Growth of well-aligned carbon nanotubes with different shapes

International Nuclear Information System (INIS)

Zhao, Tingkai; Ji, Xianglin; Liu, Hongzhen; Yao, Pengyang; Liu, Wujian; Xiong, Chuanyin; Li, Tianxin; Wang, Chen

2015-01-01

Graphical abstract: - Abstract: Well-aligned carbon nanotubes (CNTs) with different shapes, namely coiled CNTs (CCNTs), V-shape CNTs (VCNTs) and ribbon-like CNTs (RCNTs), were prepared by floating catalyst chemical vapor deposition (FC-CVD) using triethylsilane and ferrocene as catalyst precursors and xylene as carbon source. The products were characterized by transmission electron microscopy, scanning electron microscopy, X-ray diffraction and energy dispersive spectrometer. The experimental results indicated that triethylsilane limited the catalyst effectivity in the formation of the novel shapes. When the mole ratio of ferrocene and triethylsilane reached 10:1, the array morphology was maintained and several shapes appeared. It inferred that the catalyst particles were formed by two phases, namely Fe–C–Si solid solution and cementite Fe 3 C. The different absorption and desorption rates of carbon atoms between this two phases as well as the catalyst morphology change during the growth consequently lead to the formation of CCNTs and RCNTs. As for the VCNTs, it concluded that the partial inactivation of catalysts lead to two separated growth areas of CNTs which formed this CNTs. A mechanism is proposed to explain the relationships between the adding of triethylsilane and the formation of the novel structure.

Functionalization of vertically aligned carbon nanotubes

Directory of Open Access Journals (Sweden)

Eloise Van Hooijdonk

2013-02-01

Full Text Available This review focuses and summarizes recent studies on the functionalization of carbon nanotubes oriented perpendicularly to their substrate, so-called vertically aligned carbon nanotubes (VA-CNTs. The intrinsic properties of individual nanotubes make the VA-CNTs ideal candidates for integration in a wide range of devices, and many potential applications have been envisaged. These applications can benefit from the unidirectional alignment of the nanotubes, the large surface area, the high carbon purity, the outstanding electrical conductivity, and the uniformly long length. However, practical uses of VA-CNTs are limited by their surface characteristics, which must be often modified in order to meet the specificity of each particular application. The proposed approaches are based on the chemical modifications of the surface by functionalization (grafting of functional chemical groups, decoration with metal particles or wrapping of polymers to bring new properties or to improve the interactions between the VA-CNTs and their environment while maintaining the alignment of CNTs.

Functionalization of vertically aligned carbon nanotubes.

Science.gov (United States)

Van Hooijdonk, Eloise; Bittencourt, Carla; Snyders, Rony; Colomer, Jean-François

2013-01-01

This review focuses and summarizes recent studies on the functionalization of carbon nanotubes oriented perpendicularly to their substrate, so-called vertically aligned carbon nanotubes (VA-CNTs). The intrinsic properties of individual nanotubes make the VA-CNTs ideal candidates for integration in a wide range of devices, and many potential applications have been envisaged. These applications can benefit from the unidirectional alignment of the nanotubes, the large surface area, the high carbon purity, the outstanding electrical conductivity, and the uniformly long length. However, practical uses of VA-CNTs are limited by their surface characteristics, which must be often modified in order to meet the specificity of each particular application. The proposed approaches are based on the chemical modifications of the surface by functionalization (grafting of functional chemical groups, decoration with metal particles or wrapping of polymers) to bring new properties or to improve the interactions between the VA-CNTs and their environment while maintaining the alignment of CNTs.

Synthesis and interface characterization of CNTs on graphene.

Science.gov (United States)

Zhou, Changjian; Senegor, Richard; Baron, Zachary; Chen, Yihan; Raju, Salahuddin; Vyas, Anshul A; Chan, Mansun; Chai, Yang; Yang, Cary Y

2017-02-03

Carbon nanotubes (CNTs) and graphene are potential candidates for future interconnect materials. CNTs are promising on-chip via interconnect materials due to their readily formed vertical structures, their current-carrying capacity, which is much larger than existing on-chip interconnect materials such as copper and tungsten, and their demonstrated ability to grow in patterned vias with sub-50 nm widths; meanwhile, graphene is suitable for horizontal interconnects. However, they both present the challenge of having high-resistance contacts with other conductors. An all-carbon structure is proposed in this paper, which can be formed using the same chemical vapor deposition method for both CNTs and graphene. Vertically aligned CNTs are grown directly on graphene with an Fe or Ni catalyst. The structural characteristics of the graphene and the grown CNTs are analyzed using Raman spectroscopy and electron microscopy techniques. The CNT-graphene interface is studied in detail using transmission electron microscopic analysis of the CNT-graphene heterostructure, which suggests C-C bonding between the two materials. Electrical measurement results confirm the existence of both a lateral conduction path within graphene and a vertical conduction path in the CNT-graphene heterostructure, giving further support to the C-C bonding at the CNT-graphene interface and resulting in potential applications for all-carbon interconnects.

Hybrid hydrogels containing vertically aligned carbon nanotubes with anisotropic electrical conductivity for muscle myofiber fabrication.

Science.gov (United States)

Ahadian, Samad; Ramón-Azcón, Javier; Estili, Mehdi; Liang, Xiaobin; Ostrovidov, Serge; Shiku, Hitoshi; Ramalingam, Murugan; Nakajima, Ken; Sakka, Yoshio; Bae, Hojae; Matsue, Tomokazu; Khademhosseini, Ali

2014-03-19

Biological scaffolds with tunable electrical and mechanical properties are of great interest in many different fields, such as regenerative medicine, biorobotics, and biosensing. In this study, dielectrophoresis (DEP) was used to vertically align carbon nanotubes (CNTs) within methacrylated gelatin (GelMA) hydrogels in a robust, simple, and rapid manner. GelMA-aligned CNT hydrogels showed anisotropic electrical conductivity and superior mechanical properties compared with pristine GelMA hydrogels and GelMA hydrogels containing randomly distributed CNTs. Skeletal muscle cells grown on vertically aligned CNTs in GelMA hydrogels yielded a higher number of functional myofibers than cells that were cultured on hydrogels with randomly distributed CNTs and horizontally aligned CNTs, as confirmed by the expression of myogenic genes and proteins. In addition, the myogenic gene and protein expression increased more profoundly after applying electrical stimulation along the direction of the aligned CNTs due to the anisotropic conductivity of the hybrid GelMA-vertically aligned CNT hydrogels. We believe that platform could attract great attention in other biomedical applications, such as biosensing, bioelectronics, and creating functional biomedical devices.

Angular dependent anisotropic terahertz response of vertically aligned multi-walled carbon nanotube arrays with spatial dispersion

Science.gov (United States)

Zhou, Yixuan; Yiwen, E.; Xu, Xinlong; Li, Weilong; Wang, Huan; Zhu, Lipeng; Bai, Jintao; Ren, Zhaoyu; Wang, Li

2016-12-01

Spatial dispersion effect of aligned carbon nanotubes (CNTs) in the terahertz (THz) region has significance for both theoretical and applied consideration due to the unique intrinsically anisotropic physical properties of CNTs. Herein, we report the angular dependent reflection of p-polarized THz wave from vertically aligned multi-walled CNT arrays in both experiment and theory. The spectra indicate that the reflection depends on the film thickness of vertically aligned CNTs, the incident angle, and the frequency. The calculation model is based on the spatial dispersion effect of aligned CNTs and performed with effective impedance method and the Maxwell-Garnett approximation. The results fit well with the experiment when the thickness of CNT film is thin, which reveals a coherent superposition mechanism of the CNT surface reflection and CNTs/Si interface reflection. For thick CNT films, the CNTs/Si interface response determines the reflection at small incident angles, while the CNTs surface effect dominates at large incident angles. This work investigates the spatial dispersion effect of vertically aligned CNT arrays in the THz region, and paves a way for potential anisotropic THz applications based on CNTs with oblique incidence requirements.

Hierarchical structures constructed by BiOX (X = Cl, I) nanosheets on CNTs/carbon composite fibers for improved photocatalytic degradation of methyl orange

Energy Technology Data Exchange (ETDEWEB)

Weng, Baicheng, E-mail: baichengweng@gmail.com; Xu, Fenghua; Xu, Jianguang [Yancheng Institute of Technology, Materials Engineering Department (China)

2014-12-15

A hierarchical structure (CNTs/CFs-NSs) of BiOX (X = Cl, I) nanosheets (NSs) on carbon fibers (CFs) embedded with aligned carbon nanotubes (CNTs) with improved photocatalytic activities has been developed on a large scale. In the CNTs/CFs obtained by centrifugal spinning, CNTs align along the axis of the CFs, form π–π stacking interactions with CFs and strength the electrical conductivity of CFs, which favors the electron collection and transportation. Cross-flake BiOX NSs were uniformly grown on the surface of CNTs/CFs through a successive ionic layer adsorption and reaction process. The as-prepared BiOX NSs are less than 20 nm in thickness with dominant reactive (001) facets that are almost fully exposed, promoting the photocatalytic properties. The hierarchical CNTs/CFs-NSs show 3- and 2-fold improved photocatalytic activities for degradation of methyl orange for BiOCl and BiOI compared to corresponding neat NSs, respectively, given the synergistic effects of CNTs/CFs and NSs. Moreover, these novel hierarchical structures with stable performance enhance the recycled ability for the photocatalyst.

Hierarchical structures constructed by BiOX (X = Cl, I) nanosheets on CNTs/carbon composite fibers for improved photocatalytic degradation of methyl orange

International Nuclear Information System (INIS)

Weng, Baicheng; Xu, Fenghua; Xu, Jianguang

2014-01-01

A hierarchical structure (CNTs/CFs-NSs) of BiOX (X = Cl, I) nanosheets (NSs) on carbon fibers (CFs) embedded with aligned carbon nanotubes (CNTs) with improved photocatalytic activities has been developed on a large scale. In the CNTs/CFs obtained by centrifugal spinning, CNTs align along the axis of the CFs, form π–π stacking interactions with CFs and strength the electrical conductivity of CFs, which favors the electron collection and transportation. Cross-flake BiOX NSs were uniformly grown on the surface of CNTs/CFs through a successive ionic layer adsorption and reaction process. The as-prepared BiOX NSs are less than 20 nm in thickness with dominant reactive (001) facets that are almost fully exposed, promoting the photocatalytic properties. The hierarchical CNTs/CFs-NSs show 3- and 2-fold improved photocatalytic activities for degradation of methyl orange for BiOCl and BiOI compared to corresponding neat NSs, respectively, given the synergistic effects of CNTs/CFs and NSs. Moreover, these novel hierarchical structures with stable performance enhance the recycled ability for the photocatalyst

A critical evaluation of the enhancement of mechanical properties of epoxy modified using CNTs

Science.gov (United States)

Bedsole, Robert W.; Park, Cheol; Bogert, Philip B.; Tippur, Hareesh V.

2015-09-01

Carbon nanotubes (CNTs) have been widely shown in the literature to improve mechanical properties of epoxy, such as tensile strength, elastic modulus, strain to failure, and fracture toughness. These improvements in nanocomposite properties have been attributed to the extraordinary properties of the nanotubes, as well as the quality of their dispersion within and adhesion to the epoxy matrix. However, many authors have also struggled to show significant mechanical improvements using similar methodologies and despite, in some cases, showing qualitative improvements in dispersion with optical microscopy. These authors have frequently resorted to other methods for improving the mechanical properties of CNT/epoxy, such as electrically aligning CNTs, using different types of CNTs, or modifying the stoichiometry. The current work examines many different dispersion techniques, types of CNTs, types of epoxies, curing cycles, and other variables in an attempt to improve the mechanical properties of neat epoxy with CNTs. Despite seeing significant changes in the microscopy, no significant improvements in tensile or fracture properties have been attributed to CNTs in this work.

Fabrication of Vertically Aligned CNT Composite for Membrane Applications Using Chemical Vapor Deposition through In Situ Polymerization

Directory of Open Access Journals (Sweden)

Munir Mohammad

2013-01-01

Full Text Available We report the fabrication of vertically aligned carbon nanotubes (CNT composite using thermal chemical vapor deposition (CVD. A forest of vertically aligned CNTs was grown using catalytic CVD. Fluorocarbon polymer, films were deposited in the spaces between vertically aligned MWCNTs using thermal CVD apparatus developed in-house. The excessive polymer top layer was etched by exposing the sample to water plasma. Infrared spectroscopy confirmed the attachment of functional groups to CNTs. Alignment of CNTs, deposition of polymer and postetched specimens were analyzed by field emission scanning electron microscope (FE-SEM. Uniform distribution of monomodel vertically aligned CNTs embedded in the deposited polymer matrix was observed in the micrograph. Observed uniform distribution otherwise is not possible using conventional techniques such as spin coating.

Vertically aligned carbon nanotubes/diamond double-layered structure for improved field electron emission stability

Energy Technology Data Exchange (ETDEWEB)

Yang, L., E-mail: qiaoqin.yang@mail.usask.ca; Yang, Q.; Zhang, C.; Li, Y.S.

2013-12-31

A double-layered nanostructure consisting of a layer of vertically aligned Carbon Nanotubes (CNTs) and a layer of diamond beneath has been synthesized on silicon substrate by Hot Filament Chemical Vapor Deposition. The synthesis was achieved by first depositing a layer of diamond on silicon and then depositing a top layer of vertically aligned CNTs by applying a negative bias on the substrate holder. The growth of CNTs was catalyzed by a thin layer of spin-coated iron nitride. The surface morphology and structure of the CNTs/diamond double-layered structure were characterized by Scanning Electron Microscope, Energy Dispersive X-ray spectrum, and Raman Spectroscopy. Their field electron emission (FEE) properties were measured by KEITHLEY 237 high voltage measurement unit, showing much higher FEE current stability than single layered CNTs. - Highlights: • A new double-layered nanostructure consisting of a layer of vertically aligned CNTs and a layer of diamond beneath has been synthesized by hot filament chemical vapor deposition. • This double-layered structure exhibits superior field electron emission stability. • The improvement of emission stability is due to the combination of the unique properties of diamond and CNTs.

Prediction of MHC class II binding affinity using SMM-align, a novel stabilization matrix alignment method.

Science.gov (United States)

Nielsen, Morten; Lundegaard, Claus; Lund, Ole

2007-07-04

Antigen presenting cells (APCs) sample the extra cellular space and present peptides from here to T helper cells, which can be activated if the peptides are of foreign origin. The peptides are presented on the surface of the cells in complex with major histocompatibility class II (MHC II) molecules. Identification of peptides that bind MHC II molecules is thus a key step in rational vaccine design and developing methods for accurate prediction of the peptide:MHC interactions play a central role in epitope discovery. The MHC class II binding groove is open at both ends making the correct alignment of a peptide in the binding groove a crucial part of identifying the core of an MHC class II binding motif. Here, we present a novel stabilization matrix alignment method, SMM-align, that allows for direct prediction of peptide:MHC binding affinities. The predictive performance of the method is validated on a large MHC class II benchmark data set covering 14 HLA-DR (human MHC) and three mouse H2-IA alleles. The predictive performance of the SMM-align method was demonstrated to be superior to that of the Gibbs sampler, TEPITOPE, SVRMHC, and MHCpred methods. Cross validation between peptide data set obtained from different sources demonstrated that direct incorporation of peptide length potentially results in over-fitting of the binding prediction method. Focusing on amino terminal peptide flanking residues (PFR), we demonstrate a consistent gain in predictive performance by favoring binding registers with a minimum PFR length of two amino acids. Visualizing the binding motif as obtained by the SMM-align and TEPITOPE methods highlights a series of fundamental discrepancies between the two predicted motifs. For the DRB1*1302 allele for instance, the TEPITOPE method favors basic amino acids at most anchor positions, whereas the SMM-align method identifies a preference for hydrophobic or neutral amino acids at the anchors. The SMM-align method was shown to outperform other

Prediction of MHC class II binding affinity using SMM-align, a novel stabilization matrix alignment method

Directory of Open Access Journals (Sweden)

Lund Ole

2007-07-01

Full Text Available Abstract Background Antigen presenting cells (APCs sample the extra cellular space and present peptides from here to T helper cells, which can be activated if the peptides are of foreign origin. The peptides are presented on the surface of the cells in complex with major histocompatibility class II (MHC II molecules. Identification of peptides that bind MHC II molecules is thus a key step in rational vaccine design and developing methods for accurate prediction of the peptide:MHC interactions play a central role in epitope discovery. The MHC class II binding groove is open at both ends making the correct alignment of a peptide in the binding groove a crucial part of identifying the core of an MHC class II binding motif. Here, we present a novel stabilization matrix alignment method, SMM-align, that allows for direct prediction of peptide:MHC binding affinities. The predictive performance of the method is validated on a large MHC class II benchmark data set covering 14 HLA-DR (human MHC and three mouse H2-IA alleles. Results The predictive performance of the SMM-align method was demonstrated to be superior to that of the Gibbs sampler, TEPITOPE, SVRMHC, and MHCpred methods. Cross validation between peptide data set obtained from different sources demonstrated that direct incorporation of peptide length potentially results in over-fitting of the binding prediction method. Focusing on amino terminal peptide flanking residues (PFR, we demonstrate a consistent gain in predictive performance by favoring binding registers with a minimum PFR length of two amino acids. Visualizing the binding motif as obtained by the SMM-align and TEPITOPE methods highlights a series of fundamental discrepancies between the two predicted motifs. For the DRB1*1302 allele for instance, the TEPITOPE method favors basic amino acids at most anchor positions, whereas the SMM-align method identifies a preference for hydrophobic or neutral amino acids at the anchors. Conclusion

Effect of CNTs dispersion on the thermal and mechanical properties of Cu/CNTs nanocomposites

Energy Technology Data Exchange (ETDEWEB)

Muhsan, Ali Samer, E-mail: alisameer2007@gmail.com, E-mail: faizahmad@petronas.com.my; Ahmad, Faiz, E-mail: alisameer2007@gmail.com, E-mail: faizahmad@petronas.com.my; Yusoff, Puteri Sri Melor Megat Bt, E-mail: puteris@petronas.com.my [Department of Mechanical Engineering, Universiti Teknologi PETRONAS (UTP) (Malaysia); Mohamed, Norani M., E-mail: noranimuti-mohamed@petronas.com.my [Centre of Innovative Nanostructures and Nanodevices (COINN), UTP (Malaysia); Raza, M. Rafi, E-mail: rafirazamalik@gmail.com [Universiti Kebangsaan Malaysia, 43600, Bangi, Selangor (Malaysia)

2014-10-24

Modified technique of metal injection molding (MIM) was used to fabricate multiwalled carbon nanotube (CNT) reinforced Cu nanocomposites. The effect of adding different amount of CNTs (0-10 vol.%) on the thermal and mechanical behaviour of the fabricated nanocomposites is presented. Scanning electron microscope analysis revealed homogenous dispersion of CNTs in Cu matrices at different CNTs contents. The experimentally measured thermal conductivities of Cu/CNTs nanocomposites showed extraordinary increase (76% higher than pure sintered Cu) with addition of 10 vol.% CNTs. As compared to the pure sintered Cu, increase in modulus of elasticity (Young's modulus) of Cu/CNTs nanocomposites sintered at 1050°C for 2.5 h was measured to be 48%. However, in case of 7.5 vol.% CNTs, Young's modulus was increased significantly about 51% compared to that of pure sintered Cu.

Controlled Deposition and Alignment of Carbon Nanotubes

Science.gov (United States)

Smits, Jan M. (Inventor); Wincheski, Russell A. (Inventor); Patry, JoAnne L. (Inventor); Watkins, Anthony Neal (Inventor); Jordan, Jeffrey D. (Inventor)

2012-01-01

A carbon nanotube (CNT) attraction material is deposited on a substrate in the gap region between two electrodes on the substrate. An electric potential is applied to the two electrodes. The CNT attraction material is wetted with a solution defined by a carrier liquid having carbon nanotubes (CNTs) suspended therein. A portion of the CNTs align with the electric field and adhere to the CNT attraction material. The carrier liquid and any CNTs not adhered to the CNT attraction material are then removed.

Measuring Parameters of Massive Black Hole Binaries with Partially-Aligned Spins

Science.gov (United States)

Lang, Ryan N.; Hughes, Scott A.; Cornish, Neil J.

2010-01-01

It is important to understand how well the gravitational-wave observatory LISA can measure parameters of massive black hole binaries. It has been shown that including spin precession in the waveform breaks degeneracies and produces smaller expected parameter errors than a simpler, precession-free analysis. However, recent work has shown that gas in binaries can partially align the spins with the orbital angular momentum, thus reducing the precession effect. We show how this degrades the earlier results, producing more pessimistic errors in gaseous mergers. However, we then add higher harmonics to the signal model; these also break degeneracies, but they are not affected by the presence of gas. The harmonics often restore the errors in partially-aligned binaries to the same as, or better than/ those that are obtained for fully precessing binaries with no harmonics. Finally, we investigate what LISA measurements of spin alignment can tell us about the nature of gas around a binary,

Fabrication and microstructure of CNTs activated sintered W–Nb alloys

International Nuclear Information System (INIS)

Sha, J.J.; Hao, X.N.; Li, J.; Wang, Z.

2014-01-01

Highlights: • Fabrication and microstructure of CNTs activated sintered W-Nb alloys were investigated. • CNTs could significantly enhance the sintering ability of W-Nb alloys at a low temperature. • The improved sintering was due to the enhanced diffusion of W atoms along the GBs induced by CNTs. • The grain size in CNTs activated sintered W-Nb alloys decreased with increasing the Nb content. -- Abstract: In order to fabricate highly dense W-based alloys at low temperature, in the present work, high-energy ball milling and hot pressing were applied to fabricate W–Nb alloys (mass fraction of Nb varied from 0.5% to 5%), where CNTs were used as the activated sintering additives. The phase composition and microstructure were characterized by XRD and SEM equipped with EDS, respectively. The study found coupled effects of CNTs activated sintering and Nb addition on the enhanced sintering ability and refined microstructure of W at 1500 °C. The main results are: (i) XRD characterization revealed that the high-energy ball milling could significantly reduce the crystallite size of W particles and increase lattice distortion, which would enhance the sintering behavior of W alloys. (ii) The addition of CNTs to W (W–0.1CNTs) led to the formation of nanoscale interfacial layer between W grains during hot pressing, resulting in considerable densification and grain growth. Based on this result, it suggested that the activated sintering of W in the present work is due to an enhanced diffusion of W atoms along the GBs induced by CNTs. (iii) With the addition of CNTs to W–Nb alloys, the densification was improved again, but was not so obvious. The optimal densification was obtained for the W–0.1CNTs–1Nb specimen. Moreover, the microstructure characterization in CNTs activated sintered W–Nb alloys indicated that the distribution of sphere-like W(Nb) solid solution particles and decreased W grain sizes with increasing Nb content are the main microstructure features

High-performance field emission device utilizing vertically aligned carbon nanotubes-based pillar architectures

Science.gov (United States)

Gupta, Bipin Kumar; Kedawat, Garima; Gangwar, Amit Kumar; Nagpal, Kanika; Kashyap, Pradeep Kumar; Srivastava, Shubhda; Singh, Satbir; Kumar, Pawan; Suryawanshi, Sachin R.; Seo, Deok Min; Tripathi, Prashant; More, Mahendra A.; Srivastava, O. N.; Hahm, Myung Gwan; Late, Dattatray J.

2018-01-01

The vertical aligned carbon nanotubes (CNTs)-based pillar architectures were created on laminated silicon oxide/silicon (SiO2/Si) wafer substrate at 775 °C by using water-assisted chemical vapor deposition under low pressure process condition. The lamination was carried out by aluminum (Al, 10.0 nm thickness) as a barrier layer and iron (Fe, 1.5 nm thickness) as a catalyst precursor layer sequentially on a silicon wafer substrate. Scanning electron microscope (SEM) images show that synthesized CNTs are vertically aligned and uniformly distributed with a high density. The CNTs have approximately 2-30 walls with an inner diameter of 3-8 nm. Raman spectrum analysis shows G-band at 1580 cm-1 and D-band at 1340 cm-1. The G-band is higher than D-band, which indicates that CNTs are highly graphitized. The field emission analysis of the CNTs revealed high field emission current density (4mA/cm2 at 1.2V/μm), low turn-on field (0.6 V/μm) and field enhancement factor (6917) with better stability and longer lifetime. Emitter morphology resulting in improved promising field emission performances, which is a crucial factor for the fabrication of pillared shaped vertical aligned CNTs bundles as practical electron sources.

High-performance field emission device utilizing vertically aligned carbon nanotubes-based pillar architectures

Directory of Open Access Journals (Sweden)

Bipin Kumar Gupta

2018-01-01

Full Text Available The vertical aligned carbon nanotubes (CNTs-based pillar architectures were created on laminated silicon oxide/silicon (SiO2/Si wafer substrate at 775 °C by using water-assisted chemical vapor deposition under low pressure process condition. The lamination was carried out by aluminum (Al, 10.0 nm thickness as a barrier layer and iron (Fe, 1.5 nm thickness as a catalyst precursor layer sequentially on a silicon wafer substrate. Scanning electron microscope (SEM images show that synthesized CNTs are vertically aligned and uniformly distributed with a high density. The CNTs have approximately 2–30 walls with an inner diameter of 3–8 nm. Raman spectrum analysis shows G-band at 1580 cm−1 and D-band at 1340 cm−1. The G-band is higher than D-band, which indicates that CNTs are highly graphitized. The field emission analysis of the CNTs revealed high field emission current density (4mA/cm2 at 1.2V/μm, low turn-on field (0.6 V/μm and field enhancement factor (6917 with better stability and longer lifetime. Emitter morphology resulting in improved promising field emission performances, which is a crucial factor for the fabrication of pillared shaped vertical aligned CNTs bundles as practical electron sources.

Microwave and Millimeter Wave Properties of Vertically-Aligned Single Wall Carbon Nanotubes Films

Science.gov (United States)

Haddadi, K.; Tripon-Canseliet, C.; Hivin, Q.; Ducournau, G.; Teo, E.; Coquet, P.; Tay, B. K.; Lepilliet, S.; Avramovic, V.; Chazelas, J.; Decoster, D.

2016-05-01

We present the experimental determination of the complex permittivity of vertically aligned single wall carbon nanotubes (SWCNTs) films grown on quartz substrates in the microwave regime from 10 MHz up to 67 GHz, with the electrical field perpendicular to the main axis of the carbon nanotubes (CNTs), based on coplanar waveguide transmission line approach together with the measurement of the microwave impedance of top metalized vertically—aligned SWCNTs grown on conductive silicon substrates up to 26 GHz. From coplanar waveguide measurements, we obtain a real part of the permittivity almost equal to unity, which is interpreted in terms of low carbon atom density (3 × 1019 at/cm3) associated with a very low imaginary part of permittivity (vertically aligned CNTs bundle equivalent to a low resistance reveals a good conductivity (3 S/cm) parallel to the CNTs axis. From these two kinds of data, we experimentally demonstrate the tensor nature of the vertically grown CNTs bundles.

Tuning vertical alignment and field emission properties of multi-walled carbon nanotube bundles

Science.gov (United States)

Sreekanth, M.; Ghosh, S.; Srivastava, P.

2018-01-01

We report the growth of vertically aligned carbon nanotube bundles on Si substrate by thermal chemical vapor deposition technique. Vertical alignment was achieved without any carrier gas or lithography-assisted deposition. Growth has been carried out at 850 °C for different quantities of solution of xylene and ferrocene ranging from 2.25 to 3.00 ml in steps of 0.25 ml at a fixed concentration of 0.02 gm (ferrocene) per ml. To understand the growth mechanism, deposition was carried out for different concentrations of the solution by changing only the ferrocene quantity, ranging from 0.01 to 0.03 gm/ml. A tunable vertical alignment of multi-walled carbon nanotubes (CNTs) has been achieved by this process and examined by scanning and transmission electron microscopic techniques. Micro-crystalline structural analysis has been done using Raman spectroscopy. A systematic variation in field emission (FE) current density has been observed. The highest FE current density is seen for the film grown with 0.02 gm/ml concentration, which is attributed to the better alignment of CNTs, less structural disorder and less entanglement of CNTs on the surface. The alignment of CNTs has been qualitatively understood on the basis of self-assembled catalytic particles.

Polymer-derived ceramic composite fibers with aligned pristine multiwalled carbon nanotubes.

Science.gov (United States)

Sarkar, Sourangsu; Zou, Jianhua; Liu, Jianhua; Xu, Chengying; An, Linan; Zhai, Lei

2010-04-01

Polymer-derived ceramic fibers with aligned multiwalled carbon nanotubes (MWCNTs) are fabricated through the electrospinning of polyaluminasilazane solutions with well-dispersed MWCNTs followed by pyrolysis. Poly(3-hexylthiophene)-b-poly (poly (ethylene glycol) methyl ether acrylate) (P3HT-b-PPEGA), a conjugated block copolymer compatible with polyaluminasilazane, is used to functionalize MWCNT surfaces with PPEGA, providing a noninvasive approach to disperse carbon nanotubes in polyaluminasilazane chloroform solutions. The electrospinning of the MWCNT/polyaluminasilazane solutions generates polymer fibers with aligned MWCNTs where MWCNTs are oriented along the electrospun jet by a sink flow. The subsequent pyrolysis of the obtained composite fibers produces ceramic fibers with aligned MWCNTs. The study of the effect of polymer and CNT concentration on the fiber structures shows that the fiber size increases with the increment of polymer concentration, whereas higher CNT content in the polymer solutions leads to thinner fibers attributable to the increased conductivity. Both the SEM and TEM characterization of the polymer and ceramic fibers demonstrates the uniform orientation of CNTs along the fibers, suggesting excellent dispersion of CNTs and efficient CNT alignment via the electrospinning. The electrical conductivity of a ceramic fibers with 1.2% aligned MWCNTs is measured to be 1.58 x 10(-6) S/cm, which is more than 500 times higher than that of bulk ceramic (3.43 x 10(-9) S/cm). Such an approach provides a versatile method to disperse CNTs in preceramic polymer solutions and offers a new approach to integrate aligned CNTs in ceramics.

Ultra-high density aligned Carbon-nanotube with controled nano-morphology for supercapacitors

Science.gov (United States)

Ghaffari, Mehdi; Zhao, Ran; Liu, Yang; Zhou, Yue; Cheng, Jiping; Guzman de Villoria, Roberto; Wardle, B. L.; Zhang, Q. M.

2012-02-01

Recent advances in fabricating controlled-morphology vertically aligned carbon nanotubes (VA-CNTs) with ultrahigh volume fractioncreate unique opportunities for developing unconventional supercapacitors with ultra-high energy density, power density, and long charge/discharge cycle life.Continuous paths through inter-VA-CNT channels allow fast ion transport, and high electrical conduction of the aligned CNTs in the composite electrodes lead to fast discharge speed. We investigate the charge-discharge characteristics of VA-CNTs with >20 vol% of CNT and ionic liquids as electrolytes. By employing both the electric and electromechanical spectroscopes, as well as nanostructured materials characterization, the ion transport and storage behaviors in porous electrodes are studied. The results suggest pathways for optimizing the electrode morphology in supercapacitorsusing ultra-high volume fraction VA-CNTs to further enhance performance.

CNTs reinforced super-hydrophobic-oleophilic electrospun polystyrene oil sorbent for enhanced sorption capacity and reusability

KAUST Repository

Wu, Jingya

2016-12-05

To meet the challenges of global oil spills and oil-water contamination, the development of a low-cost and reusable sorbents with good hydrophobicity and oleophilic nature is crucial. In this study, functionalized carbon nanotubes (CNTs) were wrapped in polystyrene (PS) polymer (PS-CNTs) and electrospun to create an effective and rigid sorbent for oil. Covalent modification and fluorination of CNTs improved their dispersibility and interfacial interaction with the polymer, resulting in a well-aligned CNTs configuration inside the porous fiber structure. Interestingly, the oil sorption process using PS-CNTs was observed to have two phases. First, the oil swiftly entered the membrane pores formed by interconnected nanofibers due to oleophilic properties of the micro-sized void. In the second phase, the oil not only moved to nano interior spaces of the fibers by capillary forces but also adsorbed on the surface of fibers where the latter was retained due to Van der Waals force. The sorption process fits well with the intra particle diffusion model. Maximum oil sorption capacity of the PS-CNTs sorbent for sunflower oil, peanut oil, and motor oils were 116, 123, and 112 g/g, respectively, which was 65% higher than that of the PS sorbent without CNTs. Overall, a significant increase in the porosity, surface area, water contact angle, and oleophilic nature was observed for the PS-CNTs composite sorbents. Not only did the PS-CNTs sorbents exhibited a promising oil sorption capacity but also showed potential for reusability, which is an important factor to be considered in determining the overall performance of the sorbent and its environmental impacts.

CNTs reinforced super-hydrophobic-oleophilic electrospun polystyrene oil sorbent for enhanced sorption capacity and reusability

KAUST Repository

Wu, Jingya; Kyoungjin An, Alicia; Guo, Jiaxin; Lee, Eui-Jong; Usman Farid, Muhammad; Jeong, Sanghyun

2016-01-01

To meet the challenges of global oil spills and oil-water contamination, the development of a low-cost and reusable sorbents with good hydrophobicity and oleophilic nature is crucial. In this study, functionalized carbon nanotubes (CNTs) were wrapped in polystyrene (PS) polymer (PS-CNTs) and electrospun to create an effective and rigid sorbent for oil. Covalent modification and fluorination of CNTs improved their dispersibility and interfacial interaction with the polymer, resulting in a well-aligned CNTs configuration inside the porous fiber structure. Interestingly, the oil sorption process using PS-CNTs was observed to have two phases. First, the oil swiftly entered the membrane pores formed by interconnected nanofibers due to oleophilic properties of the micro-sized void. In the second phase, the oil not only moved to nano interior spaces of the fibers by capillary forces but also adsorbed on the surface of fibers where the latter was retained due to Van der Waals force. The sorption process fits well with the intra particle diffusion model. Maximum oil sorption capacity of the PS-CNTs sorbent for sunflower oil, peanut oil, and motor oils were 116, 123, and 112 g/g, respectively, which was 65% higher than that of the PS sorbent without CNTs. Overall, a significant increase in the porosity, surface area, water contact angle, and oleophilic nature was observed for the PS-CNTs composite sorbents. Not only did the PS-CNTs sorbents exhibited a promising oil sorption capacity but also showed potential for reusability, which is an important factor to be considered in determining the overall performance of the sorbent and its environmental impacts.

Nanoparticle fractionation using an aligned carbon nanotube array

Energy Technology Data Exchange (ETDEWEB)

Lim Xiaodai [NUS Graduate School for Integrative Sciences and Engineering (NGS), Centre for Life Sciences (CeLS), 05-01, 28 Medical Drive, 117456 (Singapore); Xu Hairuo; Chin, Wee Shong [Department of Chemistry, Faculty of Science, National University of Singapore, 3 Science Drive 3, 117543 (Singapore); Nicole Chew, Yi Hui; Phua, Yi Hui [Dunman High School, 10 Tanjong Rhu Road, 436895 (Singapore); Sie, Edbert Jarvis; Sum, Tze Chien [Division of Physics and Applied Physics, School of Physical and Mathematical Sciences, Nanyang Technological University, 637371 (Singapore); Chia, Guo Hao; Sow, Chorng-Haur, E-mail: chmcws@nus.edu.sg, E-mail: physowch@nus.edu.sg [Department of Physics, Blk S12, Faculty of Science, National University of Singapore, 2 Science Drive 3, 117542 (Singapore)

2010-07-23

A technique utilizing the capillary assisted sieving capability of carbon nanotubes (CNTs) to achieve fractionation of nanoparticles of small size distribution is presented. By dipping aligned CNT arrays into a solution comprising different sized quantum dots (QDs), size-selective gradient decoration of QDs onto CNTs is achieved. The fractionating capability of CNTs is also demonstrated for poly-dispersed manganese doped zinc sulfide nanoparticles and QDs of varying sizes and chemical compositions, which we attribute to the size-selective sieving effect of CNTs. By controlling the terminating point for the flow of QDs across the CNT array, a QD size specific CNT/QD hybrid structure is achieved.

Prediction of MHC class II binding affinity using SMM-align, a novel stabilization matrix alignment method

DEFF Research Database (Denmark)

Nielsen, Morten; Lundegaard, Claus; Lund, Ole

2007-01-01

the correct alignment of a peptide in the binding groove a crucial part of identifying the core of an MHC class II binding motif. Here, we present a novel stabilization matrix alignment method, SMM-align, that allows for direct prediction of peptide:MHC binding affinities. The predictive performance...... of the method is validated on a large MHC class II benchmark data set covering 14 HLA-DR (human MHC) and three mouse H2-IA alleles. RESULTS: The predictive performance of the SMM-align method was demonstrated to be superior to that of the Gibbs sampler, TEPITOPE, SVRMHC, and MHCpred methods. Cross validation...... between peptide data set obtained from different sources demonstrated that direct incorporation of peptide length potentially results in over-fitting of the binding prediction method. Focusing on amino terminal peptide flanking residues (PFR), we demonstrate a consistent gain in predictive performance...

Synthesis and electroconductivity of epoxy/aligned CNTs composites

Energy Technology Data Exchange (ETDEWEB)

Chechenin, N.G., E-mail: chechenin@sinp.msu.ru [Skobeltsyn Institute of Nuclear Physics, Lomonosov Moscow State University, Moscow, Leninskie Gory 1/2, 119234 (Russian Federation); Chernykh, P.N.; Vorobyeva, E.A.; Timofeev, O.S. [Skobeltsyn Institute of Nuclear Physics, Lomonosov Moscow State University, Moscow, Leninskie Gory 1/2, 119234 (Russian Federation)

2013-06-15

An efficient method is described of growing of vertically aligned carbon nanotubes (VANTs) densely packed on a large area with uniform height up to 1 mm. The method is based on injection of active solution of ferrocene in cyclohexane into reactor during the growth process. We also describe a method of ER/VANTs composite preparation based on infiltration of epoxy resin (ER) liquid monomer into arrays of the VANTs forest with polymerization followed. Further on we describe a press-and-draw method to reorient VANTs into horizontally aligned carbon nanotubes (HANTs) in the liquid composite precursor. The electrical conductivities up to 0.6 S/cm in ER/VANTs and up to 0.85 S/cm in ER/HANTs are obtained.

Synthesis and electroconductivity of epoxy/aligned CNTs composites

International Nuclear Information System (INIS)

Chechenin, N.G.; Chernykh, P.N.; Vorobyeva, E.A.; Timofeev, O.S.

2013-01-01

An efficient method is described of growing of vertically aligned carbon nanotubes (VANTs) densely packed on a large area with uniform height up to 1 mm. The method is based on injection of active solution of ferrocene in cyclohexane into reactor during the growth process. We also describe a method of ER/VANTs composite preparation based on infiltration of epoxy resin (ER) liquid monomer into arrays of the VANTs forest with polymerization followed. Further on we describe a press-and-draw method to reorient VANTs into horizontally aligned carbon nanotubes (HANTs) in the liquid composite precursor. The electrical conductivities up to 0.6 S/cm in ER/VANTs and up to 0.85 S/cm in ER/HANTs are obtained.

Ionic Liquid-Assisted Synthesis of a NiO/CNTs Composite and Its Electrochemical Capacitance

Directory of Open Access Journals (Sweden)

Yitong Chen

2014-01-01

Full Text Available A novel solid-state method has been developed for synthesizing nickel oxide (NiO/carbon nanotubes (CNTs composite using an ionic liquid (IL, 1-butyl-3-methylimidazolium chloride as the reaction medium. Ultraviolet-visible (UV-vis absorbance spectroscopy, infrared spectroscopy (IR, and scanning electron microscopy (SEM were employed to investigate the structure, morphology, and formation mechanism of the synthesized sample. The results demonstrated that the IL is effective for dispersing CNTs, which allows the tethering of nickel (II ions onto the surfaces of the CNTs and facilitates the subsequent chemical deposition of NiO to obtain the NiO/CNTs composite. The electrochemical properties of the composite were determined using cyclic voltammetry and galvanostatic charge/discharge measurements in 6 M KOH. Because of its unique structure, the prepared NiO/CNTs electrode exhibited good capacitive behavior and cyclability. The high specific capacitance (521 F g−1 and good rate capability (91% capacity retention at 0.5 A g−1 of the NiO/CNTs composite enable its use as a practical supercapacitor electrode material.

Electrostatically Induced Carbon Nanotube Alignment for Polymer Composite Applications

Science.gov (United States)

Chapkin, Wesley Aaron

We have developed a non-invasive technique utilizing polarized Raman spectroscopy to measure changes in carbon nanotube (CNT) alignment in situ and in real time in a polymer matrix. With this technique, we have confirmed the prediction of faster alignment for CNTs in higher electric fields. Real-time polarized Raman spectroscopy also allows us to demonstrate the loss of CNT alignment that occurs after the electric field is removed, which reveals the need for fast polymerization steps or the continued application of the aligning force during polymerization to lock in CNT alignment. Through a study on the effect of polymer viscosity on the rate of CNT alignment, we have determined that shear viscosity serves as the controlling mechanism for CNT rotation. This finding matches literature modeling of rigid rod mobility in a polymer melt and demonstrates that the rotational mobility of CNTs can be explained by a continuum model even though the diameters of single-walled CNTs are 1-2 nm. The viscosity dependence indicates that the manipulation of temperature (and indirectly viscosity) will have a direct effect on the rate of CNT alignment, which could prove useful in expediting the manufacturing of CNT-reinforced composites cured at elevated temperatures. Using real-time polarized Raman spectroscopy, we also demonstrate that electric fields of various strengths lead not only to different speeds of CNT rotation but also to different degrees of alignment. We hypothesize that this difference in achievable alignment results from discrete populations of nanotubes based on their length. The results are then explained by balancing the alignment energy for a given electric field strength with the randomizing thermal energy of the system. By studying the alignment dynamics of different CNT length distributions, we show that different degrees of alignment achieved as a function of the applied electric field strength are directly related to the square of the nanotube length. This

Investigation of Accelerated Partial Breast Patient Alignment and Treatment With Helical Tomotherapy Unit

International Nuclear Information System (INIS)

Langen, Katja M.; Buchholz, Daniel J.; Burch, Doug R. C.; Burkavage, Rob C.; Limaye, Arti U.; Meeks, Sanford L.; Kupelian, Patrick A.; Ruchala, Kenneth J.; Haimerl, Jason; Henderson, Doug; Olivera, Gustavo H.

2008-01-01

Purpose: To determine the precision of megavoltage computed tomography (MVCT)-based alignment of the seroma cavity for patients undergoing partial breast irradiation; and to determine whether accelerated partial breast irradiation (APBI) plans can be generated for TomoTherapy deliveries that meet the National Surgical Adjuvant Breast and Bowel Project (NSABP) B-39/Radiation Therapy Oncology Group (RTOG) 0413 protocol guidelines for target coverage and normal tissue dose limitations. Methods and Materials: We obtained 50 MVCT images from 10 patients. An interuser study was designed to assess the alignment precision. Using a standard helical and a fixed beam prototype ('topotherapy') optimizer, two APBI plans for each patient were developed. Results: The precision of the MVCT-based seroma cavity alignment was better than 2 mm if averaged over the patient population. Both treatment techniques could be used to generate acceptable APBI plans for patients that fulfilled the recommended NSABP B-39/RTOG-0413 selection criteria. For plans of comparable treatment time, the conformation of the prescription dose to the target was greater for helical deliveries, while the ipsilateral lung dose was significantly reduced for the topotherapy plans. Conclusions: The inherent volumetric imaging capabilities of a TomoTherapy Hi-Art unit allow for alignment of patients undergoing partial breast irradiation that is determined from the visibility of the seroma cavity on the MVCT image. The precision of the MVCT-based alignment was better than 2 mm (± standard deviation) when averaged over the patient population. Using the NSABP B-39/RTOG-0413 guidelines, acceptable APBI treatment plans can be generated using helical- or topotherapy-based delivery techniques

NN-align. An artificial neural network-based alignment algorithm for MHC class II peptide binding prediction

DEFF Research Database (Denmark)

Nielsen, Morten; Lund, Ole

2009-01-01

this binding event. RESULTS: Here, we present a novel artificial neural network-based method, NN-align that allows for simultaneous identification of the MHC class II binding core and binding affinity. NN-align is trained using a novel training algorithm that allows for correction of bias in the training data...

Heat transfer augmentation in rectangular micro channel covered with vertically aligned carbon nanotubes

NARCIS (Netherlands)

Taha, T.J.; Lefferts, Leonardus; van der Meer, Theodorus H.

2016-01-01

An experimental heat transfer investigation was carried out to examine the influence of carbon nanotubes (CNTs) layer deposits on the convective heat transfer performance inside rectangular microchannels. Successful synthesis of vertically aligned CNTs was achieved using a catalytic vapor deposition

Preparation and Characterization of Highly Aligned Carbon Nanotubes/Polyacrylonitrile Composite Nanofibers

Directory of Open Access Journals (Sweden)

Yanhua Song

2017-01-01

Full Text Available In the electrospinning process, a modified parallel electrode method (MPEM, conducted by placing a positively charged ring between the needle and the parallel electrode collector, was used to fabricate highly aligned carbon nanotubes/polyacrylonitrile (CNTs/PAN composite nanofibers. Characterizations of the samples—such as morphology, the degree of alignment, and mechanical and conductive properties—were investigated by a combination of scanning electron microscopy (SEM, transmission electron microscopy (TEM, universal testing machine, high-resistance meter, and other methods. The results showed the MPEM could improve the alignment and uniformity of electrospun CNTs/PAN composite nanofibers, and enhance their mechanical and conductive properties. This meant the successful preparation of highly aligned CNT-reinforced PAN nanofibers with enhanced physical properties, suggesting their potential application in appliances and communication areas.

Highly aligned carbon nanotube arrays fabricated by bias sputtering

International Nuclear Information System (INIS)

Hayashi, Nobuyuki; Honda, Shin-ichi; Tsuji, Keita; Lee, Kuei-Yi; Ikuno, Takashi; Fujimoto, Keiichi; Ohkura, Shigeharu; Katayama, Mitsuhiro; Oura, Kenjiro; Hirao, Takashi

2003-01-01

Vertically aligned carbon nanotube (CNT) arrays have been successfully grown on Si substrates by dc bias sputtering. Scanning electron microscopy (SEM) and transmission electron microscopy (TEM) observations revealed that the resultant arrays consisted of dense CNTs with diameters of 40-60 nm and lengths of 300-400 nm. The CNTs were found to have a bamboo-like structure at the end of which metallic nanoparticle was formed, indicating tip growth mechanism. The energy enhancement of carbon particles is a key factor for synthesis of CNTs using dc bias sputtering system

NN-align. An artificial neural network-based alignment algorithm for MHC class II peptide binding prediction

Directory of Open Access Journals (Sweden)

Lund Ole

2009-09-01

Full Text Available Abstract Background The major histocompatibility complex (MHC molecule plays a central role in controlling the adaptive immune response to infections. MHC class I molecules present peptides derived from intracellular proteins to cytotoxic T cells, whereas MHC class II molecules stimulate cellular and humoral immunity through presentation of extracellularly derived peptides to helper T cells. Identification of which peptides will bind a given MHC molecule is thus of great importance for the understanding of host-pathogen interactions, and large efforts have been placed in developing algorithms capable of predicting this binding event. Results Here, we present a novel artificial neural network-based method, NN-align that allows for simultaneous identification of the MHC class II binding core and binding affinity. NN-align is trained using a novel training algorithm that allows for correction of bias in the training data due to redundant binding core representation. Incorporation of information about the residues flanking the peptide-binding core is shown to significantly improve the prediction accuracy. The method is evaluated on a large-scale benchmark consisting of six independent data sets covering 14 human MHC class II alleles, and is demonstrated to outperform other state-of-the-art MHC class II prediction methods. Conclusion The NN-align method is competitive with the state-of-the-art MHC class II peptide binding prediction algorithms. The method is publicly available at http://www.cbs.dtu.dk/services/NetMHCII-2.0.

A one-step technique to prepare aligned arrays of carbon nanotubes

Energy Technology Data Exchange (ETDEWEB)

Mahanandia, Pitamber [Department of Physics, Indian Institute of Science, Bangalore 560012 (India); Nanda, Karuna Kar [Materials Research Centre, Indian Institute of Science, Bangalore 560012 (India)], E-mail: pitam@physics.iisc.ernet.in

2008-04-16

A simple effective pyrolysis technique has been developed to synthesize aligned arrays of multi-walled carbon nanotubes (MWCNTs) without using any carrier gas in a single-stage furnace at 700 deg. C. This technique eliminates nearly the entire complex and expensive machinery associated with other extensively used methods for preparation of CNTs such as chemical vapour deposition (CVD) and pyrolysis. Carbon source materials such as xylene, cyclohexane, camphor, hexane, toluene, pyridine and benzene have been pyrolyzed separately with the catalyst source material ferrocene to obtain aligned arrays of MWCNTs. The synthesized CNTs have been characterized by scanning electron microscopy (SEM), x-ray diffraction (XRD), transmission electron microscopy (TEM), thermogravimetric analysis (TGA) and Raman spectroscopy. In this technique, the need for the tedious and time-consuming preparation of metal catalysts and continuously fed carbon source material containing carrier gas can be avoided. This method is a single-step process where not many parameters are required to be monitored in order to prepare aligned MWCNTs. For the production of CNTs, the technique has great advantages such as low cost and easy operation.

CNTs Modified and Enhanced Cu Matrix Composites

Directory of Open Access Journals (Sweden)

ZHANG Wen-zhong

2016-12-01

Full Text Available The composite powders of 2%-CNTs were prepared by wet ball milling and hydrogen annealing treatment-cold pressing sintering was used to consolidate the ball milled composite powders with different modifications of the CNTs. The results show that the length of the CNTs is shortened, ports are open, and amorphous carbon content is increased by ball milling. And after a mixed acid purification, the impurity on the surface of the CNTs is completely removed,and a large number of oxygen-containing reactive groups are introduced; the most of CNTs can be embedded in the Cu matrix and the CNTs have a close bonding with the Cu matrix, forming the lamellar composite structure, then, ultrafine-grained composite powders can be obtained by hydrogen annealing treatment. Shortening and purification of the CNTs are both good for dispersion and bonding of CNTs in the Cu matrix, and the tensile strength and hardness of the composites after shortening and purification reaches the highest, and is 296MPa and 139.8HV respectively, compared to the matrix, up to 123.6% in tensile strength and 42.9% in hardness, attributed to the fine grain strengthening and load transferring.

Liquid-phase synthesis of vertically aligned carbon nanotubes and related nanomaterials on preheated alloy substrates

Science.gov (United States)

Yamagiwa, Kiyofumi

2018-02-01

Carbon nanotubes (CNTs) and related nanocarbons were selectively synthesized on commercially available alloy substrates by a simple liquid-phase technique. Fe- and Ni-rich stainless-steel (JIS SUS316L and Inconel®600, respectively) and Ni-Cu alloy (Monel®400) substrates were used for the synthesis, and each substrate was preheated in air to promote the self-formation of catalyst nanolayers on the surface. The substrates were resistance heated in ethanol without any addition of catalysts to grow CNTs. The yield of the CNTs effectively increased when the preheating process was employed. Highly aligned CNT arrays grew on the SUS316L substrate, while non-aligned CNTs and distinctive twisted fibers were observed on the other substrates. An Fe oxide layer was selectively formed on the preheated SUS316L substrate promoting the growth of the CNT arrays. Characterizations including cyclic voltammetry for the arrays revealed that the CNTs possess a comparatively defect-rich surface, which is a desirable characteristic for its application such as electrode materials for capacitors.

Catalyst free growth of CNTs by CVD on nanoscale rough surfaces of silicon substrates

Science.gov (United States)

Damodar, D.; Sahoo, R. K.; Jacob, C.

2013-06-01

Catalyst free growth of carbon nanotubes (CNT) has been achieved using atmospheric pressure chemical vapor deposition (APCVD) on surface modified Si(111) substrates. The effect of the substrate surface has been observed by partially etching with KOH (potassium hydroxide) solution which is an anisotropic etchant. Scanning electron microscopy (SEM) confirmed the formation of CNTs over most of the area of the substrate where substrates were anisotropically etched. Transmission electron microscopy (TEM) was used to observe the internal structure of the CNTs. Raman spectroscopy further confirmed the formation of the carbon nanostructures and also their graphitic crystallinity.

Simultaneous alignment and dispersion of carbon nanotubes with lyotropic liquid crystals

NARCIS (Netherlands)

Lagerwall, J.P.F.; Scalia, G.; Haluska, M.; Dettlaff-Weglikowska, U.; Giesselmann, F.; Roth, S.

2006-01-01

We demonstrate that single-wall carbon nanotubes (SWCNTs) can be macroscopically aligned by means of templating in a lyotropic nematic liquid crystal (LC), a self-assembling anisotropic fluid with orientational but no translational order. The CNTs spontaneously adopt the alignment of the host, as we

Functionalizing CNTs for Making Epoxy/CNT Composites

Science.gov (United States)

Chen, Jian; Rajagopal, Ramasubramaniam

2009-01-01

Functionalization of carbon nanotubes (CNTs) with linear molecular side chains of polyphenylene ether (PPE) has been shown to be effective in solubilizing the CNTs in the solvent components of solutions that are cast to make epoxy/CNT composite films. (In the absence of solubilization, the CNTs tend to clump together instead of becoming dispersed in solution as needed to impart, to the films, the desired CNT properties of electrical conductivity and mechanical strength.) Because the PPE functionalizes the CNTs in a noncovalent manner, the functionalization does not damage the CNTs. The functionalization can also be exploited to improve the interactions between CNTs and epoxy matrices to enhance the properties of the resulting composite films. In addition to the CNTs, solvent, epoxy resin, epoxy hardener, and PPE, a properly formulated solution also includes a small amount of polycarbonate, which serves to fill voids that, if allowed to remain, would degrade the performance of the film. To form the film, the solution is drop-cast or spin-cast, then the solvent is allowed to evaporate.

Carbon nanotube-incorporated collagen hydrogels improve cell alignment and the performance of cardiac constructs

Directory of Open Access Journals (Sweden)

Sun HY

2017-04-01

Full Text Available Hongyu Sun,* Jing Zhou,* Zhu Huang,* Linlin Qu,* Ning Lin,* Chengxiao Liang, Ruiwu Dai, Lijun Tang, Fuzhou Tian General Surgery Center, Chengdu Military General Hospital, Chengdu, China *These authors contributed equally to this work Abstract: Carbon nanotubes (CNTs provide an essential 2-D microenvironment for cardiomyocyte growth and function. However, it remains to be elucidated whether CNT nanostructures can promote cell–cell integrity and facilitate the formation of functional tissues in 3-D hydrogels. Here, single-walled CNTs were incorporated into collagen hydrogels to fabricate (CNT/Col hydrogels, which improved mechanical and electrical properties. The incorporation of CNTs (up to 1 wt% exhibited no toxicity to cardiomyocytes and enhanced cell adhesion and elongation. Through the use of immunohistochemical staining, transmission electron microscopy, and intracellular calcium-transient measurement, the incorporation of CNTs was found to improve cell alignment and assembly remarkably, which led to the formation of engineered cardiac tissues with stronger contraction potential. Importantly, cardiac tissues based on CNT/Col hydrogels were noted to have better functionality. Collectively, the incorporation of CNTs into the Col hydrogels improved cell alignment and the performance of cardiac constructs. Our study suggests that CNT/Col hydrogels offer a promising tissue scaffold for cardiac constructs, and might serve as injectable biomaterials to deliver cell or drug molecules for cardiac regeneration following myocardial infarction in the near future. Keywords: carbon nanotubes, collagen hydrogel, cardiac constructs, cell alignment, tissue functionality

Alignment of the ATLAS Inner Detector in the LHC Run II

CERN Document Server

Barranco Navarro, Laura; The ATLAS collaboration

2015-01-01

ATLAS physics goals require excellent resolution, unbiased measurement of all charged particle kinematic parameters. These critically depend on the layout and performance of the tracking system and on the quality of its offline alignment. ATLAS is equipped with a tracking system built using different technologies, silicon planar sensors (pixel and micro-strip) and gaseous drift- tubes, all embedded in a 2T solenoidal magnetic field. For the Run II of the LHC, the system was upgraded with the installation of a new pixel layer, the Insertable B-layer (IBL). An outline of the track based alignment approach and its implementation within the ATLAS software will be presented. Special attention will be paid to integration of the IBL into the alignment framework, techniques allowing to identify and eliminate tracking systematics as well as strategies to deal with time-dependent alignment. Performance from the commissioning of Cosmic data and potentially early LHC Run II proton-proton collisions will be discussed.

Electron-shading effect on the horizontal aligned growth of carbon nanotubes

International Nuclear Information System (INIS)

Chai Yang; Xiao Zhiyong; Chan, Philip C. H.

2009-01-01

Based on the well-accepted electron-shading theory during plasma processing, we designed microstructures to control the local built-in electric-field on the substrate surface. The distortion magnitude of the electric-field is largest near the sidewalls of the microstructures, creating a horizontal electric-field in this region. We showed that the horizontally aligned carbon nanotubes (CNTs) were grown by making use of this built-in electric-field during the plasma-enhanced chemical vapor deposition process, with a tactical choice of geometries and materials of the microstructures on the substrate. This technique opens up a way to selectively and controllably grow horizontally aligned CNTs on the substrate surface

Carbon nanotube-incorporated collagen hydrogels improve cell alignment and the performance of cardiac constructs

Science.gov (United States)

Sun, Hongyu; Zhou, Jing; Huang, Zhu; Qu, Linlin; Lin, Ning; Liang, Chengxiao; Dai, Ruiwu; Tang, Lijun; Tian, Fuzhou

2017-01-01

Carbon nanotubes (CNTs) provide an essential 2-D microenvironment for cardiomyocyte growth and function. However, it remains to be elucidated whether CNT nanostructures can promote cell–cell integrity and facilitate the formation of functional tissues in 3-D hydrogels. Here, single-walled CNTs were incorporated into collagen hydrogels to fabricate (CNT/Col) hydrogels, which improved mechanical and electrical properties. The incorporation of CNTs (up to 1 wt%) exhibited no toxicity to cardiomyocytes and enhanced cell adhesion and elongation. Through the use of immunohistochemical staining, transmission electron microscopy, and intracellular calcium-transient measurement, the incorporation of CNTs was found to improve cell alignment and assembly remarkably, which led to the formation of engineered cardiac tissues with stronger contraction potential. Importantly, cardiac tissues based on CNT/Col hydrogels were noted to have better functionality. Collectively, the incorporation of CNTs into the Col hydrogels improved cell alignment and the performance of cardiac constructs. Our study suggests that CNT/Col hydrogels offer a promising tissue scaffold for cardiac constructs, and might serve as injectable biomaterials to deliver cell or drug molecules for cardiac regeneration following myocardial infarction in the near future. PMID:28450785

Transferring vertically aligned carbon nanotubes onto a polymeric substrate using a hot embossing technique for microfluidic applications.

Science.gov (United States)

Mathur, A; Roy, S S; McLaughlin, J A

2010-07-06

We explored the hot embossing method for transferring vertically aligned carbon nanotubes (CNTs) into microfluidic channels, fabricated on poly-methyl-methacrylate (PMMA). Patterned and unpatterned CNTs were synthesized by microwave plasma-enhanced chemical vapour deposition on silicon to work as a stamp. For hot embossing, 115 degrees C and 1 kN force for 2 min were found to be the most suitable parameters for the complete transfer of aligned CNTs on the PMMA microchannel. Raman and SEM studies were used to analyse the microstructure of CNTs before and after hot embossing. The PMMA microparticles with dimensions (approx. 10 microm in diameter) similar to red blood cells were successfully filtered using laminar flow through these microfluidic channels. Finally, a microfluidic-based point-of-care device for blood filtration and detection of bio-molecules is drawn schematically.

Industrial compatible re-growth of vertically aligned multiwall carbon nanotubes by ultrafast pure oxygen purification process

DEFF Research Database (Denmark)

Bu, Ian Y.Y.; Hou, Kai; Engstrøm, Daniel Southcott

2011-01-01

amorphous carbon and reactivate nickel catalyst. Controlling of the purification temperature is important for high yield CNTs, as excessive high annealing temperature results in deformation of the CNTs. Unlike hazardous wet purification treatments, purified CNTs remained vertically aligned and offer......Reproducible high-yield purification process of multiwalled carbon nanotubes (CNTs) was developed by thermal annealing in ultrapure oxygen. The optimized condition involves thermal annealing via a PID controlled heater in high purity oxygen at temperature of 450°C for 180s, which burns out...

Synergistic effects between TiO2 and carbon nanotubes (CNTs) in a TiO2/CNTs system under visible light irradiation.

Science.gov (United States)

Wu, Chung-Hsin; Kuo, Chao-Yin; Chen, Shih-Ting

2013-01-01

This study synthesized a TiO2/carbon nanotubes (CNTs) composite via the sol-gel method. The surface characteristics of the TiO2/CNTs composite were determined by X-ray diffraction, transmission electron microscopy, specific surface area analyser, ultraviolent (UV)-vis spectroscopy, X-ray photoelectron spectroscopy and Raman spectrometer. The photocatalytic activity ofthe TiO2/CNTs composite was evaluated by decolourizing C.I. Reactive Red 2 (RR2) under visible light irradiation. Furthermore, the effects of calcination temperature, pH, RR2 concentration, and the TiO2/CNTs composite dosage on RR2 decolourization were determined simultaneously. The optimal calcination temperature to generate TiO2 and the TiO2/CNTs composite was 673 K, as the percentage of anatase crystallization at this temperature was highest. The specific surface area of the TiO2/CNTs composite and TiO2 were 45 and 42 m2/g, respectively. The band gap of TiO2 and the TiO2/CNTs composite was 2.97 and 2.71 eV by UV-vis measurements, respectively. Experimental data indicate that the Ti-O-C bond formed in the TiO2/CNTs composite. The RR2 decolourization rates can be approximated by pseudo-first-order kinetics; moreover, only the TiO2/CNTs composite had photocatalytic activity under visible light irradiation. At pH 7, the RR2 decolourization rate constant of 0.5, 1 and 2 g/L TiO2/CNTs addition was 0.005, 0.0015, and 0.0047 min(-1), respectively. Decolourization rate increased as pH and the RR2 concentration decreased. The CNTs functioned as electron acceptors, promoting separation of photoinduced electron-hole pairs to retard their recombination; thus, photocatalytic activity of the TiO2/CNTs composite exceeded that of TiO2.

Continuous high-yield production of vertically aligned carbon nanotubes on 2D and 3D substrates.

Science.gov (United States)

Guzmán de Villoria, Roberto; Hart, A John; Wardle, Brian L

2011-06-28

Vertically aligned carbon nanotubes (VACNTs) have certain advantages over bulk CNT powders and randomly oriented CNT mats for applications in flexible electronic devices, filtration membranes, biosensors and multifunctional aerospace materials. Here, a machine and a process to synthesize VACNTs in a continuous manner are presented showing uniform growth on 2D and 3D substrates, including alumina fibers, silicon wafer pieces, and stainless steel foils. Aligned multiwalled carbon nanotubes (MWNT) are synthesized at substrate feed rates of up to 6.8 cm/min, and the CNTs reach up to 60 μm in length depending on residence time in the reactor. In addition to the aligned morphology indicative of high yield growth, transmission electron microscopy and Raman spectroscopy reveal that the CNTs are of comparable quality to CNTs grown via a similar batch process. A significant reduction in time, reaction products, gases, and energy is demonstrated relative to batch processing, paving the way for industrial production of VACNTs.

Experimental and DFT study of thiol-stabilized Pt/CNTs catalysts.

Science.gov (United States)

Li, L; Chen, S G; Wei, Z D; Qi, X Q; Xia, M R; Wang, Y Q

2012-12-28

Using a combination of experiments and density functional theory (DFT) calculations, we explored the mechanisms of the stabilization effect of the thiolized (-SH) group on the Pt/SH-CNTs catalyst. Pt particles supported on the hydroxyl functionalized CNTs (Pt/OH-CNTs) are synthesized as a baseline for comparison. Experimentally, the platinum on OH-CNTs has a stronger tendency for aggregation than that on SH-CNTs. The differences in the oxidation resistance, migration activation energy, and corrosion resistance between the Pt/SH-CNTs and Pt/OH-CNTs are calculated using DFT. The DFT calculations indicate that the -SH group enhances the oxidation resistance of the Pt cluster and CNTs and restricts Pt migration on the CNTs. DFT calculations also suggest that the enhanced stability of Pt/SH-CNTs originates from the increased interaction between Pt and SH-CNTs and the depressed d-band center of the Pt NPs. Thus, the functional groups on the CNTs used for stabilization of supported Pt NPs should provide a deposit and anchor site for Pt NPs and maintain the perfect structure of CNTs rather than destroying it.

CMS silicon tracker alignment strategy with the Millepede II algorithm

International Nuclear Information System (INIS)

Flucke, G; Schleper, P; Steinbrueck, G; Stoye, M

2008-01-01

The positions of the silicon modules of the CMS tracker will be known to O(100 μm) from survey measurements, mounting precision and the hardware alignment system. However, in order to fully exploit the capabilities of the tracker, these positions need to be known to a precision of a few μm. Only a track-based alignment procedure can reach this required precision. Such an alignment procedure is a major challenge given that about 50000 geometry constants need to be measured. Making use of the novel χ 2 minimization program Millepede II an alignment strategy has been developed in which all detector components are aligned simultaneously and all correlations between their position parameters taken into account. Different simulated data, such as Z 0 decays and muons originated in air showers were used for the study. Additionally information about the mechanical structure of the tracker, and initial position uncertainties have been used as input for the alignment procedure. A proof of concept of this alignment strategy is demonstrated using simulated data

Systematic periodicity in waviness of vertically aligned carbon nanotubes explained by helical buckling

Science.gov (United States)

Jahangiri, Mehdi

2017-09-01

A hypothesis is proposed in this work to account for the geometry of individual vertically aligned carbon nanotubes (VACNTs) that not only justifies the directionality of their growth, but also explains the origin of the waviness frequently reported for these nanotube forests. Such waviness has fundamental effects on the transport/conduction properties of VACNTs, either through or along them, regarding phenomena such as mass, stress, heat and electricity. Despite the general opinion about randomness of carbon nanotubes (CNTs) tortuosity, we demonstrate here that rules of helical buckling of tubular strings is applicable to VACNTs, based on which a regular 3D helical geometry is proposed for VACNTs, with a 2D sine wave shape side-profile. In this framework, gradual increase of the total free surface energy by growth of CNTs ensues their partial cohesion, driven by van der Waals interactions, to reduce the excess surface energy. On the other hand, their cohesion is accompanied by their deformation and loss of straightness, which in turn, translates to buildup of an elastic strain energy in the system. The balance of the two energies along with the spatial constraints on each CNT at its contact points with neighboring CNTs, is manifested in its helical buckling, that is systematically influenced by nanostructural characteristics of VACNTs, such as their diameter, wall thickness and inter-CNT spacing.

PEP-II IR-2 Alignment

International Nuclear Information System (INIS)

Seryi, A

2004-01-01

This paper describes the first results and preliminary analysis obtained with several alignment monitoring systems recently installed in the PEP-II interaction region. The hydrostatic level system, stretched wire system, and laser tracker have been installed in addition to the existing tiltmeters and LVDT sensors. These systems detected motion of the left raft, which correlated primarily with the low energy ring (LER) current. The motion is of the order of 120 micrometers. The cause was identified as synchrotron radiation heating the beampipe, causing its expansion which then results in its deformation and offset of the IR quadrupoles. We also discuss further plans on measurements, analysis and means to counteract this motion

Aligned Carbon Nanotubes for High-Performance Films and Composites

Science.gov (United States)

Zhang, Liwen

Carbon nanotubes (CNTs) with extraordinary properties and thus many potential applications have been predicted to be the best reinforcements for the next-generation multifunctional composite materials. Difficulties exist in transferring the most use of the unprecedented properties of individual CNTs to macroscopic forms of CNT assemblies. Therefore, this thesis focuses on two main goals: 1) discussing the issues that influence the performance of bulk CNT products, and 2) fabricating high-performance dry CNT films and composite films with an understanding of the fundamental structure-property relationship in these materials. Dry CNT films were fabricated by a winding process using CNT arrays with heights of 230 mum, 300 im and 360 mum. The structures of the as-produced films, as well as their mechanical and electrical properties were examined in order to find out the effects of different CNT lengths. It was found that the shorter CNTs synthesized by shorter time in the CVD furnace exhibited less structural defects and amorphous carbon, resulting in more compact packing and better nanotube alignment when made into dry films, thus, having better mechanical and electrical performance. A novel microcombing approach was developed to mitigate the CNT waviness and alignment in the dry films, and ultrahigh mechanical properties and exceptional electrical performance were obtained. This method utilized a pair of sharp surgical blades with microsized features at the blade edges as micro-combs to, for the first time, disentangle and straighten the wavy CNTs in the dry-drawn CNT sheet at single-layer level. The as-combed CNT sheet exhibited high level of nanotube alignment and straightness, reduced structural defects, and enhanced nanotube packing density. The dry CNT films produced by microcombing had a very high Young's modulus of 172 GPa, excellent tensile strength of 3.2 GPa, and unprecedented electrical conductivity of 1.8x10 5 S/m, which were records for CNT films or

Multi-Directional Growth of Aligned Carbon Nanotubes Over Catalyst Film Prepared by Atomic Layer Deposition

Directory of Open Access Journals (Sweden)

Zhou Kai

2010-01-01

Full Text Available Abstract The structure of vertically aligned carbon nanotubes (CNTs severely depends on the properties of pre-prepared catalyst films. Aiming for the preparation of precisely controlled catalyst film, atomic layer deposition (ALD was employed to deposit uniform Fe2O3 film for the growth of CNT arrays on planar substrate surfaces as well as the curved ones. Iron acetylacetonate and ozone were introduced into the reactor alternately as precursors to realize the formation of catalyst films. By varying the deposition cycles, uniform and smooth Fe2O3 catalyst films with different thicknesses were obtained on Si/SiO2 substrate, which supported the growth of highly oriented few-walled CNT arrays. Utilizing the advantage of ALD process in coating non-planar surfaces, uniform catalyst films can also be successfully deposited onto quartz fibers. Aligned few-walled CNTs can be grafted on the quartz fibers, and they self-organized into a leaf-shaped structure due to the curved surface morphology. The growth of aligned CNTs on non-planar surfaces holds promise in constructing hierarchical CNT architectures in future.

Progress in ETA-II magnetic field alignment using stretched wire and low energy electron beam techniques

International Nuclear Information System (INIS)

Griffith, L.V.; Deadrick, F.J.

1991-01-01

Flux line alignment of the solenoidal focus magnets used on the ETA-II linear induction accelerator is a key element leading to a reduction of beam corkscrew motion. Two techniques have been used on the ETA-II accelerator to measure and establish magnet alignment. A low energy electron beam has been used to directly map magnetic field lines, and recent work has utilized a pulsed stretched wire technique to measure magnet tilts and offsets with respect to a reference axis. This paper reports on the techniques used in the ETA-II accelerator alignment, and presents results from those measurements which show that accelerator is magnetically aligned to within ∼ ± 200 microns

Enhancement of C/C-LAS joint using aligned carbon nanotubes prepared by injection chemical vapor deposition

Energy Technology Data Exchange (ETDEWEB)

Zhao, Feng-Ling; Fu, Qian-Gang, E-mail: fuqiangang@nwpu.edu.cn; Feng, Lei; Shen, Qing-Liang

2016-01-05

Carbon nanotubes (CNTs) enhanced carbon/carbon-lithium aluminum silicate (C/C-LAS) joint was prepared by a three-step technique of pack cementation, injection chemical vapor deposition (ICVD) and hot-pressing. A layer of aligned CNTs was grown on the surface of SiC coated C/C composites by ICVD method, and the joint was obtained by hot-pressing with magnesium aluminum silicate (MAS) as the interlayer. SEM observation reveals that the introduced CNTs result in the formation of a dense and crack-free CNT/MAS nanocomposite interface between SiC and MAS. Compared with the joints without CNTs, the average shear strength of the joints reinforced by CNTs was improved by 48% accompanied by an obvious change in failure mode from brittle fracture without CNTs to plastic fracture with CNTs. The pulling-out and bridging of CNTs on the fracture surfaces had a positive effect on the strength enhancement of the C/C-LAS joint.

ZrB₂-CNTs Nanocomposites Fabricated by Spark Plasma Sintering.

Science.gov (United States)

Jin, Hua; Meng, Songhe; Xie, Weihua; Xu, Chenghai; Niu, Jiahong

2016-11-29

ZrB₂-based nanocomposites with and without carbon nanotubes (CNTs) as reinforcement were prepared at 1600 °C by spark plasma sintering. The effects of CNTs on the microstructure and mechanical properties of nano-ZrB₂ matrix composites were studied. The results indicated that adding CNTs can inhibit the abnormal grain growth of ZrB₂ grains and improve the fracture toughness of the composites. The toughness mechanisms were crack deflection, crack bridging, debonding, and pull-out of CNTs. The experimental results of the nanograined ZrB₂-CNTs composites were compared with those of the micro-grained ZrB₂-CNTs composites. Due to the small size and surface effects, the nanograined ZrB₂-CNTs composites exhibited stronger mechanical properties: the hardness, flexural strength and fracture toughness were 18.7 ± 0.2 GPa, 1016 ± 75 MPa, and 8.5 ± 0.4 MPa·m 1/2 , respectively.

SATe-II: very fast and accurate simultaneous estimation of multiple sequence alignments and phylogenetic trees.

Science.gov (United States)

Liu, Kevin; Warnow, Tandy J; Holder, Mark T; Nelesen, Serita M; Yu, Jiaye; Stamatakis, Alexandros P; Linder, C Randal

2012-01-01

Highly accurate estimation of phylogenetic trees for large data sets is difficult, in part because multiple sequence alignments must be accurate for phylogeny estimation methods to be accurate. Coestimation of alignments and trees has been attempted but currently only SATé estimates reasonably accurate trees and alignments for large data sets in practical time frames (Liu K., Raghavan S., Nelesen S., Linder C.R., Warnow T. 2009b. Rapid and accurate large-scale coestimation of sequence alignments and phylogenetic trees. Science. 324:1561-1564). Here, we present a modification to the original SATé algorithm that improves upon SATé (which we now call SATé-I) in terms of speed and of phylogenetic and alignment accuracy. SATé-II uses a different divide-and-conquer strategy than SATé-I and so produces smaller more closely related subsets than SATé-I; as a result, SATé-II produces more accurate alignments and trees, can analyze larger data sets, and runs more efficiently than SATé-I. Generally, SATé is a metamethod that takes an existing multiple sequence alignment method as an input parameter and boosts the quality of that alignment method. SATé-II-boosted alignment methods are significantly more accurate than their unboosted versions, and trees based upon these improved alignments are more accurate than trees based upon the original alignments. Because SATé-I used maximum likelihood (ML) methods that treat gaps as missing data to estimate trees and because we found a correlation between the quality of tree/alignment pairs and ML scores, we explored the degree to which SATé's performance depends on using ML with gaps treated as missing data to determine the best tree/alignment pair. We present two lines of evidence that using ML with gaps treated as missing data to optimize the alignment and tree produces very poor results. First, we show that the optimization problem where a set of unaligned DNA sequences is given and the output is the tree and alignment of

Novel Real-time Calibration and Alignment Procedure for LHCb Run II

CERN Multimedia

Prouve, Claire

2016-01-01

In order to achieve optimal detector performance the LHCb experiment has introduced a novel real-time detector alignment and calibration strategy for Run II of the LHC. For the alignment tasks, data is collected and processed at the beginning of each fill while the calibrations are performed for each run. This real time alignment and calibration allows the same constants being used in both the online and offline reconstruction, thus improving the correlation between triggered and offline selected events. Additionally the newly computed alignment and calibration constants can be instantly used in the trigger, making it more efficient. The online alignment and calibration of the RICH detectors also enable the use of hadronic particle identification in the trigger. The computing time constraints are met through the use of a new dedicated framework using the multi-core farm infrastructure for the LHCb trigger. An overview of all alignment and calibration tasks is presented and their performance is shown.

Atomic layer deposition of ruthenium on plasma-treated vertically aligned carbon nanotubes for high-performance ultracapacitors.

Science.gov (United States)

Kim, Jun Woo; Kim, Byungwoo; Park, Suk Won; Kim, Woong; Shim, Joon Hyung

2014-10-31

It is challenging to realize a conformal metal coating by atomic layer deposition (ALD) because of the high surface energy of metals. In this study, ALD of ruthenium (Ru) on vertically aligned carbon nanotubes (CNTs) was carried out. To activate the surface of CNTs that lack surface functional groups essential for ALD, oxygen plasma was applied ex situ before ALD. X-ray photoelectron spectroscopy and Raman spectroscopy confirmed surface activation of CNTs by the plasma pretreatment. Transmission electron microscopy analysis with energy-dispersive x-ray spectroscopy composition mapping showed that ALD Ru grew conformally along CNTs walls. ALD Ru/CNTs were electrochemically oxidized to ruthenium oxide (RuOx) that can be a potentially useful candidate for use in the electrodes of ultracapacitors. Electrode performance of RuOx/CNTs was evaluated using cyclic voltammetry and galvanostatic charge-discharge measurements.

Behavior of oxidized platinum nanoparticles on an aligned carbon nanotube forest

Energy Technology Data Exchange (ETDEWEB)

Matsuda, Keita, E-mail: matsuda.keita@c.mbox.nagoya-u.ac.jp; Norimatsu, Wataru [Department of Applied Chemistry, Nagoya University, Nagoya 464-8603 (Japan); Arai, Shigeo; Kusunoki, Michiko [Institute of Materials and Systems for Sustainability, Nagoya University, Nagoya 464-8603 (Japan)

2016-10-14

We observed and analyzed the behavior of platinum nanoparticles (PtNPs) supported on aligned-carbon nanotubes (CNTs) at high temperatures by X-ray photoelectron spectroscopy and high-resolution transmission electron microscope observations. We found that the PtNPs moved toward the inner-side along each CNT on which they were deposited. The mechanism of this behavior is related to the redox reaction of Pt with the carbon atoms in the CNT. We also performed in-situ observation of this process at a high temperature using an environmental transmission electron microscope under an oxygen atmosphere. We found that the PtNPs penetrated down into a high-density aligned CNT forest along the tube axis and that the PtNPs changed their shape to fit the structure of the CNTs during their movement.

Surface properties of CNTs and their interaction with silica.

Science.gov (United States)

Sobolkina, Anastasia; Mechtcherine, Viktor; Bellmann, Cornelia; Khavrus, Vyacheslav; Oswald, Steffen; Hampel, Silke; Leonhardt, Albrecht

2014-01-01

In order to improve the embedding of carbon nanotubes (CNTs) in cement-based matrices, silica was deposited on the sidewall of CNTs by a sol-gel method. Knowledge of the conditions of CNTs' surfaces is a key issue in understanding the corresponding interaction mechanisms. In this study various types of CNTs synthesized using acetonitrile, cyclohexane, and methane were investigated with regard to their physicochemical surface properties. Significant differences in surface polarity as well as in the wetting properties of the CNTs, depending on the precursors used, were revealed by combining electro-kinetic potential and contact angle measurements. The hydrophobicity of CNTs decreases by utilising the carbon sources in the following order: cyclohexane, methane, and finally acetonitrile. The XPS analysis, applied to estimate the chemical composition at the CNT surface, showed nitrogen atoms incorporated into the tube structure by using acetonitrile as a carbon source. It was found that the simultaneous presence of nitrogen- and/or oxygen-containing sites with different acid-base properties increased the surface polarity of the CNTs, imparting amphoteric characteristics to them and improving their wetting behaviour. Regarding the silica deposition, strong differences in adsorption capacity of the CNTs were observed. The mechanism of silica adsorption through interfacial bond formation was discussed. Copyright © 2013 Elsevier Inc. All rights reserved.

Partial alignment and measurement of residual dipolar couplings of proteins under high hydrostatic pressure

Energy Technology Data Exchange (ETDEWEB)

Fu, Yinan; Wand, A. Joshua, E-mail: wand@mail.med.upenn.edu [University of Pennsylvania, Department of Biochemistry and Biophysics, Johnson Research Foundation (United States)

2013-08-15

High-pressure NMR spectroscopy has emerged as a complementary approach for investigating various structural and thermodynamic properties of macromolecules. Noticeably absent from the array of experimental restraints that have been employed to characterize protein structures at high hydrostatic pressure is the residual dipolar coupling, which requires the partial alignment of the macromolecule of interest. Here we examine five alignment media that are commonly used at ambient pressure for this purpose. We find that the spontaneous alignment of Pf1 phage, d(GpG) and a C12E5/n-hexnanol mixture in a magnetic field is preserved under high hydrostatic pressure. However, DMPC/DHPC bicelles and collagen gel are found to be unsuitable. Evidence is presented to demonstrate that pressure-induced structural changes can be identified using the residual dipolar coupling.

Improving cardiac myocytes performance by CNTs platforms

Directory of Open Access Journals (Sweden)

Valentina eMartinelli

2013-09-01

Full Text Available The application of nanotechnology to the cardiovascular system has increasingly caught scientists’ attention as a potentially powerful tool for the development of new generation devices able to interface, repair or boost the performance of cardiac tissue. Carbon nanotubes (CNTs are considered as promising materials for nanomedicine applications in general and have been recently tested towards excitable cell growth. CNTs are cylindrically shaped structures made up of rolled-up graphene sheets, with unique electrical, thermal and mechanical properties, able to effectively conducting electrical current in electrochemical interfaces. CNTs-based scaffolds have been recently found to support the in vitro growth of cardiac cells: in particular, their ability to improve cardiomyocytes proliferation, maturation and electrical behavior are making CNTs extremely attractive for the development and exploitation of interfaces able to impact on cardiac cells physiology and function.

Study of surface morphology and alignment of MWCNTs grown by chemical vapor deposition

Energy Technology Data Exchange (ETDEWEB)

Shukrullah, S., E-mail: zshukrullah@gmail.com, E-mail: noranimuti-mohamed@petronas.com.my, E-mail: maizats@petronas.com.my; Mohamed, N. M., E-mail: zshukrullah@gmail.com, E-mail: noranimuti-mohamed@petronas.com.my, E-mail: maizats@petronas.com.my; Shaharun, M. S., E-mail: zshukrullah@gmail.com, E-mail: noranimuti-mohamed@petronas.com.my, E-mail: maizats@petronas.com.my [Department of Fundamental and Applied Sciences, Universiti Teknologi PETRONAS, 31750 Tronoh, Perak (Malaysia); Yasar, M., E-mail: Muhammad.yasar@ieee.org [Department of Electrical and Electronic Engineering, Universiti Teknologi PETRONAS, 31750 Tronoh, Perak (Malaysia)

2014-10-24

In this research work, Multiwalled Carbon Nanotubes (MWCNTs) have been synthesized successfully by using floating catalytic chemical vapor deposition (FCCVD) method. Different ferrocene amounts (0.1, 0.125 and 0.15 g) were used as catalyst and ethylene was used as a carbon precursor at reaction temperature of 800°C. Characterization of the grown MWCNTs was carried out by using scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The obtained data showed that the catalyst weight affects the nanotubes diameter, alignment, crystallinity and growth significantly, whereas negligible influence was noticed on CNTs forest length. The dense, uniform and meadow like patterns of grown CNTs were observed for 0.15 g ferrocene. The average diameter of the grown CNTs was found in the range of 32 to 75 nm. Close inspection of the TEM images also confirmed the defects in some of the grown CNTs, where few black spots were evident in CNTs structure.

Study of surface morphology and alignment of MWCNTs grown by chemical vapor deposition

International Nuclear Information System (INIS)

Shukrullah, S.; Mohamed, N. M.; Shaharun, M. S.; Yasar, M.

2014-01-01

In this research work, Multiwalled Carbon Nanotubes (MWCNTs) have been synthesized successfully by using floating catalytic chemical vapor deposition (FCCVD) method. Different ferrocene amounts (0.1, 0.125 and 0.15 g) were used as catalyst and ethylene was used as a carbon precursor at reaction temperature of 800°C. Characterization of the grown MWCNTs was carried out by using scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The obtained data showed that the catalyst weight affects the nanotubes diameter, alignment, crystallinity and growth significantly, whereas negligible influence was noticed on CNTs forest length. The dense, uniform and meadow like patterns of grown CNTs were observed for 0.15 g ferrocene. The average diameter of the grown CNTs was found in the range of 32 to 75 nm. Close inspection of the TEM images also confirmed the defects in some of the grown CNTs, where few black spots were evident in CNTs structure

Effects of vertically aligned carbon nanotubes on shear performance of laminated nanocomposite bonded joints

Directory of Open Access Journals (Sweden)

Davood Askari and Mehrdad N Ghasemi-Nejhad

2012-01-01

Full Text Available The main objective is to improve the most commonly addressed weakness of the laminated composites (i.e. delamination due to poor interlaminar strength using carbon nanotubes (CNTs as reinforcement between the laminae and in the transverse direction. In this work, a chemical vapor deposition technique has been used to grow dense vertically aligned arrays of CNTs over the surface of chemically treated two-dimensionally woven cloth and fiber tows. The nanoforest-like fabrics can be used to fabricate three-dimensionally reinforced laminated nanocomposites. The presence of CNTs aligned normal to the layers and in-between the layers of laminated composites is expected to considerably enhance the properties of the laminates. To demonstrate the effectiveness of our approach, composite single lap-joint specimens were fabricated for interlaminar shear strength testing. It was observed that the single lap-joints with through-the-thickness CNT reinforcement can carry considerably higher shear stresses and strains. Close examination of the test specimens showed that the failure of samples with CNT nanoforests was completely cohesive, while the samples without CNT reinforcement failed adhesively. This concludes that the adhesion of adjacent carbon fabric layers can be considerably improved owing to the presence of vertically aligned arrays of CNT nanoforests.

Effects of vertically aligned carbon nanotubes on shear performance of laminated nanocomposite bonded joints.

Science.gov (United States)

Askari, Davood; Ghasemi-Nejhad, Mehrdad N

2012-08-01

The main objective is to improve the most commonly addressed weakness of the laminated composites (i.e. delamination due to poor interlaminar strength) using carbon nanotubes (CNTs) as reinforcement between the laminae and in the transverse direction. In this work, a chemical vapor deposition technique has been used to grow dense vertically aligned arrays of CNTs over the surface of chemically treated two-dimensionally woven cloth and fiber tows. The nanoforest-like fabrics can be used to fabricate three-dimensionally reinforced laminated nanocomposites. The presence of CNTs aligned normal to the layers and in-between the layers of laminated composites is expected to considerably enhance the properties of the laminates. To demonstrate the effectiveness of our approach, composite single lap-joint specimens were fabricated for interlaminar shear strength testing. It was observed that the single lap-joints with through-the-thickness CNT reinforcement can carry considerably higher shear stresses and strains. Close examination of the test specimens showed that the failure of samples with CNT nanoforests was completely cohesive, while the samples without CNT reinforcement failed adhesively. This concludes that the adhesion of adjacent carbon fabric layers can be considerably improved owing to the presence of vertically aligned arrays of CNT nanoforests.

Investigation of nonlinear I–V behavior of CNTs filled polymer composites

International Nuclear Information System (INIS)

Wang, Jian; Yu, Shuhui; Luo, Suibin; Chu, Baojin; Sun, Rong; Wong, Ching-Ping

2016-01-01

Graphical abstract: - Highlights: • Mechanism of nonlinear behavior of the CNT composites was systematically investigated. • There are one linear region (I) and two nonlinear regions (II and III) in the I–V curves. • This phenomenon was analyzed based on hopping, tunneling and Joule heating effects. - Abstract: Nonlinear current–voltage (I–V) behavior is a typical feature of polymeric composites containing conductor or semiconductor fillers, which are desired to handle the transient voltage and electrostatic discharge (ESD) of microelectronic devices. In this paper, the mechanism of nonlinear behavior of carbon nanotubes (CNTs) filled polymer composites in the applied electric field was explored. The I–V curves of the composites exhibited three regions. The variation of current at low voltages (region I) is linear. Under relatively higher voltages (region II), the variation is nonlinear and grows rapidly with voltage. As the voltage is further increased, the I–V curve is still non-linear (region III), but the growth rate is significantly slowed down. The I–V characteristics in the above three regions were analyzed systematically based on the calculation of the electrons hopping from the conduction band of CNTs to epoxy, the induced current under electric field, as well as Joule-heating and tunneling effect.

En route to controlled catalytic CVD synthesis of densely packed and vertically aligned nitrogen-doped carbon nanotube arrays

Directory of Open Access Journals (Sweden)

Slawomir Boncel

2014-03-01

Full Text Available The catalytic chemical vapour deposition (c-CVD technique was applied in the synthesis of vertically aligned arrays of nitrogen-doped carbon nanotubes (N-CNTs. A mixture of toluene (main carbon source, pyrazine (1,4-diazine, nitrogen source and ferrocene (catalyst precursor was used as the injection feedstock. To optimize conditions for growing the most dense and aligned N-CNT arrays, we investigated the influence of key parameters, i.e., growth temperature (660, 760 and 860 °C, composition of the feedstock and time of growth, on morphology and properties of N-CNTs. The presence of nitrogen species in the hot zone of the quartz reactor decreased the growth rate of N-CNTs down to about one twentieth compared to the growth rate of multi-wall CNTs (MWCNTs. As revealed by electron microscopy studies (SEM, TEM, the individual N-CNTs (half as thick as MWCNTs grown under the optimal conditions were characterized by a superior straightness of the outer walls, which translated into a high alignment of dense nanotube arrays, i.e., 5 × 108 nanotubes per mm2 (100 times more than for MWCNTs grown in the absence of nitrogen precursor. In turn, the internal crystallographic order of the N-CNTs was found to be of a ‘bamboo’-like or ‘membrane’-like (multi-compartmental structure morphology. The nitrogen content in the nanotube products, which ranged from 0.0 to 3.0 wt %, was controlled through the concentration of pyrazine in the feedstock. Moreover, as revealed by Raman/FT-IR spectroscopy, the incorporation of nitrogen atoms into the nanotube walls was found to be proportional to the number of deviations from the sp2-hybridisation of graphene C-atoms. As studied by XRD, the temperature and the [pyrazine]/[ferrocene] ratio in the feedstock affected the composition of the catalyst particles, and hence changed the growth mechanism of individual N-CNTs into a ‘mixed base-and-tip’ (primarily of the base-type type as compared to the purely �

En route to controlled catalytic CVD synthesis of densely packed and vertically aligned nitrogen-doped carbon nanotube arrays.

Science.gov (United States)

Boncel, Slawomir; Pattinson, Sebastian W; Geiser, Valérie; Shaffer, Milo S P; Koziol, Krzysztof K K

2014-01-01

The catalytic chemical vapour deposition (c-CVD) technique was applied in the synthesis of vertically aligned arrays of nitrogen-doped carbon nanotubes (N-CNTs). A mixture of toluene (main carbon source), pyrazine (1,4-diazine, nitrogen source) and ferrocene (catalyst precursor) was used as the injection feedstock. To optimize conditions for growing the most dense and aligned N-CNT arrays, we investigated the influence of key parameters, i.e., growth temperature (660, 760 and 860 °C), composition of the feedstock and time of growth, on morphology and properties of N-CNTs. The presence of nitrogen species in the hot zone of the quartz reactor decreased the growth rate of N-CNTs down to about one twentieth compared to the growth rate of multi-wall CNTs (MWCNTs). As revealed by electron microscopy studies (SEM, TEM), the individual N-CNTs (half as thick as MWCNTs) grown under the optimal conditions were characterized by a superior straightness of the outer walls, which translated into a high alignment of dense nanotube arrays, i.e., 5 × 10(8) nanotubes per mm(2) (100 times more than for MWCNTs grown in the absence of nitrogen precursor). In turn, the internal crystallographic order of the N-CNTs was found to be of a 'bamboo'-like or 'membrane'-like (multi-compartmental structure) morphology. The nitrogen content in the nanotube products, which ranged from 0.0 to 3.0 wt %, was controlled through the concentration of pyrazine in the feedstock. Moreover, as revealed by Raman/FT-IR spectroscopy, the incorporation of nitrogen atoms into the nanotube walls was found to be proportional to the number of deviations from the sp(2)-hybridisation of graphene C-atoms. As studied by XRD, the temperature and the [pyrazine]/[ferrocene] ratio in the feedstock affected the composition of the catalyst particles, and hence changed the growth mechanism of individual N-CNTs into a 'mixed base-and-tip' (primarily of the base-type) type as compared to the purely 'base'-type for undoped

[Influence of CNTs on Photodegradation of Salbutamol in Water Environment].

Science.gov (United States)

Wang, Qi; Han, Jia-rui; Wei, Bo-fan; Zhou, Lei; Zhang, Ya; Yang, Xi

2015-08-01

The influence of CNTs on the photolysis of organic pollutant was investigated by studying the photodegradation kinetics of SAL under 1000 W Xenon lamp, in the presence of three kinds of CNTs (SCNT, MWNT-COOH, MWNT-OH). In addition, the interaction between CNTs and Fe3" was also investigated. The results showed that the photodegradation of salbutamol followed pseudo-first-order kinetics, which could be inhibited by all three kinds of CNTs through light screening effect. Formation of singlet oxygen was detected during the photolysis, using the molecular probe furfuryl alcohol. All three kinds of CNTs could absorb electrons through competition, i.e., inhibit SAL photodegradation by light screening effect; meanwhile, the CNTs could generate singlet oxygen through photoexcitation to promote the photodegradation reaction. Both mechanisms coexisted, and in most cases, the inhibition effect was dominant. In addition, CNTs could inactivate the photoactive substance Fe3 in the water body by electrostatic adsorption, and affect the photochemical behavior of organic pollutants in natural water body.

Crystallization Behavior of Poly(ethylene oxide) in Vertically Aligned Carbon Nanotube Array.

Science.gov (United States)

Sheng, Jiadong; Zhou, Shenglin; Yang, Zhaohui; Zhang, Xiaohua

2018-03-27

We investigate the effect of the presence of vertically aligned multiwalled carbon nanotubes (CNTs) on the orientation of poly(ethylene oxide) (PEO) lamellae and PEO crystallinity. The high alignment of carbon nanotubes acting as templates probably governs the orientation of PEO lamellae. This templating effect might result in the lamella planes of PEO crystals oriented along a direction parallel to the long axis of the nanotubes. The presence of aligned carbon nanotubes also gives rise to the decreases in PEO crystallinity, crystallization temperature, and melting temperature due to the perturbation of carbon nanotubes to the crystallization of PEO. These effects have significant implications for controlling the orientation of PEO lamellae and decreasing the crystallinity of PEO and thickness of PEO lamellae, which have significant impacts on ion transport in PEO/CNT composite and the capacitive performance of PEO/CNT composite. Both the decreased PEO crystallinity and the orientation of PEO lamellae along the long axes of vertically aligned CNTs give rise to the decrease in the charge transfer resistance, which is associated with the improvements in the ion transport and capacitive performance of PEO/CNT composite.

Model calculation of the scanned field enhancement factor of CNTs

International Nuclear Information System (INIS)

Ahmad, Amir; Tripathi, V K

2006-01-01

The field enhancement factor of a carbon nanotube (CNT) placed in a cluster of CNTs is smaller than an isolated CNT because the electric field on one tube is screened by neighbouring tubes. This screening depends on the length of the CNTs and the spacing between them. We have derived an expression to compute the field enhancement factor of CNTs under any positional distribution of CNTs using a model of a floating sphere between parallel anode and cathode plates. Using this expression we can compute the field enhancement factor of a CNT in a cluster (non-uniformly distributed CNTs). This expression is used to compute the field enhancement factor of a CNT in an array (uniformly distributed CNTs). Comparison has been shown with experimental results and existing models

Design of Electrically Conductive Structural Composites by Modulating Aligned CVD-Grown Carbon Nanotube Length on Glass Fibers.

Science.gov (United States)

He, Delong; Fan, Benhui; Zhao, Hang; Lu, Xiaoxin; Yang, Minhao; Liu, Yu; Bai, Jinbo

2017-01-25

Function-integration in glass fiber (GF) reinforced polymer composites is highly desired for developing lightweight structures and devices with improved performance and structural health monitoring. In this study, homogeneously aligned carbon nanotube (CNT) shell was in situ grafted on GF by chemical vapor deposition (CVD). It was demonstrated that the CNT shell thickness and weight fraction can be modulated by controlling the CVD conditions. The obtained hierarchical CNTs-GF/epoxy composites show highly improved electrical conductivity and thermo-mechanical and flexural properties. The composite through-plane and in-plane electrical conductivities increase from a quasi-isolator value to ∼3.5 and 100 S/m, respectively, when the weight fraction of CNTs grafted on GF fabric varies from 0% to 7%, respectively. Meanwhile, the composite storage modulus and flexural modulus and strength improve as high as 12%, 21%, and 26%, respectively, with 100% retention of the glass transition temperature. The reinforcing mechanisms are investigated by analyzing the composite microstructure and the interfacial adhesion and wetting properties of CNTs-GF hybrids. Moreover, the specific damage-related resistance variation characteristics could be employed to in situ monitor the structural health state of the composites. The outstanding electrical and structural properties of the CNTs-GF composites were due to the specific interfacial and interphase structures created by homogeneously grafting aligned CNTs on each GF of the fabric.

Effects of Conformal Nanoscale Coatings on Thermal Performance of Vertically Aligned Carbon Nanotubes.

Science.gov (United States)

Silvestri, Cinzia; Riccio, Michele; Poelma, René H; Jovic, Aleksandar; Morana, Bruno; Vollebregt, Sten; Irace, Andrea; Zhang, Guo Qi; Sarro, Pasqualina M

2018-04-17

The high aspect ratio and the porous nature of spatially oriented forest-like carbon nanotube (CNT) structures represent a unique opportunity to engineer a novel class of nanoscale assemblies. By combining CNTs and conformal coatings, a 3D lightweight scaffold with tailored behavior can be achieved. The effect of nanoscale coatings, aluminum oxide (Al 2 O 3 ) and nonstoichiometric amorphous silicon carbide (a-SiC), on the thermal transport efficiency of high aspect ratio vertically aligned CNTs, is reported herein. The thermal performance of the CNT-based nanostructure strongly depends on the achieved porosity, the coating material and its infiltration within the nanotube network. An unprecedented enhancement in terms of effective thermal conductivity in a-SiC coated CNTs has been obtained: 181% compared to the as-grown CNTs and Al 2 O 3 coated CNTs. Furthermore, the integration of coated high aspect ratio CNTs in an epoxy molding compound demonstrates that, next to the required thermal conductivity, the mechanical compliance for thermal interface applications can also be achieved through coating infiltration into foam-like CNT forests. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Mass production of CNTs using CVD multi-quartz tubes

Energy Technology Data Exchange (ETDEWEB)

Yousef, Samy; Mohamed, Alaa [Dept. of Production Engineering and Printing Technology, Akhbar Elyom Academy, Giza (Egypt)

2016-11-15

Carbon nanotubes (CNTs) have become the backbone of modern industries, including lightweight and heavy-duty industrial applications. Chemical vapor deposition (CVD) is considered as the most common method used to synthesize high yield CNTs. This work aims to develop the traditional CVD for the mass production of more economical CNTs, meeting the growing CNT demands among consumers by increasing the number of three particular reactors. All reactors housing is connected by small channels to provide the heat exchange possibility between the chambers, thereby decreasing synthesis time and reducing heat losses inside the ceramic body of the furnace. The novel design is simple and cheap with a lower reacting time and heat loss compared with the traditional CVD design. Methane, hydrogen, argon, and catalyzed iron nanoparticles were used as a carbon source and catalyst during the synthesis process. In addition, CNTs were produced using only a single quartz tube for comparison. The produced samples were examined using XRD, TEM, SEM, FTIR, and TGA. The results showed that the yield of CNTs increases by 287 % compared with those synthesized with a single quartz tube. Moreover, the total synthesis time of CNTs decreases by 37 % because of decreased heat leakage.

Synthesis of Cu-CNTs nanocomposites via double pressing double sintering method

Directory of Open Access Journals (Sweden)

Marjan Darabi

2018-01-01

Full Text Available In this research, copper (Cu-carbon nanotubes (CNTs nanocomposites were synthesized with different weight percentages of CNTs by double pressing double sintering (DPDS method as well as conventional sintering method. A planetary ball mill was used to disperse CNTs in Cu matrix. The milled powders were first cold pressed to 450 MPa in a uniaxial stainless-steel die with cylindrical compacts (diameter: 12 mm and height: 5 mm. The effect of CNTs content and the DPDS method on the properties of the nanocomposites were investigated. The microstructure and phase analysis of Cu-CNTs nanocomposite samples were studied by FESEM and X-Ray Diffraction. The electrical conductivity of nanocomposites was measured and compared to both sintering methods. Mechanical properties of Cu-CNTs nanocomposites were characterized using bending strength and micro-hardness measurements. Enhancements of about 32% in bending strength, 31.6% in hardness and 19.5% in electrical conductivity of Cu-1 wt.% CNTs nanocomposite synthesized by DPDS method were observed as compared to Cu-1 wt.% CNTs nanocomposites fabricated under the similar condition by a conventional sintering process.

Measuring Parameters of Massive Black Hole Binaries with Partially Aligned Spins

Science.gov (United States)

Lang, Ryan N.; Hughes, Scott A.; Cornish, Neil J.

2011-01-01

The future space-based gravitational wave detector LISA will be able to measure parameters of coalescing massive black hole binaries, often to extremely high accuracy. Previous work has demonstrated that the black hole spins can have a strong impact on the accuracy of parameter measurement. Relativistic spin-induced precession modulates the waveform in a manner which can break degeneracies between parameters, in principle significantly improving how well they are measured. Recent studies have indicated, however, that spin precession may be weak for an important subset of astrophysical binary black holes: those in which the spins are aligned due to interactions with gas. In this paper, we examine how well a binary's parameters can be measured when its spins are partially aligned and compare results using waveforms that include higher post-Newtonian harmonics to those that are truncated at leading quadrupole order. We find that the weakened precession can substantially degrade parameter estimation, particularly for the "extrinsic" parameters sky position and distance. Absent higher harmonics, LISA typically localizes the sky position of a nearly aligned binary about an order of magnitude less accurately than one for which the spin orientations are random. Our knowledge of a source's sky position will thus be worst for the gas-rich systems which are most likely to produce electromagnetic counterparts. Fortunately, higher harmonics of the waveform can make up for this degradation. By including harmonics beyond the quadrupole in our waveform model, we find that the accuracy with which most of the binary's parameters are measured can be substantially improved. In some cases, the improvement is such that they are measured almost as well as when the binary spins are randomly aligned.

Highly efficient growth of vertically aligned carbon nanotubes on Fe-Ni based metal alloy foils for supercapacitors

Science.gov (United States)

Amalina Raja Seman, Raja Noor; Asyadi Azam, Mohd; Ambri Mohamed, Mohd

2016-12-01

Supercapacitors are highly promising energy devices with superior charge storage performance and a long lifecycle. Construction of the supercapacitor cell, especially electrode fabrication, is critical to ensure good performance in applications. This work demonstrates direct growth of vertically aligned carbon nanotubes (CNTs) on Fe-Ni based metal alloy foils, namely SUS 310S, Inconel 600 and YEF 50, and their use in symmetric vertically aligned CNT supercapacitor electrodes. Alumina and cobalt thin film catalysts were deposited onto the foils, and then CNT growth was performed using alcohol catalytic chemical vapour deposition. By this method, vertically aligned CNTs were successfully grown and used directly as a binder-free supercapacitor electrode to deliver excellent electrochemical performance. The device showed relatively good specific capacitance, a superior rate capability and excellent cycle stability, maintaining about 96% capacitance up to 1000 cycles.

High-rate capability silicon decorated vertically aligned carbon nanotubes for Li-ion batteries

Energy Technology Data Exchange (ETDEWEB)

Gohier, Aurelien; Kim, Ki-Hwan; Maurice, Jean-Luc; Cojocaru, Costel Sorin [Laboratoire de Physique des Interfaces et des Couches Minces, LPICM, Ecole Polytechnique, route de Saclay, 91128 Palaiseau Cedex (France); Laik, Barbara; Pereira-Ramos, Jean-Pierre [Institut de Chimie et des Materiaux Paris-Est, ICMPE/GESMAT, UMR 7182 CNRS-UPEC, 2 rue Henri Dunant, 94320 Thiais (France); Van, Pierre Tran [Renault SAS, DREAM/DETA/SEE, 1, avenue du Golf, 78288 Guyancourt (France)

2012-05-15

The concept of a hybrid nanostructured collector made of thin vertically aligned carbon nanotubes (CNTs) decorated with Si nanoparticles provides high power density anodes in lithium-ion batteries. An impressive rate capability is achieved due to the efficient electronic conduction of CNTs combined with well defined electroactive Si nanoparticles: capacities of 3000 mAh g{sup -1} at 1.3C and 800 mAh g{sup -1} at 15C are achieved. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Determination of the electrical resistivity of vertically aligned carbon nanotubes by scanning probe microscopy

Science.gov (United States)

Ageev, O. A.; Il'in, O. I.; Rubashkina, M. V.; Smirnov, V. A.; Fedotov, A. A.; Tsukanova, O. G.

2015-07-01

Techniques are developed to determine the resistance per unit length and the electrical resistivity of vertically aligned carbon nanotubes (VA CNTs) using atomic force microscopy (AFM) and scanning tunneling microscopy (STM). These techniques are used to study the resistance of VA CNTs. The resistance of an individual VA CNT calculated with the AFM-based technique is shown to be higher than the resistance of VA CNTs determined by the STM-based technique by a factor of 200, which is related to the influence of the resistance of the contact of an AFM probe to VA CNTs. The resistance per unit length and the electrical resistivity of an individual VA CNT 118 ± 39 nm in diameter and 2.23 ± 0.37 μm in height that are determined by the STM-based technique are 19.28 ± 3.08 kΩ/μm and 8.32 ± 3.18 × 10-4 Ω m, respectively. The STM-based technique developed to determine the resistance per unit length and the electrical resistivity of VA CNTs can be used to diagnose the electrical parameters of VA CNTs and to create VA CNT-based nanoelectronic elements.

A new approach to design safe CNTs with an understanding of redox potential

OpenAIRE

Tsuruoka, Shuji; Cassee, Flemming R; Castranova, Vincent

2013-01-01

Background Carbon nanotubes (CNTs) are being increasingly industrialized and applied for various products. As of today, although several toxicological evaluations of CNTs have been conducted, designing safer CNTs is not practiced because reaction kinetics of CNTs with bioactive species is not fully understood. Results The authors propose a kinetic mechanism to establish designing safe CNTs as a new goal. According to a literature search on the behavior of CNTs and the effects of impurities, i...

HAlign-II: efficient ultra-large multiple sequence alignment and phylogenetic tree reconstruction with distributed and parallel computing.

Science.gov (United States)

Wan, Shixiang; Zou, Quan

2017-01-01

Multiple sequence alignment (MSA) plays a key role in biological sequence analyses, especially in phylogenetic tree construction. Extreme increase in next-generation sequencing results in shortage of efficient ultra-large biological sequence alignment approaches for coping with different sequence types. Distributed and parallel computing represents a crucial technique for accelerating ultra-large (e.g. files more than 1 GB) sequence analyses. Based on HAlign and Spark distributed computing system, we implement a highly cost-efficient and time-efficient HAlign-II tool to address ultra-large multiple biological sequence alignment and phylogenetic tree construction. The experiments in the DNA and protein large scale data sets, which are more than 1GB files, showed that HAlign II could save time and space. It outperformed the current software tools. HAlign-II can efficiently carry out MSA and construct phylogenetic trees with ultra-large numbers of biological sequences. HAlign-II shows extremely high memory efficiency and scales well with increases in computing resource. THAlign-II provides a user-friendly web server based on our distributed computing infrastructure. HAlign-II with open-source codes and datasets was established at http://lab.malab.cn/soft/halign.

Synthesis and characterization of CNTs using polypropylene waste as precursor

Energy Technology Data Exchange (ETDEWEB)

Bajad, Ganesh S. [Department of Chemical Engineering, Visvesvaraya National Institute of Technology, Nagpur 440010 (India); Tiwari, Saurabh K. [Department of Chemical Engineering, Indian Institute of Technology Bombay, Powai, Mumbai 400076 (India); Vijayakumar, R.P., E-mail: vijayakumarrp@che.vnit.ac.in [Department of Chemical Engineering, Visvesvaraya National Institute of Technology, Nagpur 440010 (India)

2015-04-15

Graphical abstract: - Highlights: • A facile method for producing CNTs from polypropylene waste is proposed. • Optimization of Ni/Mo mole ratio using RSM suggests the adequacy of cubic model. • Process parameters were optimized by RSM using Box–Behnken four factorial design. • Maximum desirability of one suggested that 514% of CNTs would yield over Ni{sub 4}Mo{sub 0.2}MgO{sub 1}. • Increase in Ni/Mo ratio from 0.5 to 20, inner diameter of CNTs decreases from 25 to 2 nm. - Abstract: We study the synthesis of MWCNTs using polypropylene waste as a precursor and Ni/Mo/MgO as a catalyst by the combustion technique. Molar ratios of Ni, Mo and MgO in the Ni/Mo/MgO catalyst were optimized using response surface methodology (RSM) to obtain the maximum yield of CNTs. The mole ratio 4/0.2/1 was found to yield more carbon product. Further, process parameters such as combustion temperature, combustion time, polymer and catalyst weight were optimized by RSM using Box–Behnken three-level and four-factorial design. The best possible combination of process parameters (combustion time of 10 min, combustion temperature of 800 °C, polymer weight of 5 g and catalyst weight of 150 mg) for maximum yield of CNTs was obtained. HRTEM indicates that the diameter of CNTs depends on the catalyst composition used for the synthesis of CNTs. The results of the study indicate a facile method for producing CNTs from polypropylene waste.

Synthesis and characterization of CNTs using polypropylene waste as precursor

International Nuclear Information System (INIS)

Bajad, Ganesh S.; Tiwari, Saurabh K.; Vijayakumar, R.P.

2015-01-01

Graphical abstract: - Highlights: • A facile method for producing CNTs from polypropylene waste is proposed. • Optimization of Ni/Mo mole ratio using RSM suggests the adequacy of cubic model. • Process parameters were optimized by RSM using Box–Behnken four factorial design. • Maximum desirability of one suggested that 514% of CNTs would yield over Ni 4 Mo 0.2 MgO 1 . • Increase in Ni/Mo ratio from 0.5 to 20, inner diameter of CNTs decreases from 25 to 2 nm. - Abstract: We study the synthesis of MWCNTs using polypropylene waste as a precursor and Ni/Mo/MgO as a catalyst by the combustion technique. Molar ratios of Ni, Mo and MgO in the Ni/Mo/MgO catalyst were optimized using response surface methodology (RSM) to obtain the maximum yield of CNTs. The mole ratio 4/0.2/1 was found to yield more carbon product. Further, process parameters such as combustion temperature, combustion time, polymer and catalyst weight were optimized by RSM using Box–Behnken three-level and four-factorial design. The best possible combination of process parameters (combustion time of 10 min, combustion temperature of 800 °C, polymer weight of 5 g and catalyst weight of 150 mg) for maximum yield of CNTs was obtained. HRTEM indicates that the diameter of CNTs depends on the catalyst composition used for the synthesis of CNTs. The results of the study indicate a facile method for producing CNTs from polypropylene waste

Controlled density of vertically aligned carbon nanotubes in a triode plasma chemical vapor deposition system

International Nuclear Information System (INIS)

Lim, Sung Hoon; Park, Kyu Chang; Moon, Jong Hyun; Yoon, Hyun Sik; Pribat, Didier; Bonnassieux, Yvan; Jang, Jin

2006-01-01

We report on the growth mechanism and density control of vertically aligned carbon nanotubes using a triode plasma enhanced chemical vapor deposition system. The deposition reactor was designed in order to allow the intermediate mesh electrode to be biased independently from the ground and power electrodes. The CNTs grown with a mesh bias of + 300 V show a density of ∼ 1.5 μm -2 and a height of ∼ 5 μm. However, CNTs do not grow when the mesh electrode is biased to - 300 V. The growth of CNTs can be controlled by the mesh electrode bias which in turn controls the plasma density and ion flux on the sample

Highly Sensitive and Stretchable Strain Sensor Based on Ag@CNTs.

Science.gov (United States)

Zhang, Qiang; Liu, Lihua; Zhao, Dong; Duan, Qianqian; Ji, Jianlong; Jian, Aoqun; Zhang, Wendong; Sang, Shengbo

2017-12-04

Due to the rapid development and superb performance of electronic skin, we propose a highly sensitive and stretchable temperature and strain sensor. Silver nanoparticles coated carbon nanowires (Ag@CNT) nanomaterials with different Ag concentrations were synthesized. After the morphology and components of the nanomaterials were demonstrated, the sensors composed of Polydimethylsiloxane (PDMS) and CNTs or Ag@CNTs were prepared via a simple template method. Then, the electronic properties and piezoresistive effects of the sensors were tested. Characterization results present excellent performance of the sensors for the highest gauge factor (GF) of the linear region between 0-17.3% of the sensor with Ag@CNTs1 was 137.6, the sensor with Ag@CNTs2 under the strain in the range of 0-54.8% exhibiting a perfect linearity and the GF of the sensor with Ag@CNTs2 was 14.9.

Size-dependent impact of CNTs on dynamic properties of calmodulin.

Science.gov (United States)

Gao, Jian; Wang, Liming; Kang, Seung-gu; Zhao, Lina; Ji, Mingjuan; Chen, Chunying; Zhao, Yuliang; Zhou, Ruhong; Li, Jingyuan

2014-11-07

There are growing concerns about the biosafety of nanomaterials such as carbon nanotubes (CNTs) as their applications become more widespread. We report here a theoretical and experimental study of the binding of various sizes of CNTs [CNT (4,4), (5,5), (6,6) and (7,7)] to calmodulin (CaM) protein and, in particular, their impact on the Ca(2+)-dependent dynamic properties of CaM. Our simulations show that all the CNTs can plug into the hydrophobic binding pocket of Ca(2+)-bound CaM with binding affinities comparable with the native substrate M13 peptide. Even though CNT (4,4) shows a similar behavior to the M13 peptide in its dissociation from Ca(2+)-free CaM, wider CNTs still bind firmly to CaM, indicating a potential failure of Ca(2+) regulation. Such a size-dependent impact of CNTs on the dynamic properties of CaM is a result of the excessively strong hydrophobic interactions between the wider CNTs and CaM. These simulation results were confirmed by circular dichroism spectroscopy, which showed that the secondary structures of CaM become insensitive to Ca(2+) concentrations after the addition of CNTs. Our findings indicate that the cytotoxicity of nanoparticles to proteins arises not only from the inhibition of static protein structures (binding pockets), but also from impacts on their dynamic properties.

Chitosan/CNTs green nanocomposite membrane: Synthesis, swelling and polyaromatic hydrocarbons removal

International Nuclear Information System (INIS)

Bibi, Saira; Yasin, Tariq; Hassan, Safia; Riaz, Muhammad; Nawaz, Mohsan

2015-01-01

Carbon nanotubes (CNTs) were irradiated in air at 100 kGy under gamma radiations. The Raman spectroscopy of γ-treated CNTs showed distinctive changes in the absorption bands. The CNTs were mixed with blend of chitosan (Cs)/poly (vinyl alcohol) (PVA) and crosslinked with silane. The chemical reactions between the components affected the position and intensities of the infrared bands. Scanning electron micrograph of Cs/CNTs nanocomposite membrane showed the homogeneous dispersion of CNTs in the polymer matrix. The addition of CNTs lowered its swelling in water. Naphthalene (NAPH) was selected as a model compound and its removal was studied using HPLC technique. This membrane showed fast uptake of NAPH and 87% was removed from water within 30 min. The NAPH loaded membrane showed strong chemical interactions and cannot be desorbed. The fast uptake of PAHs and the green nature of this membrane made them suitable candidates for clean-up purposes. - Highlights: • Radiation modified CNTs and chitosan gave nanocomposite membranes. • This membrane showed hydrogel properties. • This membrane was used for the removal of naphthalene. • The green nature made them suitable candidates for clean-up purposes of PAH

Preparation and characterization of PVC /ENR/CNTs Nano composites

International Nuclear Information System (INIS)

Ratnam, C.T.; Nur Azrini Ramlee; Keong, C.C.

2011-01-01

Poly (vinyl chloride), PVC/ epoxidized natural rubber blend, ENR/ carbon nano tubes, CNTs were prepared by using melt and solution blending methods. Addition of 2 phr of CNTs found to cause a drop in the tensile strength, Ts of the 50/ 50 PVC/ ENR blend. The nano composites prepared by the melt blending method exhibited higher values of Ts compared to the nano composites prepared by solution blending. Melt blending found to be an efficient method to prepare PVC/ ENR/ CNTs nano composites. (author)

Aligning the unalignable: bacteriophage whole genome alignments.

Science.gov (United States)

Bérard, Sèverine; Chateau, Annie; Pompidor, Nicolas; Guertin, Paul; Bergeron, Anne; Swenson, Krister M

2016-01-13

In recent years, many studies focused on the description and comparison of large sets of related bacteriophage genomes. Due to the peculiar mosaic structure of these genomes, few informative approaches for comparing whole genomes exist: dot plots diagrams give a mostly qualitative assessment of the similarity/dissimilarity between two or more genomes, and clustering techniques are used to classify genomes. Multiple alignments are conspicuously absent from this scene. Indeed, whole genome aligners interpret lack of similarity between sequences as an indication of rearrangements, insertions, or losses. This behavior makes them ill-prepared to align bacteriophage genomes, where even closely related strains can accomplish the same biological function with highly dissimilar sequences. In this paper, we propose a multiple alignment strategy that exploits functional collinearity shared by related strains of bacteriophages, and uses partial orders to capture mosaicism of sets of genomes. As classical alignments do, the computed alignments can be used to predict that genes have the same biological function, even in the absence of detectable similarity. The Alpha aligner implements these ideas in visual interactive displays, and is used to compute several examples of alignments of Staphylococcus aureus and Mycobacterium bacteriophages, involving up to 29 genomes. Using these datasets, we prove that Alpha alignments are at least as good as those computed by standard aligners. Comparison with the progressive Mauve aligner - which implements a partial order strategy, but whose alignments are linearized - shows a greatly improved interactive graphic display, while avoiding misalignments. Multiple alignments of whole bacteriophage genomes work, and will become an important conceptual and visual tool in comparative genomics of sets of related strains. A python implementation of Alpha, along with installation instructions for Ubuntu and OSX, is available on bitbucket (https://bitbucket.org/thekswenson/alpha).

Specification and R and D Program on Magnet Alignment Tolerances for NSLS-II

International Nuclear Information System (INIS)

Kramer, S.L.; Jain, A.K.

2009-01-01

The NSLS-II light source is a proposed 3 GeV storage ring, with the potential for ultra-low emittance. Despite the reduced emittance goal for the bare lattice, the closed orbit amplification factors are on average >55 in both planes, for random quadrupole alignment errors. The high chromaticity will also require strong sextupoles and the low 3 GeV energy will require large dynamic and momentum aperture to insure adequate lifetime. This will require tight alignment tolerances (∼ 30(micro)m) on the multipole magnets during installation. By specifying tight alignment tolerances of the magnets on the support girders, the random alignment tolerances of the girders in the tunnel can be significantly relaxed. Using beam based alignment to find the golden orbit through the quadrupole centers, the closed orbit offsets in the multipole magnets will then be reduced to essentially the alignment errors of the magnets, restoring much of the dynamic aperture and lifetime of the bare lattice. Our R and D program to achieve these tight alignment tolerances of the magnets on the girders using a vibrating wire technique, will be discussed and initial results presented.

Synthesis and characterization of functionalized CNTs using soya and milk protein

Science.gov (United States)

saxena, Sanjay; ranu, Rachana; Hait, Chandan; Priya, Shruti

2014-10-01

Nanotechnology is the study of the phenomenon and manipulation of matter at atomic and molecular scale to enhance their older property and generate several new properties. Carbon nanotubes (CNTs) are one of the most commonly mentioned building blocks of nanotechnology. CNTs are very prevalent in today's world of medical research and are being highly researched in the fields of efficient drug delivery and bio sensing methods for disease treatment and health monitoring. There are number of methods for synthesizing CNTs. This is a biological method for synthesis of CNTs in which protein is used as carbon source and amino acids present in protein form complex with metal salt. The CNTs synthesized are then characterized and functionalized using techniques such as transmission electron microscopy, Fourier transform infra-red, nuclear magnetic resonance, ultra-violet visible spectroscopy, X-ray diffraction, etc. The properties of the synthesized CNTs are studied with the help of techniques such as thermo-gravimetric analysis, differential thermal analysis, and vibrating sample magnetometer, etc.

Chitosan/CNTs green nanocomposite membrane: synthesis, swelling and polyaromatic hydrocarbons removal.

Science.gov (United States)

Bibi, Saira; Yasin, Tariq; Hassan, Safia; Riaz, Muhammad; Nawaz, Mohsan

2015-01-01

Carbon nanotubes (CNTs) were irradiated in air at 100 kGy under gamma radiations. The Raman spectroscopy of γ-treated CNTs showed distinctive changes in the absorption bands. The CNTs were mixed with blend of chitosan (Cs)/poly (vinyl alcohol) (PVA) and crosslinked with silane. The chemical reactions between the components affected the position and intensities of the infrared bands. Scanning electron micrograph of Cs/CNTs nanocomposite membrane showed the homogeneous dispersion of CNTs in the polymer matrix. The addition of CNTs lowered its swelling in water. Naphthalene (NAPH) was selected as a model compound and its removal was studied using HPLC technique. This membrane showed fast uptake of NAPH and 87% was removed from water within 30 min. The NAPH loaded membrane showed strong chemical interactions and cannot be desorbed. The fast uptake of PAHs and the green nature of this membrane made them suitable candidates for clean-up purposes. Copyright © 2014 Elsevier B.V. All rights reserved.

Preparation of magnetic carbon nanotubes (Mag-CNTs) for biomedical and biotechnological applications.

Science.gov (United States)

Masotti, Andrea; Caporali, Andrea

2013-12-18

Carbon nanotubes (CNTs) have been widely studied for their potential applications in many fields from nanotechnology to biomedicine. The preparation of magnetic CNTs (Mag-CNTs) opens new avenues in nanobiotechnology and biomedical applications as a consequence of their multiple properties embedded within the same moiety. Several preparation techniques have been developed during the last few years to obtain magnetic CNTs: grafting or filling nanotubes with magnetic ferrofluids or attachment of magnetic nanoparticles to CNTs or their polymeric coating. These strategies allow the generation of novel versatile systems that can be employed in many biotechnological or biomedical fields. Here, we review and discuss the most recent papers dealing with the preparation of magnetic CNTs and their application in biomedical and biotechnological fields.

A new approach to design safe CNTs with an understanding of redox potential.

Science.gov (United States)

Tsuruoka, Shuji; Cassee, Flemming R; Castranova, Vincent

2013-09-02

Carbon nanotubes (CNTs) are being increasingly industrialized and applied for various products. As of today, although several toxicological evaluations of CNTs have been conducted, designing safer CNTs is not practiced because reaction kinetics of CNTs with bioactive species is not fully understood. The authors propose a kinetic mechanism to establish designing safe CNTs as a new goal. According to a literature search on the behavior of CNTs and the effects of impurities, it is found that chemical reactions on CNT surface are attributed to redox reactions involving metal impurities and carbon structures at the CNT surface. A new goal is proposed to design safer CNTs using the redox potential hypothesis. The value of this hypothesis must be practically investigated and proven through the further experiments.

Splitting of a vertical multiwalled carbon nanotube carpet to a graphene nanoribbon carpet and its use in supercapacitors.

Science.gov (United States)

Zhang, Chenguang; Peng, Zhiwei; Lin, Jian; Zhu, Yu; Ruan, Gedeng; Hwang, Chih-Chau; Lu, Wei; Hauge, Robert H; Tour, James M

2013-06-25

Potassium vapor was used to longitudinally split vertically aligned multiwalled carbon nanotubes carpets (VA-CNTs). The resulting structures have a carpet of partially split MWCNTs and graphene nanoribbons (GNRs). The split structures were characterized by scanning electron microscopy, transmission electron microscopy, atomic force microscopy, Raman spectroscopy and X-ray photoelectron spectroscopy. When compared to the original VA-CNTs carpet, the split VA-CNTs carpet has enhanced electrochemical performance with better specific capacitance in a supercapacitor. Furthermore, the split VA-CNTs carpet has excellent cyclability as a supercapacitor electrode material. There is a measured maximum power density of 103 kW/kg at an energy density of 5.2 Wh/kg and a maximum energy density of 9.4 Wh/kg. The superior electrochemical performances of the split VA-CNTs can be attributed to the increased surface area for ion accessibility after splitting, and the lasting conductivity of the structure with their vertical conductive paths based on the preserved GNR alignment.

Microstructural and optical properties of nanocrystalline ZnO deposited onto vertically aligned carbon nanotubes by physical vapor deposition

Energy Technology Data Exchange (ETDEWEB)

Borkar, Tushar [Department of Materials Science and Engineering and Center for Advanced Research and Technology, University of North Texas, Denton 76203 (United States); Chang, Won Seok [Korea Institute of Machinery and Materials, 104 Sinseongno, Yuseong-gu, Daejeon 305-343 (Korea, Republic of); Hwang, Jun Yeon, E-mail: Junyeon.Hwang@kist.re.kr [Department of Materials Science and Engineering and Center for Advanced Research and Technology, University of North Texas, Denton 76203 (United States); Institute of Advanced Composite Materials, Korea Institute of Science and Technology, Jeonbuk 565-902 (Korea, Republic of); Shepherd, Nigel D.; Banerjee, Rajarshi [Department of Materials Science and Engineering and Center for Advanced Research and Technology, University of North Texas, Denton 76203 (United States)

2012-10-15

Nanocrystalline ZnO films with thicknesses of 5 nm, 10 nm, 20 nm, and 50 nm were deposited via magnetron sputtering onto the surface of vertically aligned multi-walled carbon nanotubes (MWCNTs). The ZnO/CNTs heterostructures were characterized by scanning electron microscopy, high resolution transmission electron microscopy, and X-ray diffraction studies. No structural degradation of the CNTs was observed and photoluminescence (PL) measurements of the nanostructured ZnO layers show that the optical properties of these films are typical of ZnO deposited at low temperatures. The results indicate that magnetron sputtering is a viable technique for growing heterostructures and depositing functional layers onto CNTs.

Hydrogenation of Phenol over Pt/CNTs: The Effects of Pt Loading and Reaction Solvents

OpenAIRE

Feng Li; Bo Cao; Wenxi Zhu; Hua Song; Keliang Wang; Cuiqin Li

2017-01-01

Carbon nanotubes (CNTs)-supported Pt nanoparticles were prepared with selective deposition of Pt nanoparticles inside and outside CNTs (Pt–in/CNTs and Pt–out/CNTs). The effects of Pt loading and reaction solvents on phenol hydrogenation were investigated. The Pt nanoparticles in Pt–in/CNTs versus Pt–out/CNTs are smaller and better dispersed. The catalytic activity and reuse stability toward phenol hydrogenation both improved markedly. The dichloromethane–water mixture as the reaction solvent,...

Oxygen plasma assisted end-opening and field emission enhancement in vertically aligned multiwall carbon nanotubes

International Nuclear Information System (INIS)

Mathur, A.; Roy, S.S.; Hazra, K.S.; Wadhwa, S.; Ray, S.C.; Mitra, S.K.; Misra, D.S.; McLaughlin, J.A.

2012-01-01

Highlights: ► We showed Ar/O 2 plasma can be effective for the end opening of aligned CNTs. ► The field emission property was dramatically enhanced after plasma modification. ► Microstructures were clearly understood by Raman and SEM analysis. ► Surface wet-ability at various functionalised conditions was studied. - Abstract: This paper highlights the changes in micro-structural and field emission properties of vertically aligned carbon nanotubes (VACNTs) via oxygen plasma treatment. We find that exposure of very low power oxygen plasma (6 W) at 13.56 MHz for 15–20 min, opens the tip of vertically aligned CNTs. Scanning electron microscopy and transmission electron microscopy images were used to identify the quality and micro-structural changes of the nanotube morphology and surfaces. Raman spectra showed that the numbers of defects were increased throughout the oxygen plasma treatment process. In addition, the hydrophobic nature of the VACNTs is altered significantly and the contact angle decreases drastically from 110° to 40°. It was observed that the electron field emission (EFE) characteristics are significantly enhanced. The turn-on electric field (ETOE) of CNTs decreased from ∼0.80 V μm −1 (untreated) to ∼0.60 V μm −1 (oxygen treated). We believe that the open ended VACNTs would be immensely valuable for applications such as micro/nanofluidic based filtering elements and display devices.

Oxygen plasma assisted end-opening and field emission enhancement in vertically aligned multiwall carbon nanotubes

Energy Technology Data Exchange (ETDEWEB)

Mathur, A. [NIBEC, School of Engineering, University of Ulster, Jordanstown, BT37 0QB (United Kingdom); Roy, S.S., E-mail: sinharoy@ualberta.ca [Department of Mechanical Engineering, University of Alberta, Edmonton, T6T 2G8 (Canada); Hazra, K.S. [Department of Physics, IIT Bombay, Powai, Mumbai-400076 (India); Wadhwa, S. [NIBEC, School of Engineering, University of Ulster, Jordanstown, BT37 0QB (United Kingdom); Ray, S.C. [School of Physics, University of the Witwatersrand, WITS 2050, Johannesburg (South Africa); Mitra, S.K. [Department of Mechanical Engineering, University of Alberta, Edmonton, T6T 2G8 (Canada); Misra, D.S. [Department of Physics, IIT Bombay, Powai, Mumbai-400076 (India); McLaughlin, J.A. [NIBEC, School of Engineering, University of Ulster, Jordanstown, BT37 0QB (United Kingdom)

2012-05-15

Highlights: Black-Right-Pointing-Pointer We showed Ar/O{sub 2} plasma can be effective for the end opening of aligned CNTs. Black-Right-Pointing-Pointer The field emission property was dramatically enhanced after plasma modification. Black-Right-Pointing-Pointer Microstructures were clearly understood by Raman and SEM analysis. Black-Right-Pointing-Pointer Surface wet-ability at various functionalised conditions was studied. - Abstract: This paper highlights the changes in micro-structural and field emission properties of vertically aligned carbon nanotubes (VACNTs) via oxygen plasma treatment. We find that exposure of very low power oxygen plasma (6 W) at 13.56 MHz for 15-20 min, opens the tip of vertically aligned CNTs. Scanning electron microscopy and transmission electron microscopy images were used to identify the quality and micro-structural changes of the nanotube morphology and surfaces. Raman spectra showed that the numbers of defects were increased throughout the oxygen plasma treatment process. In addition, the hydrophobic nature of the VACNTs is altered significantly and the contact angle decreases drastically from 110 Degree-Sign to 40 Degree-Sign . It was observed that the electron field emission (EFE) characteristics are significantly enhanced. The turn-on electric field (ETOE) of CNTs decreased from {approx}0.80 V {mu}m{sup -1} (untreated) to {approx}0.60 V {mu}m{sup -1} (oxygen treated). We believe that the open ended VACNTs would be immensely valuable for applications such as micro/nanofluidic based filtering elements and display devices.

Nonhomogeneous morphology and the elastic modulus of aligned carbon nanotube films

International Nuclear Information System (INIS)

Won, Yoonjin; Gao, Yuan; Kenny, Thomas W; Goodson, Kenneth E; Guzman de Villoria, Roberto; Wardle, Brian L; Xiang, Rong; Maruyama, Shigeo

2015-01-01

Carbon nanotube (CNT) arrays offer the potential to develop nanostructured materials that leverage their outstanding physical properties. Vertically aligned carbon nanotubes (VACNTs), also named CNT forests, CNT arrays, or CNT turfs, can provide high heat conductivity and sufficient mechanical compliance to accommodate thermal expansion mismatch for use as thermal interface materials (TIMs). This paper reports measurements of the in-plane moduli of vertically aligned, single-walled CNT (SWCNT) and multi-walled CNT (MWCNT) films. The mechanical response of these films is related to the nonhomogeneous morphology of the grown nanotubes, such as entangled nanotubes of a top crust layer, aligned CNTs in the middle region, and CNTs in the bottom layer. To investigate how the entanglements govern the overall mechanical moduli of CNT films, we remove the crust layer consisting of CNT entanglements by etching the CNT films from the top. A microfabricated cantilever technique shows that crust removal reduces the resulting moduli of the etched SWCNT films by as much as 40%, whereas the moduli of the etched MWCNT films do not change significantly, suggesting a minimal crust effect on the film modulus for thick MWCNT films (>90 μm). This improved understanding will allow us to engineer the mechanical moduli of CNT films for TIMs or packaging applications. (paper)

Nonhomogeneous morphology and the elastic modulus of aligned carbon nanotube films

Science.gov (United States)

Won, Yoonjin; Gao, Yuan; Guzman de Villoria, Roberto; Wardle, Brian L.; Xiang, Rong; Maruyama, Shigeo; Kenny, Thomas W.; Goodson, Kenneth E.

2015-11-01

Carbon nanotube (CNT) arrays offer the potential to develop nanostructured materials that leverage their outstanding physical properties. Vertically aligned carbon nanotubes (VACNTs), also named CNT forests, CNT arrays, or CNT turfs, can provide high heat conductivity and sufficient mechanical compliance to accommodate thermal expansion mismatch for use as thermal interface materials (TIMs). This paper reports measurements of the in-plane moduli of vertically aligned, single-walled CNT (SWCNT) and multi-walled CNT (MWCNT) films. The mechanical response of these films is related to the nonhomogeneous morphology of the grown nanotubes, such as entangled nanotubes of a top crust layer, aligned CNTs in the middle region, and CNTs in the bottom layer. To investigate how the entanglements govern the overall mechanical moduli of CNT films, we remove the crust layer consisting of CNT entanglements by etching the CNT films from the top. A microfabricated cantilever technique shows that crust removal reduces the resulting moduli of the etched SWCNT films by as much as 40%, whereas the moduli of the etched MWCNT films do not change significantly, suggesting a minimal crust effect on the film modulus for thick MWCNT films (>90 μm). This improved understanding will allow us to engineer the mechanical moduli of CNT films for TIMs or packaging applications.

[Preparation and catalytic activity of surface-modification CNTs/TiO2 composite photocatalysts].

Science.gov (United States)

Wang, Huan-Ying; Li, Wen-Jun; Chang, Zhi-Dong; Zhou, Hua-Lei; Guo, Hui-Chao

2011-09-01

A novel kind of carbon nanotubes/titanium dioxide (CNTs/TiO2) composite photocatalyst was prepared by a modified sol-gel method in which the nanoscaled TiO2 particles were uniformly deposited on the CNTs modified with poly(vinyl pyrrolidone) (PVP). The composites were characterized by a range of analytical techniques including high resolution transmission electron microscopy (TEM), X-ray diffraction (XRD), and X-ray photoelectron spectroscopy (XPS). The results show the successful covering of the CNTs with PVP, forming core-shell structure. The nanoscaled TiO2 particles were uniformly deposited on the surface of CNTs reducing the bare CNTs which avoid losing the absorption and scattering of photons. The combination of CNTs and TiO2 particles imply the enhanced interactions between the CNTs and TiO2 interface which possibly becomes heterojunction. The composites become mesoporous crystalline TiO2 (anatase) clusters after annealing at 500 degrees C, and the surface area increases obviously. The photocatalytic activities of surface modification CNTs/TiO2 (smCNTs/TiO2) composites are extremely enhanced from the results of the photodegradation of methylene blue (MB).

Alignment of SWNTs by protein-ligand interaction of functionalized magnetic particles under low magnetic fields.

Science.gov (United States)

Park, Tae Jung; Park, Jong Pil; Lee, Seok Jae; Jung, Dae-Hwan; Ko, Young Koan; Jung, Hee-Tae; Lee, Sang Yup

2011-05-01

Carbon nanotubes (CNTs) have attracted considerable attention for applications using their superior mechanical, thermal and electrical properties. A simple method to controllably align single-walled CNTs (SWNTs) by using magnetic particles embedded with superparamagnetic iron oxide as an accelerator under the magnetic field was developed. The functionalization of SWNTs using biotin, interacted with streptavidin-coupled magnetic particles (micro-to-nano in diameter), and layer-by-layer assembly were performed for the alignment of a particular direction onto the clean silicon and the gold substrate at very low magnetic forces (0.02-0.89 T) at room temperature. The successful alignment of the SWNTs with multi-layer film was observed by scanning electron microscopy (SEM) and transmission electron microscopy (TEM). By changing the orientation and location of the substrates, crossed-networks of SWNTs-magnetic particle complex could easily be fabricated. We suggest that this approach, which consists of a combination of biological interaction among streptavidin-biotin and magnetite particles, should be useful for lateral orientation of individual SWNTs with controllable direction.

Alignment of the ATLAS inner detector for the LHC Run II

CERN Document Server

Butti, Pierfrancesco; The ATLAS collaboration

2015-01-01

ATLAS a multipurpose experiment at the LHC proton-proton collider. Its physics goals require high resolution, unbiased measurement of all charged particle kinematic parameters. These critically depend on the layout and performance of the tracking system, notably quality of its offline alignment. ATLAS is equipped with a tracking system built using different technologies, silicon planar sensors (pixel and micro-strip) and gaseous drift- tubes, all embedded in a 2T solenoidal magnetic field. For the LHC Run II, the system has been upgraded with the installation of a new pixel layer, the Insertable B-layer (IBL). Offline track alignment of the ATLAS tracking system has to deal with about 700,000 degrees of freedom (DoF) defining its geometrical parameters. The task requires using very large data sets and represents a considerable numerical challenge in terms of both CPU time and precision. The adopted strategy uses a hierarchical approach to alignment, combining local and global least squares techniques. An outl...

New Three-Dimensional Porous Electrode Concept: Vertically-Aligned Carbon Nanotubes Directly Grown on Embroidered Copper Structures.

Science.gov (United States)

Aguiló-Aguayo, Noemí; Amade, Roger; Hussain, Shahzad; Bertran, Enric; Bechtold, Thomas

2017-12-11

New three-dimensional (3D) porous electrode concepts are required to overcome limitations in Li-ion batteries in terms of morphology (e.g., shapes, dimensions), mechanical stability (e.g., flexibility, high electroactive mass loadings), and electrochemical performance (e.g., low volumetric energy densities and rate capabilities). Here a new electrode concept is introduced based on the direct growth of vertically-aligned carbon nanotubes (VA-CNTs) on embroidered Cu current collectors. The direct growth of VA-CNTs was achieved by plasma-enhanced chemical vapor deposition (PECVD), and there was no application of any post-treatment or cleaning procedure. The electrochemical behavior of the as-grown VA-CNTs was analyzed by charge/discharge cycles at different specific currents and with electrochemical impedance spectroscopy (EIS) measurements. The results were compared with values found in the literature. The as-grown VA-CNTs exhibit higher specific capacities than graphite and pristine VA-CNTs found in the literature. This together with the possibilities that the Cu embroidered structures offer in terms of specific surface area, total surface area, and designs provide a breakthrough in new 3D electrode concepts.

Thermal buckling behavior of defective CNTs under pre-load: A molecular dynamics study.

Science.gov (United States)

Mehralian, Fahimeh; Tadi Beni, Yaghoub; Kiani, Yaser

2017-05-01

Current study is concentrated on the extraordinary properties of defective carbon nanotubes (CNTs). The role of vacancy defects in thermal buckling response of precompressed CNTs is explored via molecular dynamics (MD) simulations. Defective CNTs are initially compressed at a certain ratio of their critical buckling strain and then undergo a uniform temperature rise. Comprehensive study is implemented on both armchair and zigzag CNTs with different vacancy defects including monovacancy, symmetric bivacancy and asymmetric bivacancy. The results reveal that defects have a pronounced impact on the buckling behavior of CNTs; interestingly, defective CNTs under compressive pre-load show higher resistance to thermal buckling than pristine ones. In the following, the buckling response of defective CNTs is shown to be dependent on the vacancy defects, location of defects and chirality. Copyright © 2017 Elsevier Inc. All rights reserved.

CoS/CNTs hybrid structure for improved performance lithium ion battery

Energy Technology Data Exchange (ETDEWEB)

Wang, Huijun; Ma, Jingjing; Liu, Sheng; Nie, Longying; Chai, Yaqin; Yang, Xia, E-mail: xiayang2@swu.edu.cn; Yuan, Ruo, E-mail: yuanruo@swu.edu.cn

2016-08-15

Cobalt sulfide (CoS) has a high theoretical capacity as an anode materials for lithium ion batteries (LIBs), however it suffers from poor cyclability and weak retention. Therefore, a lot of efforts have been devoted to overcome these defects. In this work, cobalt sulfide/carbon nanotubes (CoS/CNTs) nanocomposites were prepared by a simple and effective solvothermal method. The nanocomposites were constructed by CoS nanoparticles coated on the carbon nanotubes and the electrochemical performances of the CoS/CNTs nanocomposites were investigated as anode materials for LIBs. The results showed that the materials had superior cycle stability and kept a high discharge capacity of 780 mAh g{sup −1} after 50 cycles at the current density of 100 mA g{sup −1}. The excellent electrochemical performances are due to the good combination of the hybrid structure and better electron transportation originated from CNTs. The CoS/CNTs nanocomposites with excellent rate capabilities and super capabilities could be promising anode material for lithium ion battery. - Highlights: • CoS/CNTs nanocomposites were prepared by a simple and effective solvothermal method. • Compared with pristine CoS, CoS/CNTs nanocomposites had superior cycle stability. • CoS/CNTs nanocomposites kept a high discharge capacity of 780 mAh g{sup −1} after 50 cycles at 100 mA g{sup −1}.

Cationic Zn-Porphyrin Polymer Coated onto CNTs as a Cooperative Catalyst for the Synthesis of Cyclic Carbonates.

Science.gov (United States)

Jayakumar, Sanjeevi; Li, He; Chen, Jian; Yang, Qihua

2018-01-24

The development of solid catalysts containing multiple active sites that work cooperatively is very attractive for biomimetic catalysis. Herein, we report the synthesis of bifunctional catalysts by supporting cationic porphyrin-based polymers on carbon nanotubes (CNTs) using the direct reaction of 5,10,15,20-tetrakis(4-pyridyl)porphyrin zinc(II), di(1H-imidazol-1-yl)methane, and 1,4-bis(bromomethyl)benzene in the presence of CNTs. The bifunctional catalysts could efficiently catalyze the cycloaddition reaction of epoxides and CO 2 under solvent-free conditions with porphyrin zinc(II) as the Lewis acid site and a bromine anion as a nucleophilic agent working in a cooperative way. Furthermore, a relative amount of porphyrin zinc(II) and quaternary ammonium bromide could be facilely adjusted for facilitating cooperative behavior. The bifunctional catalyst with a TOF up to 2602 h -1 is much more active than the corresponding homogeneous counterpart and is one of the most active heterogeneous catalysts ever reported under cocatalyst-free conditions. The high activity is mainly attributed to the enhanced cooperation effect of the bifunctional catalyst. With a wide substrate scope, the bifunctional catalyst could be stably recycled. This work demonstrates a new approach for the generation of a cooperative activation effect for solid catalysts.

The Surface Interface Characteristics of Vertically Aligned Carbon Nanotube and Graphitic Carbon Fiber Arrays Grown by Thermal and Plasma Enhanced Chemical Vapor Deposition

Science.gov (United States)

Delzeit, Lance; Nguyen, Cattien; Li, Jun; Han, Jie; Meyyappan, M.

2002-01-01

The development of nano-arrays for sensors and devices requires the growth of arrays with the proper characteristics. One such application is the growth of vertically aligned carbon nanotubes (CNTs) and graphitic carbon fibers (GCFs) for the chemical attachment of probe molecules. The effectiveness of such an array is dependent not only upon the effectiveness of the probe and the interface between that probe and the array, but also the array and the underlaying substrate. If that array is a growth of vertically aligned CNTs or GCFs then the attachment of that array to the surface is of the utmost importance. This attachment provides the mechanical stability and durability of the array, as well as, the electrical properties of that array. If the detection is to be acquired through an electrical measurement, then the appropriate resistance between the array and the surface need to be fabricated into the device. I will present data on CNTs and GCFs grown from both thermal and plasma enhanced chemical vapor deposition. The focus will be on the characteristics of the metal film from which the CNTs and GCFs are grown and the changes that occur due to changes within the growth process.

Growth of vertically aligned arrays of carbon nanotubes for high field emission

International Nuclear Information System (INIS)

Kim, D.; Lim, S.H.; Guilley, A.J.; Cojocaru, C.S.; Bouree, J.E.; Vila, L.; Ryu, J.H.; Park, K.C.; Jang, J.

2008-01-01

Vertically aligned multi-walled carbon nanotubes have been grown on Ni-coated silicon substrates, by using either direct current diode or triode plasma-enhanced chemical vapor deposition at low temperature (around 620 deg. C). Acetylene gas has been used as the carbon source while ammonia and hydrogen have been used for etching. However densely packed (∼ 10 9 cm -2 ) CNTs were obtained when the pressure was ∼ 100 Pa. The alignment of nanotubes is a necessary, but not a sufficient condition in order to get an efficient electron emission: the growth of nanotubes should be controlled along regular arrays, in order to minimize the electrostatic interactions between them. So a three dimensional numerical simulation has been developed to calculate the local electric field in the vicinity of the tips for a finite square array of nanotubes and thus to calculate the maximum of the electron emission current density as a function of the spacing between nanotubes. Finally the triode plasma-enhanced process combined with pre-patterned catalyst films (using different lithography techniques) has been chosen in order to grow regular arrays of aligned CNTs with different pitches in the micrometer range. The comparison between the experimental and the simulation data permits to define the most efficient CNT-based electron field emitters

Determination of material constants of vertically aligned carbon nanotube structures in compressions

International Nuclear Information System (INIS)

Li, Yupeng; Kang, Junmo; Choi, Jae-Boong; Nam, Jae-Do; Suhr, Jonghwan

2015-01-01

Different chemical vapour deposition (CVD) fabrication conditions lead to a wide range of variation in the microstructure and morphologies of carbon nanotubes (CNTs), which actually determine the compressive mechanical properties of CNTs. However, the underlying relationship between the structure/morphology and mechanical properties of CNTs is not fully understood. In this study, we characterized and compared the structural and morphological properties of three kinds of vertically aligned carbon nanotube (VACNT) arrays from different CVD fabrication methods and performed monotonic compressive tests for each VACNT array. The compressive stress–strain responses and plastic deformation were first compared and analyzed with nanotube buckling behaviours. To quantify the compressive properties of the VACNT arrays, a strain density energy function was used to determine their intrinsic material constants. Then, the structural and morphological effects on the quantified material constants of the VACNTs were statistically investigated and analogized to cellular materials with an open-cell model. The statistical analysis shows that density, defect degree, and the moment of inertia of the CNTs are key factors in the improvement of the compressive mechanical properties of VACNT arrays. This approach could allow a model-driven CNT synthesis for engineering their mechanical behaviours. (paper)

WC Nanocrystals Grown on Vertically Aligned Carbon Nanotubes: An Efficient and Stable Electrocatalyst for Hydrogen Evolution Reaction.

Science.gov (United States)

Fan, Xiujun; Zhou, Haiqing; Guo, Xia

2015-05-26

Single nanocrystalline tungsten carbide (WC) was first synthesized on the tips of vertically aligned carbon nanotubes (VA-CNTs) with a hot filament chemical vapor deposition (HF-CVD) method through the directly reaction of tungsten metal with carbon source. The VA-CNTs with preservation of vertical structure integrity and alignment play an important role to support the nanocrystalline WC growth. With the high crystallinity, small size, and uniform distribution of WC particles on the carbon support, the formed WC-CNTs material exhibited an excellent catalytic activity for hydrogen evolution reaction (HER), giving a η10 (the overpotential for driving a current of 10 mA cm(-2)) of 145 mV, onset potential of 15 mV, exchange current density@ 300 mV of 117.6 mV and Tafel slope values of 72 mV dec(-1) in acid solution, and η10 of 137 mV, onset potential of 16 mV, exchange current density@ 300 mV of 33.1 mV and Tafel slope values of 106 mV dec(-1) in alkaline media, respectively. Electrochemical stability test further confirms the long-term operation of the catalyst in both acidic and alkaline media.

One-Pot Synthesis of Cu(II Complex with Partially Oxidized TTF Moieties

Directory of Open Access Journals (Sweden)

Hiroki Oshio

2012-07-01

Full Text Available The one-pot synthesis of a Cu(II complex with partially oxidized tetrathiafulvalene (TTF moieties in its capping MT-Hsae-TTF ligands, [CuII(MT-sae-TTF2] [CuICl2] was realized by the simultaneous occurrence of Cu(II complexation and CuIICl2 mediated oxidation of TTF moieties. The crystal structure was composed of one-dimensional columns formed by partially oxidized TTF moieties and thus the cation radical salt showed relatively high electrical conductivity. Tight binding band structure calculations indicated the existence of a Peierls gap due to the tetramerization of the TTF moieties in the one-dimensional stacking column at room temperature, which is consistent with the semiconducting behavior of this salt.

Use of Amino‐Functionalized CNTs and CVD Grown CNTs for Better Dispersion in Al Powder in the Fabrication of Composites

Energy Technology Data Exchange (ETDEWEB)

Singhal, S. K.; Mathur, R. B. [National Physical Laboratory (CSIR), New Delhi‐1100 12 (India); Mamta,; Teotia, Satish [Guru Jambheshwar University of Science and Technology, Hisar (India); Chahal, Rajiv [Nanoscience and Nanotechnology, Panjab University, Chandigarh (India)

2011-12-12

We report an improved process for the better dispersion of multiwalled carbon nanotubes (MWCNTs) in Al powder used for the fabrication of Al‐matrix composites employing powder metallurgy process. For obtaining a better dispersion of MWCNTs in Al, we used two types of MWCNTs. In the first type, the MWCNTs were firstly functionalized by using ammonium bi‐carbonate and mix with Al powder using a high energy ball mill in the presence of a process control agent. In the second type we grew MWCNTs directly on Al powder using CVD. Various mechanical properties of the composites including micro hardness, compressive strength etc. were determined. It has been observed that using functionalized MWCNTs (fCNTs) and CVD grown MWCNTs, these properties were found to enhance significantly. The dispersion of functionalized CNTs was studied by SEM and the interfacial bonding between functionalized CNTs and Al matrix using high resolution transmission electron microscopy (HRTEM).

Transfer of microstructure pattern of CNTs onto flexible substrate using hot press technique for sensing applications

International Nuclear Information System (INIS)

Mishra, Prabhash; Tai, Nyan-Hwa; Harsh; Islam, S.S.

2013-01-01

Graphical abstract: - Highlights: • Successfully transfer of microstructure patterned CNTs on PET substrate. • Demonstrate as resistor-based NH 3 gas sensor in the sub-ppm range. • Excellent photodetector having instantaneous response and recovery characteristics. • An effective technique to grow and produce flexible electronic device. - Abstract: In this work, we report the successful and efficient transfer process of two- dimensional (2-D) vertically aligned carbon nanotubes (CNTs) onto polyethylene terephthalate (PET) substrate by hot pressing method with an aim to develop flexible sensor devices. Carbon nanotubes are synthesized by cold wall thermal chemical vapor deposition using patterned SiO 2 substrate under low pressure. The height of the pattern of CNTs is controlled by reaction time. The entire growth and transfer process is carried out within 30 min. Strong adhesion between the nanotube and polyethylene terephthalate substrate was observed in the post-transferred case. Raman spectroscopy and scanning electron microscope (SEM) studies are used to analyze the microstructure of carbon nanotube film before and after hot pressing. This technique shows great potential for the fabrication of flexible sensing devices. We report for the first time, the application of patterned microstructure developed by this technique in the development of gas sensor and optoelectronic device. Surface resistive mode is used for detection of ammonia (NH 3 ) gas in the sub-ppm range. An impressive photoconducting response is also observed in the visible wavelength. The reproducibility of the sample was checked and the results indicate the possibility of use of carbon nanotube as gas sensor, photodetector, CCDs etc

Transfer of microstructure pattern of CNTs onto flexible substrate using hot press technique for sensing applications

Energy Technology Data Exchange (ETDEWEB)

Mishra, Prabhash [Department of Material Science and Engineering, National Tsing Hua University, Hsinchu 30013, Taiwan (China); Nano-Sensor Research Laboratory, F/O Engineering and Technology, Jamia Millia Islamia, Jamia Nagar, New Delhi (India); Tai, Nyan-Hwa [Department of Material Science and Engineering, National Tsing Hua University, Hsinchu 30013, Taiwan (China); Harsh [Nano-Sensor Research Laboratory, F/O Engineering and Technology, Jamia Millia Islamia, Jamia Nagar, New Delhi (India); Islam, S.S., E-mail: safiul5996@gmail.com [Nano-Sensor Research Laboratory, F/O Engineering and Technology, Jamia Millia Islamia, Jamia Nagar, New Delhi (India)

2013-08-01

Graphical abstract: - Highlights: • Successfully transfer of microstructure patterned CNTs on PET substrate. • Demonstrate as resistor-based NH{sub 3} gas sensor in the sub-ppm range. • Excellent photodetector having instantaneous response and recovery characteristics. • An effective technique to grow and produce flexible electronic device. - Abstract: In this work, we report the successful and efficient transfer process of two- dimensional (2-D) vertically aligned carbon nanotubes (CNTs) onto polyethylene terephthalate (PET) substrate by hot pressing method with an aim to develop flexible sensor devices. Carbon nanotubes are synthesized by cold wall thermal chemical vapor deposition using patterned SiO{sub 2} substrate under low pressure. The height of the pattern of CNTs is controlled by reaction time. The entire growth and transfer process is carried out within 30 min. Strong adhesion between the nanotube and polyethylene terephthalate substrate was observed in the post-transferred case. Raman spectroscopy and scanning electron microscope (SEM) studies are used to analyze the microstructure of carbon nanotube film before and after hot pressing. This technique shows great potential for the fabrication of flexible sensing devices. We report for the first time, the application of patterned microstructure developed by this technique in the development of gas sensor and optoelectronic device. Surface resistive mode is used for detection of ammonia (NH{sub 3}) gas in the sub-ppm range. An impressive photoconducting response is also observed in the visible wavelength. The reproducibility of the sample was checked and the results indicate the possibility of use of carbon nanotube as gas sensor, photodetector, CCDs etc.

A Study of CO2 Methanation over Ni-Based Catalysts Supported by CNTs with Various Textural Characteristics

Directory of Open Access Journals (Sweden)

Yanyan Feng

2015-01-01

Full Text Available This work studied the influence of textural characteristics of CNTs on catalytic performance of Ni/CNTs for CO2 methanation. The CNTs supports were prepared by chemical vapor deposition method using Ni/MgO catalysts, and acetonitrile and ethanol were used as carbon sources, respectively. The Ni/CNTs catalysts were prepared via impregnation method and characterized by X-ray diffraction (XRD, N2 adsorption/desorption, and temperature-programmed reduction (H2-TPR techniques. The results indicated that the textural characteristics of CNTs supports significantly impacted on the catalytic performance of Ni/CNTs. The catalyst Ni/CNTs-E (CNTs using ethanol as carbon source had good reducibility, high specific surface area, and moderate defects, resulting in higher CO2 conversion and CH4 yield, followed by Ni/CNTs-C (commercial CNTs and Ni/CNTs-A (CNTs using acetonitrile as carbon source. Based on Arrhenius formula, activation energies of the catalysts were calculated and were found decreased for Ni/CNTs-A and Ni/CNTs-E.

High stability and high activity Pd/ITO-CNTs electrocatalyst for direct formic acid fuel cell

International Nuclear Information System (INIS)

Qu, Wei-Li; Gu, Da-Ming; Wang, Zhen-Bo; Zhang, Jing-Jia

2014-01-01

Graphical abstract: The addition of ITO in Pd/CNTs catalyst significantly improves the activity and stability of catalyst for formic acid electrooxidation due to excellent stability and high electrical conductivity of ITO, and metal-support interaction between Pd nanoparticles and ITO. - Highlights: • Pd catalyst with ITO and CNTs as a mixture support for DFAFC was first prepared by microwave-assisted polyol process. • The activity and stability of Pd/ITO-CNTs catalyst is significantly higher than those of Pd/CNTs. • When ITO content is 50% of ITO/CNTs support mass, Pd/ITO-CNTs exhibits the best performance. - Abstract: Indium tin oxide (ITO) and carbon nanotube hybrid has been explored as a support for Pd catalyst. Pd/ITO-CNTs catalysts with different ITO contents were prepared by the microwave-assisted polyol process. The as-prepared Pd/ITO-CNTs catalysts were characterized by X-ray diffraction (XRD), energy dispersive analysis of X-ray (EDAX), X-ray photoelectron spectroscopy (XPS), transmission electron microscopy (TEM), high resolution transmission electron microscopy (HRTEM), and electrochemical measurements in this work. The TEM results show that Pd particle size distribution in the Pd/ITO-CNTs catalyst is more uniform than that in Pd/CNTs, indicating that the ITO can promote the dispersion of Pd nanoparticles. It is found that there is metal-support interaction between Pd nanoparticles and ITO in the Pd/ITO-CNTs catalyst through XPS test. The results of electrochemical tests prove that the Pd/ITO-CNTs catalysts exhibit higher electro-catalytic activity and stability than Pd/CNTs toward formic acid electrooxidation. When the ITO content is 50% of ITO-CNTs support mass, the Pd/ITO-CNTs catalyst has the best catalytic performance for formic acid electrooxidation. The peak current density of formic acid electrooxidation on the Pd/ITO-CNTs50% electrode is 1.53 times as high as that on Pd/CNTs, 2.31 times higher than that on Pd/ITO. The results of aging

Alignment of the CMS Tracker: Latest results from LHC Run-II

CERN Document Server

Mittag, Gregor

2017-01-01

The all-silicon design of the tracking system of the CMS experiment provides excellent measurements of charged-particle tracks and an efficient tagging of jets. Conditions of the CMS tracker changed repeatedly during the 2015/2016 shutdown and the 2016 data-taking period. Still the true position and orientation of each of the 15 148 silicon strip and 1440 silicon pixel modules need to be known with high precision for all intervals. The alignment constants also need to be promptly re-adjusted each time the state of the CMS magnet is changed between 0T and 3.8 T. Latest Run-II results of the CMS tracker alignment and resolution performance are presented, which are obtained using several millions of reconstructed tracks from collision and cosmic-ray data of 2016. The geometries and the resulting performance of physics observables are carefully validated. In addition to the offline alignment, an online procedure has been put in place which continuously monitors movements of the pixel high-level structures and tri...

Synthesis and characterization of magnetic Fe/CNTs composites with controllable Fe nanoparticle concentration

International Nuclear Information System (INIS)

Zhao Fan; Duan Hongyan; Wang Weigao; Wang Jun

2012-01-01

Fe/CNTs composites, with different concentrations of Fe nanoparticles (NPs) on carbon nanotube (CNT) surfaces, were successfully fabricated via a facile solvothermal method. The lengths of CNTs are up to 10 μm and the mean diameter of the Fe nanoparticles is about 25 nm. The structures, composition and magnetic properties of the Fe/CNTs were characterized by XRD, FTIR, FE-SEM, TEM and PPMS. We found that the concentrations of Fe nanoparticles depositing on the CNTs could be controlled by adjusting the initial mass ratio of ferrocene to CNTs. The Fe/CNTs composites display good ferromagnetic properties at room temperature, with a saturation magnetization of 125 emu/g-Fe and a coercivity of 276 Oe. The Curie temperature of the sample is about 1038 K, slightly lower than that (1043 K) of the bulk iron.

AAO-CNTs electrode on microfluidic flow injection system for rapid iodide sensing.

Science.gov (United States)

Phokharatkul, Ditsayut; Karuwan, Chanpen; Lomas, Tanom; Nacapricha, Duangjai; Wisitsoraat, Anurat; Tuantranont, Adisorn

2011-06-15

In this work, carbon nanotubes (CNTs) nanoarrays in anodized aluminum oxide (AAO-CNTs) nanopore is integrated on a microfluidic flow injection system for in-channel electrochemical detection of iodide. The device was fabricated from PDMS (polydimethylsiloxane) microchannel bonded on glass substrates that contains three-electrode electrochemical system, including AAO-CNTs as a working electrode, silver as a reference electrode and platinum as an auxiliary electrode. Aluminum, stainless steel catalyst, silver and platinum layers were sputtered on the glass substrate through shadow masks. Aluminum layer was then anodized by two-step anodization process to form nanopore template. CNTs were then grown in AAO template by thermal chemical vapor deposition. The amperometric detection of iodide was performed in 500-μm-wide and 100-μm-deep microchannels on the microfluidic chip. The influences of flow rate, injection volume and detection potential on the current response were optimized. From experimental results, AAO-CNTs electrode on chip offers higher sensitivity and wider dynamic range than CNTs electrode with no AAO template. Copyright © 2011 Elsevier B.V. All rights reserved.

Towards Robust and Accurate Multi-View and Partially-Occluded Face Alignment.

Science.gov (United States)

Xing, Junliang; Niu, Zhiheng; Huang, Junshi; Hu, Weiming; Zhou, Xi; Yan, Shuicheng

2018-04-01

Face alignment acts as an important task in computer vision. Regression-based methods currently dominate the approach to solving this problem, which generally employ a series of mapping functions from the face appearance to iteratively update the face shape hypothesis. One keypoint here is thus how to perform the regression procedure. In this work, we formulate this regression procedure as a sparse coding problem. We learn two relational dictionaries, one for the face appearance and the other one for the face shape, with coupled reconstruction coefficient to capture their underlying relationships. To deploy this model for face alignment, we derive the relational dictionaries in a stage-wised manner to perform close-loop refinement of themselves, i.e., the face appearance dictionary is first learned from the face shape dictionary and then used to update the face shape hypothesis, and the updated face shape dictionary from the shape hypothesis is in return used to refine the face appearance dictionary. To improve the model accuracy, we extend this model hierarchically from the whole face shape to face part shapes, thus both the global and local view variations of a face are captured. To locate facial landmarks under occlusions, we further introduce an occlusion dictionary into the face appearance dictionary to recover face shape from partially occluded face appearance. The occlusion dictionary is learned in a data driven manner from background images to represent a set of elemental occlusion patterns, a sparse combination of which models various practical partial face occlusions. By integrating all these technical innovations, we obtain a robust and accurate approach to locate facial landmarks under different face views and possibly severe occlusions for face images in the wild. Extensive experimental analyses and evaluations on different benchmark datasets, as well as two new datasets built by ourselves, have demonstrated the robustness and accuracy of our proposed

New Three-Dimensional Porous Electrode Concept: Vertically-Aligned Carbon Nanotubes Directly Grown on Embroidered Copper Structures

Directory of Open Access Journals (Sweden)

Noemí Aguiló-Aguayo

2017-12-01

Full Text Available New three-dimensional (3D porous electrode concepts are required to overcome limitations in Li-ion batteries in terms of morphology (e.g., shapes, dimensions, mechanical stability (e.g., flexibility, high electroactive mass loadings, and electrochemical performance (e.g., low volumetric energy densities and rate capabilities. Here a new electrode concept is introduced based on the direct growth of vertically-aligned carbon nanotubes (VA-CNTs on embroidered Cu current collectors. The direct growth of VA-CNTs was achieved by plasma-enhanced chemical vapor deposition (PECVD, and there was no application of any post-treatment or cleaning procedure. The electrochemical behavior of the as-grown VA-CNTs was analyzed by charge/discharge cycles at different specific currents and with electrochemical impedance spectroscopy (EIS measurements. The results were compared with values found in the literature. The as-grown VA-CNTs exhibit higher specific capacities than graphite and pristine VA-CNTs found in the literature. This together with the possibilities that the Cu embroidered structures offer in terms of specific surface area, total surface area, and designs provide a breakthrough in new 3D electrode concepts.

Novel real-time alignment and calibration of the LHCb detector in Run II

Energy Technology Data Exchange (ETDEWEB)

Xu, Z., E-mail: zhirui.xu@epfl.ch; Tobin, M.

2016-07-11

An automatic real-time alignment and calibration strategy of the LHCb detector was developed for the Run II. Thanks to the online calibration, tighter event selection criteria can be used in the trigger. Furthermore, the online calibration facilitates the use of hadronic particle identification using the Ring Imaging Cherenkov (RICH) detectors at the trigger level. The motivation for a real-time alignment and calibration of the LHCb detector is discussed from both the operational and physics performance points of view. Specific challenges of this novel configuration are discussed, as well as the working procedures of the framework and its performance.

Novel real-time alignment and calibration of the LHCb detector in Run II

CERN Document Server

AUTHOR|(CDS)2086132; Tobin, Mark

2016-01-01

An automatic real-time alignment and calibration strategy of the LHCb detector was developed for the Run II. Thanks to the online calibration, tighter event selection criteria can be used in the trigger. Furthermore, the online calibration facilitates the use of hadronic particle identification using the Ring Imaging Cherenkov (RICH) detectors at the trigger level. The motivation for a real-time alignment and calibration of the LHCb detector is discussed from both the operational and physics performance points of view. Specific challenges of this novel configuration are discussed, as well as the working procedures of the framework and its performance.

Alignment of the ATLAS Inner Detector upgraded for the LHC Run II

CERN Document Server

AUTHOR|(INSPIRE)INSPIRE-00386283; The ATLAS collaboration

2015-01-01

ATLAS is a multipurpose experiment at the LHC proton-proton collider. Its physics goals require high resolution, unbiased measurement of all charged particle kinematic parameters. These critically depend on the layout and performance of the tracking system, notably quality of its offline alignment. ATLAS is equipped with a tracking system built using different technologies, silicon planar sensors (pixel and micro-strip) and gaseous drift- tubes, all embedded in a 2T solenoidal magnetic field. For the LHC Run II, the system has been upgraded with the installation of a new pixel layer, the Insertable B-layer (IBL). Offline track alignment of the ATLAS tracking system has to deal with about 700,000 degrees of freedom (DoF) defining its geometrical parameters. The task requires using very large data sets and represents a considerable numerical challenge in terms of both CPU time and precision. The adopted strategy uses a hierarchical approach to alignment, combining local and global least squares techniques. An o...

Alignment of the ATLAS Inner Detector Upgraded for the LHC Run II

CERN Document Server

Butti, Pierfrancesco; The ATLAS collaboration

2015-01-01

ATLAS is a multipurpose experiment at the LHC proton-proton collider. Its physics goals require high resolution, unbiased measurement of all charged particle kinematic parameters. These critically depend on the layout and performance of the tracking system, notably quality of its offline alignment. ATLAS is equipped with a tracking system built using different technologies, silicon planar sensors (pixel and micro-strip) and gaseous drift- tubes, all embedded in a 2T solenoidal magnetic field. For the LHC Run II, the system has been upgraded with the installation of a new pixel layer, the Insertable B-layer (IBL). Offline track alignment of the ATLAS tracking system has to deal with about 700,000 degrees of freedom (DoF) defining its geometrical parameters. The task requires using very large data sets and represents a considerable numerical challenge in terms of both CPU time and precision. The adopted strategy uses a hierarchical approach to alignment, combining local and global least squares techniques. An o...

Nature and electronic properties of Y-junctions in CNTs and N-doped CNTs obtained by the pyrolysis of organometallic precursors

Science.gov (United States)

Deepak, F. L.; John, Neena Susan; Govindaraj, A.; Kulkarni, G. U.; Rao, C. N. R.

2005-08-01

Carbon nanotubes (CNTs) and N-doped CNTs with Y-junctions have been prepared by the pyrolysis of nickelocene-thiophene and nickel phthalocyanine-thiophene mixtures, respectively, the latter being reported for the first time. The junctions are free from the presence of sulfur and contain only carbon or carbon and nitrogen. The electronic properties of the junction nanotubes have been investigated by scanning tunneling microscopy. Tunneling conductance measurements reveal rectifying behavior with regions of coulomb blockade, the effect being much larger in the N-doped junction nanotubes.

Aligned Carbon Nanotube Arrays Bonded to Solid Graphite Substrates: Thermal Analysis for Future Device Cooling Applications

Directory of Open Access Journals (Sweden)

Betty T. Quinton

2018-05-01

Full Text Available Carbon nanotubes (CNTs are known for high thermal conductivity and have potential use as nano-radiators or heat exchangers. This paper focuses on the thermal performance of carpet-like arrays of vertically aligned CNTs on solid graphite substrates with the idea of investigating their behavior as a function of carpet dimensions and predicting their performance as thermal interface material (TIM for electronic device cooling. Vertically aligned CNTs were grown on highly oriented pyrolytic graphite (HOPG substrate, which creates a robust and durable all-carbon hierarchical structure. The multi-layer thermal analysis approach using Netzsch laser flash analysis system was used to evaluate their performance as a function of carpet height, from which their thermal properties can be determined. It was seen that the thermal resistance of the CNT array varies linearly with CNT carpet height, providing a unique way of decoupling the properties of the CNT carpet from its interface. This data was used to estimate the thermal conductivity of individual multi-walled nanotube strands in this carpet, which was about 35 W/m-K. The influence of CNT carpet parameters (aerial density, diameter, and length on thermal resistance of the CNT carpet and its potential advantages and limitations as an integrated TIM are discussed.

Detailed profiling of CNTs arrays along the growth window in a floating catalyst reactor

International Nuclear Information System (INIS)

Maghrebi, Morteza; Khodadadi, Abbas Ali; Mortazavi, Yadollah; Mhaisalkar, Subodh

2009-01-01

We report a detailed longitudinal and depth profiles of multi-wall carbon nanotubes (CNTs) arrays synthesized using xylene and ferrocene in a floating catalyst reactor. Point to point analyses of the CNTs grown in a 'growth window' with CNTs arrays longer than 0.5 mm were performed using optical microscopy, Raman spectroscopy, FESEM, high-resolution TGA/DTA, and TEM techniques. The heights of the CNTs arrays show a maximum at a mid point of the growth window, while a reverse trend of minimum is observed for iron-to-CNTs atomic ratios. The ratio of amorphous carbon to CNTs sharply increases along the growth window and from the bottom to top of CNTs arrays. The CNTs diameter also increases along the growth window, due to deposition of the amorphous carbon, which can be almost removed by temperature programmed oxidation up to around 500 deg. C. A base growth mechanism, the variations of catalyst content, residence time and temperature profile along the growth window, the adsorption and decomposition of polycyclic aromatic hydrocarbons to amorphous carbon, and a limited diffusion of hydrocarbon species through the arrays covered by excessive amorphous carbon may explain the results.

Diameter control of vertically aligned carbon nanotubes using CoFe2O4 nanoparticle Langmuir-Blodgett films

Science.gov (United States)

Tamiya, Shuhei; Sato, Taiga; Kushida, Masahito

2018-03-01

Vertically aligned carbon nanotubes (VA-CNTs) are suggested for utilization as a new catalyst support of polymer electrolyte fuel cells (PEFCs). The independent control of the diameter and number density of VA-CNTs is essential for application in PEFCs. As the catalyst for VA-CNT growth, we fabricated CoFe2O4 nanoparticle (NP) films using the Langmuir-Blodgett (LB) technique. Using the LB technique, we were able to separately control the diameter and number density of VA-CNTs. The number density of VA-CNTs was changed by mixing with the filler moleculer, palmitic acid (C16). The VA-CNT diameter was changed by the adjusting the CoFe2O4 NP diameter. However, the heat-induced aggregation of CoFe2O4 NPs occurred in thermal chemical vapor deposition to synthesize VA-CNTs. Therefore, we examined how to minimize the effect of heat-induced aggregation of CoFe2O4 NPs. As a result, selection of the appropriate number density and diameter of CoFe2O4 NPs was found to be important for the control of VA-CNT diameter.

[Anti-tumor effects of DDP-PLLA-CNTs on human cholangiocarcinoma cell line in vitro].

Science.gov (United States)

Li, Maolan; Lu, Wei; Zhang, Fei; Ding, Qichen; Wu, Xiangsong; Tan, Zhujun; Wu, Wenguang; Weng, Hao; Wang, Xuefeng; Shi, Weibin; Dong, Ping; Gu, Jun; Liu, Yingbin

2014-11-04

To explore the antitumor effects of DDP-PLLA-CNTs on human cholangiocarcinoma cell line. DDP-PLLA-CNTs were prepared with the method of ultrasound emulsification. The morphology of DDP-PLLA-CNTs was determined by scanning electron microscope (SEM). And its drug loading and drug release curve in vitro was detected by UV-Vis-NIR spectrophotometer. CCK8 was used to test the cytotoxic effects of DDP-PLLA-CNTs at different concentrations on QBC939 cell proliferation.Flow cytometry was employed to measure the changes of apoptotic rate. With excellent controlled-release characteristic of in vitro drug release, DDP-PLLA-CNTs inhibited the proliferation and significantly increased the apoptotic rate of QBC939 cell line. DDP-PLLA-CNTs have drug sustained-release characteristics and can significantly inhibit the proliferation of QBC939 cell line.

Fabrication and Water Treatment Application of Carbon Nanotubes (CNTs)-Based Composite Membranes: A Review.

Science.gov (United States)

Ma, Lining; Dong, Xinfa; Chen, Mingliang; Zhu, Li; Wang, Chaoxian; Yang, Fenglin; Dong, Yingchao

2017-03-18

Membrane separation technology is widely explored for various applications, such as water desalination and wastewater treatment, which can alleviate the global issue of fresh water scarcity. Specifically, carbon nanotubes (CNTs)-based composite membranes are increasingly of interest due to the combined merits of CNTs and membrane separation, offering enhanced membrane properties. This article first briefly discusses fabrication and growth mechanisms, characterization and functionalization techniques of CNTs, and then reviews the fabrication methods for CNTs-based composite membranes in detail. The applications of CNTs-based composite membranes in water treatment are comprehensively reviewed, including seawater or brine desalination, oil-water separation, removal of heavy metal ions and emerging pollutants as well as membrane separation coupled with assistant techniques. Furthermore, the future direction and perspective for CNTs-based composite membranes are also briefly outlined.

Fabrication and Water Treatment Application of Carbon Nanotubes (CNTs-Based Composite Membranes: A Review

Directory of Open Access Journals (Sweden)

Lining Ma

2017-03-01

Full Text Available Membrane separation technology is widely explored for various applications, such as water desalination and wastewater treatment, which can alleviate the global issue of fresh water scarcity. Specifically, carbon nanotubes (CNTs-based composite membranes are increasingly of interest due to the combined merits of CNTs and membrane separation, offering enhanced membrane properties. This article first briefly discusses fabrication and growth mechanisms, characterization and functionalization techniques of CNTs, and then reviews the fabrication methods for CNTs-based composite membranes in detail. The applications of CNTs-based composite membranes in water treatment are comprehensively reviewed, including seawater or brine desalination, oil-water separation, removal of heavy metal ions and emerging pollutants as well as membrane separation coupled with assistant techniques. Furthermore, the future direction and perspective for CNTs-based composite membranes are also briefly outlined.

Simultaneous alignment and Lorentz angle calibration in the CMS silicon tracker using Millepede II

CERN Document Server

Bartosik, Nazar

2013-01-01

The CMS silicon tracker consists of 25 684 sensors that provide measurements of trajectories of charged particles that are used by almost every physics analysis at CMS. In order to achieve high measurement precision, the positions and orientations of all sensors have to be determined very accurately. This is achieved by track-based alignment using the global fit approach of the Millepede II program. This approach is capable of determining about 200 000 parameters simultaneously.The alignment precision reached such a high level that even small calibration inaccuracies are noticeable. Therefore the alignment framework has been extended to treat position sensitive calibration parameters. Of special interest is the Lorentz angle which affects the hit positions due to the drift of the signal electrons in the magnetic field. We present the results from measurements of the Lorentz angle and its time dependence during full 2012 data taking period as well as general description of the alignment and calibration procedu...

Bromate Removal from Water Using Doped Iron Nanoparticles on Multiwalled Carbon Nanotubes (CNTS

Directory of Open Access Journals (Sweden)

Aasem Zeino

2014-01-01

Full Text Available The raw carbon nanotubes (CNTs were prepared by the floating catalyst chemical vapor deposition method. The raw carbon nanotubes were functionalized, impregnated with iron nanoparticles, and characterized using high resolution transmission electron microscopy (HRTEM, scanning electron microscopy with energy dispersive spectroscopy (SEM-EDS, Fourier transform infrared spectroscopy (FTIR, Differential Scanning Calorimetry (DSC, and thermogravimetric analysis (TGA. The three types of these multiwalled carbon nanotubes were applied as adsorbents for the removal of bromate from drinking water. The effects of the pH, the concentration of BrO3- anion, the adsorbent dose, the contact time, and the coanions on the adsorption process have been investigated. The results concluded that the highest adsorption capacities were 0.3460 and 0.3220 mg/g through using CNTs-Fe and raw CNTs, respectively, at the same conditions. The results showed that the CNTs-Fe gives higher adsorption capacity compared with the raw CNTs and the functionalized CNTs. The presence of nitrate (NO3- in the solution decreases the adsorption capacity of all CNTs compared with chloride (Cl- associated with pH adjustment caused by nitric acid or hydrochloric acid, respectively. However, the adsorption of all MWNCTs types increases as the pH of solution decreases.

Reactivity of silicon and germanium doped CNTs toward aromatic sulfur compounds: A theoretical approach

International Nuclear Information System (INIS)

Galano, Annia; Francisco-Marquez, Misaela

2008-01-01

Adsorption processes of thiophene and benzothiophene on pristine carbon nanotubes (CNTs), and on CNTs doped with Si or Ge, have been modeled with Density Functional. This is the first study on the chemical reactivity of such doped tubes. The calculated data suggest that the presence of silicon or germanium atoms in CNTs increases their reactivity toward thiophene, and benzothiophene. The adsorption of these species on pristine CNTs seems very unlikely to occur, while the addition products involving doped CNTs were found to be very stable, with respect to the isolated reactants, in terms of Gibbs free energy. Several of these adsorption processes were found to be significantly exergonic (ΔG < 0) in non-polar liquid phase. The results reported in this work suggest that Si and Ge defects on CNTs increase their reactivity toward unsaturated species, and could make them useful in the removal processes of aromatic sulfur compounds from oil-hydrocarbons. However, according to our results, CNTs doped with Si atoms are expected to be more efficient as aromatic sulfur compounds scavengers than those doped with Ge. These results also suggest that the presence of silicon and germanium atoms in the CNTs structures enhances their reactivity toward nucleophilic molecules, compared to pristine carbon nanotubes

Interface structure and properties of CNTs/Cu composites fabricated by electroless deposition and spark plasma sintering

Science.gov (United States)

Wang, Hu; Zhang, Zhao-Hui; Hu, Zheng-Yang; Song, Qi; Yin, Shi-Pan

2018-01-01

In this paper, we fabricated a novel copper matrix composites reinforced by carbon nanotubes (CNTs) using electroless deposition (ED) and spark plasma sintering technique. Microstructure, mechanical, electric conductivity, and thermal properties of the CNTs/Cu composites were investigated. The results show that a favorable interface containing C-O and O-Cu bond was formed between CNTs and matrix when the CNTs were coated with nano-Cu by ED method. Thus, we accomplished the uniformly dispersed CNTs in the CNTs/Cu powders and compacted composites, which eventually leads to the enhancement of the mechanical properties of the CNTs/Cu composites in the macro-scale environment. However, the interface structure can hinder the movement of carriers and free electrons and increase the interface thermal resistance, which leads to modest decrease of electrical and thermal conductivity of the CNTs/Cu composites.

Compositos CNTs/bioceramico para a estimulacao eletrica ossea in situ

Science.gov (United States)

Mata, Diogo Miguel Rodrigues Marinho da

The present thesis aims to develop a biocompatible and electroconductor bone graft containing carbon nanotubes (CNTs) that allows the in situ regeneration of bone cells by applying pulsed external electrical stimuli. The CNTs were produced by chemical vapor deposition (CVD) by a semi-continuous method with a yield of 500 mg/day. The deposition parameters were optimised to obtain high pure CNTs 99.96% with controlled morphologies, fundamental requisites for the biomedical application under study. The chemical functionalisation of CNTs was also optimised to maximise their processability and biocompatibility. The CNTs were functionalised by the Diels-Alder cycloaddition of 1,3-butadiene. The biological behaviour of the functionalised CNTs was evaluated in vitro with the osteoblastic cells line MG63 and in vivo, by subcutaneous implantation in rats. The materials did not induce an expressed inflammatory response, but the functionalised CNTs showed a superior in vitro and in vivo biocompatibility than the non-functionalised ones. Composites of ceramic matrix, of bioglass (Glass) and hydroxyapatite (HA), reinforced with carbon nanotubes (CNT/Glass/HA) were processed by a wet approach. The incorporation of just 4.4 vol% of CNTs allowed the increase of 10 orders of magnitude of the electrical conductivity of the matrix. In vitro studies with MG63 cells show that the CNT/Glass/HA composites guarantee the adhesion and proliferation of bone cells, and stimulate their phenotype expression, namely the alkaline phosphate (ALP). The interactions between the composite materials and the culture medium (α-MEM), under an applied electrical external field, were studied by scanning vibrating electrode technique. An increase of the culture medium electrical conductivity and the electrical field confinement in the presence of the conductive samples submerged in the medium was demonstrated. The in vitro electrical stimulation of MG63 cells on the conductive composites promotes the

Porosimetry and packing morphology of vertically-aligned carbon nanotube arrays via impedance spectroscopy.

Science.gov (United States)

Mutha, Heena K; Lu, Yuan; Stein, Itai; Cho, H Jeremy; Suss, Matthew; Laoui, Tahar; Thompson, Carl; Wardle, Brian; Wang, Evelyn

2016-12-13

Vertically aligned one-dimensional nanostructure arrays are promising in many applications such as electrochemical systems, solar cells, and electronics, taking advantage of high surface area per unit volume, nanometer length scale packing, and alignment leading to high conductivity. However, many devices need to optimize arrays for device performance by selecting an appropriate morphology. Developing a simple, non-invasive tool for understanding the role of pore volume distribution and interspacing would aid in the optimization of nanostructure morphologies in electrodes. In this work, we combined electrochemical impedance spectroscopy (EIS) with capacitance measurements and porous electrode theory to conduct in situ porosimetry of vertically-aligned carbon nanotubes (VA-CNTs) non-destructively. We utilized the EIS measurements with a pore size distribution model to quantify the average and dispersion of inter-CNT spacing (Γ), stochastically, in carpets that were mechanically densified from 1.7 × 1010 tubes/cm2 to 4.5 × 1011 tubes/cm2. Our analysis predicts that the inter-CNT spacing ranges from over 100 ± 50 nm in sparse carpets to sub 10 ± 5 nm in packed carpets. Our results suggest that waviness of CNTs leads to variations in the inter-CNT spacing, which can be significant in sparse carpets. This methodology can be used to predict the performance of many nanostructured devices, including supercapacitors, batteries, solar cells, and semiconductor electronics. Copyright 2016 IOP Publishing Ltd.

CNTs/Al5083 Composites of High-performance Uniform and Dispersion Fabricated by High-energy Ball-milling

Directory of Open Access Journals (Sweden)

GUO Li

2017-11-01

Full Text Available Carbon nanotubes (CNTs, mass fraction of 0%-2% reinforced Al5083 composites were fabricated by horizontal high-energy ball milling. The effects of ball milling time and CNTs contents on the properties of composite materials were studied. The micro morphology of CNTs/Al5083 composites was characterized by scanning electron microscopy(SEM and transmission electron microscopy(TEM, the tensile strength and microhardness of the composites were tested. The results indicate that after high-energy ball milling for 1.5h, the carbon nanotubes are dispersed homogeneously in the Al5083 matrix, and good interfacial bonding strength between CNTs and Al5083 is obtained at the addition of 1.5%CNTs. Under these conditions, the tensile strength and microhardness of CNTs/Al5083 composites are 188.8MPa and 136HV, respectively. Compared to Al5083 matrix without CNTs reinforcement, tensile strength and microhardness of CNTs/Al5083 composites are increased by 32.2% and 36%, respectively.

Effect of Reaction Temperature on Carbon Yield and Morphology of CNTs on Copper Loaded Nickel Nanoparticles

Directory of Open Access Journals (Sweden)

Hu Ming

2016-01-01

Full Text Available This investigation was attempted to introduce carbon nanotubes (CNTs onto surface of copper powders in order to improve heat transfer performance of copper matrix for engineering application of electrical packaging materials. The Ni/MgO catalyst was formed on the copper powders surface by means of codeposition method. CVD technique was executed to fabricate uniform CNTs on copper powders and effect of reaction temperature on the morphology of CNTs was surveyed. The results showed that CNTs products on the copper powder surface were distributed uniformly even if reaction temperature was different. The diameter dimension of CNTs was within the scope of 30~60 nm. Growth behaviors of CNTs by CVD method were considered to be “tip-growth” mechanism. Raman spectra of CNTs proved that intensity ratio of D-band to G-band (ID/IG increased as deposition reaction temperature increased, which implied that order degree of graphitic structure in synthesized CNTs improved.

CNTs threaded (001) exposed TiO2 with high activity in photocatalytic NO oxidation.

Science.gov (United States)

Xiao, Shuning; Zhu, Wei; Liu, Peijue; Liu, Fanfan; Dai, Wenrui; Zhang, Dieqing; Chen, Wei; Li, Hexing

2016-02-07

A microwave-ionothermal strategy was developed for in situ synthesis of CNTs threaded TiO2 single crystal with a tunable percentage of surface exposed (001) active facets. The CNTs were used as microwave antennas to create local "super hot" dots to induce Ti(3+) adsorption and hydrolysis, thereby leading to a good assembly of (001) facets exposed single crystalline TiO2 threaded by the CNTs in the presence of Hmim[BF4] ionic liquid. Due to the high percentage of the active (001) facets of single crystal TiO2 and the direct electron transfer property of the CNTs, the as-prepared CNTs-TiO2 composite showed a photocatalytic NO removal ratio of up to 76.8% under UV irradiation. In addition, with self-doped Ti(3+), the CNTs-TiO2 composite also exhibited an enhanced activity under irradiation with either solar lights or visible lights, showing good potential in practical applications for environmental remediation.

High-performance Supercapacitors Based on Electrochemical-induced Vertical-aligned Carbon Nanotubes and Polyaniline Nanocomposite Electrodes

Science.gov (United States)

Wu, Guan; Tan, Pengfeng; Wang, Dongxing; Li, Zhe; Peng, Lu; Hu, Ying; Wang, Caifeng; Zhu, Wei; Chen, Su; Chen, Wei

2017-03-01

Supercapacitors, which store electrical energy through reversible ion on the surface of conductive electrodes have gained enormous attention for variously portable energy storage devices. Since the capacitive performance is mainly determined by the structural and electrochemical properties of electrodes, the electrodes become more crucial to higher performance. However, due to the disordered microstructure and low electrochemical activity of electrode for ion tortuous migration and accumulation, the supercapacitors present relatively low capacitance and energy density. Here we report a high-performance supercapacitor based on polyaniline/vertical-aligned carbon nanotubes (PANI/VA-CNTs) nanocomposite electrodes where the vertical-aligned-structure is formed by the electrochemical-induction (0.75 V). The supercapacitor displays large specific capacitance of 403.3 F g-1, which is 6 times higher than disordered CNTs in HClO4 electrolyte. Additionally, the supercapacitor can also present high specific capacitance (314.6 F g-1), excellent cycling stability (90.2% retention after 3000 cycles at 4 A g-1) and high energy density (98.1 Wh kg-1) in EMIBF4 organic electrolyte. The key to high-performance lies in the vertical-aligned-structure providing direct path channel for ion faster diffusion and high electrochemical capacitance of polyaniline for ion more accommodation.

High-performance Supercapacitors Based on Electrochemical-induced Vertical-aligned Carbon Nanotubes and Polyaniline Nanocomposite Electrodes.

Science.gov (United States)

Wu, Guan; Tan, Pengfeng; Wang, Dongxing; Li, Zhe; Peng, Lu; Hu, Ying; Wang, Caifeng; Zhu, Wei; Chen, Su; Chen, Wei

2017-03-08

Supercapacitors, which store electrical energy through reversible ion on the surface of conductive electrodes have gained enormous attention for variously portable energy storage devices. Since the capacitive performance is mainly determined by the structural and electrochemical properties of electrodes, the electrodes become more crucial to higher performance. However, due to the disordered microstructure and low electrochemical activity of electrode for ion tortuous migration and accumulation, the supercapacitors present relatively low capacitance and energy density. Here we report a high-performance supercapacitor based on polyaniline/vertical-aligned carbon nanotubes (PANI/VA-CNTs) nanocomposite electrodes where the vertical-aligned-structure is formed by the electrochemical-induction (0.75 V). The supercapacitor displays large specific capacitance of 403.3 F g -1 , which is 6 times higher than disordered CNTs in HClO 4 electrolyte. Additionally, the supercapacitor can also present high specific capacitance (314.6 F g -1 ), excellent cycling stability (90.2% retention after 3000 cycles at 4 A g -1 ) and high energy density (98.1 Wh kg -1 ) in EMIBF 4 organic electrolyte. The key to high-performance lies in the vertical-aligned-structure providing direct path channel for ion faster diffusion and high electrochemical capacitance of polyaniline for ion more accommodation.

Microwave-Hydrothermal Synthesis of SnO2-CNTs Hybrid Nanocomposites with Visible Light Photocatalytic Activity.

Science.gov (United States)

Wu, Shuisheng; Dai, Weili

2017-03-03

SnO2 nanoparticles coated on carbon nanotubes (CNTs) were prepared via a simple microwave-hydrothermal route. The as-obtained SnO2-CNTs composites were characterized using X-ray powder diffraction, Raman spectroscopy, and transmission electron microscopy. The photocatalytic activity of as-prepared SnO2-CNTs for degradation of Rhodamine B under visible light irradiation was investigated. The results show that SnO2-CNTs nanocomposites have a higher photocatalytic activity than pure SnO2 due to the rapid transferring of electrons and the effective separation of holes and electrons on SnO2-CNTs.

Aligned Carbon Nanotubes Array by DC Glow Plasma Etching for Supercapacitor

Directory of Open Access Journals (Sweden)

Yongfeng Luo

2013-01-01

Full Text Available To open the end of carbon nanotubes and make these ends connect with functional carboxyl group, aligned carbon nanotubes (CNTs arrays was etched by DC glow oxygen-argon plasma. With these open-ended carbon nanotubes array as electrode materials to build supercapacitor, we found that the capacity (32.2 F/g increased significantly than that of pure carbon nanotubes (6.7 F/g.

Vertically aligned BCN nanotubes with high capacitance.

Science.gov (United States)

Iyyamperumal, Eswaramoorthi; Wang, Shuangyin; Dai, Liming

2012-06-26

Using a chemical vapor deposition method, we have synthesized vertically aligned BCN nanotubes (VA-BCNs) on a Ni-Fe-coated SiO(2)/Si substrate from a melamine diborate precursor. The effects of pyrolysis conditions on the morphology and thermal property of grown nanotubes, as well as the nanostructure and composition of an individual BCN nanotube, were systematically studied. It was found that nitrogen atoms are bonded to carbons in both graphitic and pyridinic forms and that the resultant VA-BCNs grown at 1000 °C show the highest specific capacitance (321.0 F/g) with an excellent rate capability and high durability with respect to nonaligned BCN (167.3 F/g) and undoped multiwalled carbon nanotubes (117.3 F/g) due to synergetic effects arising from the combined co-doping of B and N in CNTs and the well-aligned nanotube structure.

In-situ synthesis of hydrogen peroxide in a novel Zn-CNTs-O2 system

Science.gov (United States)

Gong, Xiao-bo; Yang, Zhao; Peng, Lin; Zhou, An-lan; Liu, Yan-lan; Liu, Yong

2018-02-01

A novel strategy of in-situ synthesis of hydrogen peroxide (H2O2) was formulated and evaluated. Oxygen was selectively reduced to H2O2 combined with electrochemical corrosion of zinc in the Zn-CNTs-O2 system. The ratio of zinc and CNTs, heat treatment temperature, and operational parameters such as composite dosage, initial pH, solution temperature, oxygen flow rate were systematically investigated to improve the efficiency of H2O2 generation. The Zn-CNTs composite (weight ratio of 2.5:1) prepared at 500 °C showed the maximum H2O2 accumulation concentration of 293.51 mg L-1 within 60 min at the initial pH value of 3.0, Zn-CNTs dosage of 0.4 g and oxygen flow rate of 400 mL min-1. The oxygen was reduced through two-electron pathway to hydrogen peroxide on CNTs while the zinc was oxidized in the system and the dissolved zinc ions convert to zinc hydroxide and depositing on the surface of CNTs. It was proposed that the increment of direct H2O2 production was caused by the improvement of the formed Zn/CNTs corrosion cell. This provides promising strategy for in-situ synthesis and utilization of hydrogen peroxide in the novel Zn-CNTs-O2 system, which enhances the environmental and economic attractiveness of the use of H2O2 as green oxidant for wastewater treatments.

Influence of metal nanoparticle decorated CNTs on polyurethane based electro active shape memory nanocomposite actuators

International Nuclear Information System (INIS)

Raja, Mohan; Shanmugharaj, A.M.; Ryu, Sung Hun; Subha, J.

2011-01-01

Highlights: → Polyurethane based on pristine and metal (Ag and Cu) nanoparticle decorated CNTs nanocomposites are prepared through melt blending process. → The electrical, mechanical, dynamic mechanical, thermal conductivity and electro active shape memory properties of the PU nanocomposites were investigated. → The influence of metal nanoparticle decorated CNTs showed significant improvement in their all properties to compare to pristine CNTs. → Electro active shape memory studies of the PU/M-CNTs nanocomposites reveal extraordinary recoverability of its shape at lower applied dc voltages. - Abstract: Polymer nanocomposites based on thermoplastic polyurethane (PU) elastomer and metal nanoparticle (Ag and Cu) decorated multiwall carbon nanotubes (M-CNTs) were prepared through melt mixing process and investigated for its mechanical, dynamic mechanical and electro active shape memory properties. Structural characterization and morphological characterization of the PU nanocomposites were done using X-ray diffraction (XRD) and scanning electron microscopy (SEM). Morphological characterization revealed better dispersion of M-CNTs in the polyurethane, which is attributed to the improved interaction between the M-CNTs and polyurethane. Loading of the metal nanoparticle coated carbon nanotubes resulted in the significant improvement on the mechanical properties such as tensile strength of the PU composites in comparison to the pristine carbon nanotubes (P-CNTs). Dynamic mechanical analysis showed that the glass transition temperature (Tg) of the polyurethane increases slightly with increasing loading of both pristine and metal nanoparticle functionalized carbon nanotubes. The metal nanoparticles decorated carbon nanotubes also showed significant improvement in the thermal and electrical conductivity of the PU/M-CNTs nanocomposites. Shape memory studies of the PU/M-CNTs nanocomposites exhibit remarkable recoverability of its shape at lower applied dc voltages.

[Anti-tumor effect of 5-FU-PLLA-CNTs on human gastric carcinoma cell lines in vitro].

Science.gov (United States)

Gu, Jun; Li, Maolan; Wu, Xiangsong; Wu, Wenguang; Zhang, Lin; Ding, Qichen; Yang, Jiahua; Weng, Hao; Ding, Qian; Bao, Runfa; Shu, Yijun; Liu, Yingbin

2014-04-01

To prepare cisPLLAtin-loaded polylactic acid/cnts, and to study the anti-tumor effect of 5-FU-PLLA-CNTs on human gastric carcinoma cell lines(MGC803 and MNK45). 5-FU-PLLA-CNTs were prepared with ultrasound emulsification. The morphology of 5-FU-PLLA-CNTs was determined by scanning electron microscope(SEM), and its drug loading and drug release curve in vitro were detected by UV-Vis-NIR spectrophotometer. Cells were divided into experiment, positive control and negative control groups. CCK8 method was used to test the cytotoxic effect of 5-FU-PLLA-CNTs in different concentrations on MGC803 and MNK45 cell proliferation. Flow cytometry was employed to measure the apoptotic rate of MGC803 and MNK45 cells before and after the intervention of 5-FU-PLLA-CNTs. Deep layer film of 5-FU-PLLA-CNTs was successfully established, whose drug-load rate was(4.54±0.43)%, entrapment rate was(21.56±2.36)%. In vitro release test showed release rate within 24 h of 5-FU-PLLA-CNTs was 23.9% in a as lowly increasing manner, and accumulating release rate was 85.3% at day 31. CCk8 experiment revealed, as compared to control group, 5-FU-PLLA-CNTs significantly inhibited the proliferation of two cell lines in dose-dependent and time-dependent manner. The best 5-FU-PLLA-CNTs concentration of inhibition for human gastric cancer cell lines was 1 mg/well. Flow cytometry indicated the apoptotic rate of MGC803 and MNK45 cells in experiment group treated by 1 mg/well 5-FU-PLLA-CNTs significantly increased as compared to negative control group (P0.05). The 5-FU-PLLA-CNTs has good drug sustained-release capacity, and can significantly kill and inhibit the proliferation of MGC803 and MNK45 cell lines.

ROS evaluation for a series of CNTs and their derivatives using an ESR method with DMPO

International Nuclear Information System (INIS)

Tsuruoka, S; Noguchi, T; Endo, M; Tristan, F; Terrones, M; Takeuchi, K; Koyama, K; Usui, Y; Matsumoto, H; Saito, N; Porter, D W; Castranova, V

2013-01-01

Carbon nanotubes (CNTs) are important materials in advanced industries. It is a concern that pulmonary exposure to CNTs may induce carcinogenic responses. It has been recently reported that CNTs scavenge ROS though non-carbon fibers generate ROS. A comprehensive evaluation of ROS scavenging using various kinds of CNTs has not been demonstrated well. The present work specifically investigates ROS scavenging capabilities with a series of CNTs and their derivatives that were physically treated, and with the number of commercially available CNTs. CNT concentrations were controlled at 0.2 through 0.6 wt%. The ROS scavenging rate was measured by ESR with DMPO. Interestingly, the ROS scavenging rate was not only influenced by physical treatments, but was also dependent on individual manufacturing methods. Ratio of CNTs to DMPO/ hydrogen peroxide is a key parameter to obtain appropriate ROS quenching results for comparison of CNTs. The present results suggest that dangling bonds are not a sole factor for scavenging, and electron transfer on the CNT surface is not clearly determined to be the sole mechanism to explain ROS scavenging.

ROS evaluation for a series of CNTs and their derivatives using an ESR method with DMPO.

Science.gov (United States)

Tsuruoka, S; Takeuchi, K; Koyama, K; Noguchi, T; Endo, M; Tristan, F; Terrones, M; Matsumoto, H; Saito, N; Usui, Y; Porter, D W; Castranova, V

Carbon nanotubes (CNTs) are important materials in advanced industries. It is a concern that pulmonary exposure to CNTs may induce carcinogenic responses. It has been recently reported that CNTs scavenge ROS though non-carbon fibers generate ROS. A comprehensive evaluation of ROS scavenging using various kinds of CNTs has not been demonstrated well. The present work specifically investigates ROS scavenging capabilities with a series of CNTs and their derivatives that were physically treated, and with the number of commercially available CNTs. CNT concentrations were controlled at 0.2 through 0.6 wt%. The ROS scavenging rate was measured by ESR with DMPO. Interestingly, the ROS scavenging rate was not only influenced by physical treatments, but was also dependent on individual manufacturing methods. Ratio of CNTs to DMPO/ hydrogen peroxide is a key parameter to obtain appropriate ROS quenching results for comparison of CNTs. The present results suggest that dangling bonds are not a sole factor for scavenging, and electron transfer on the CNT surface is not clearly determined to be the sole mechanism to explain ROS scavenging.

The in situ growth of 3D net-like CNTs on C fiber

Energy Technology Data Exchange (ETDEWEB)

Ma, Junfeng, E-mail: majunfeng01@sina.cn; Lan, Xuena; Niu, Bingbing; Fan, Dongxiao

2017-05-01

Carbon nanotubes (CNTs) with 3 dimensional net-like structure were perfectly grown on C fiber at ambient temperature and pressure using a modified electrochemical process, and their composition and morphology were characterized by Raman spectroscopy, Energy dispersive spectroscopy (EDS), High resolution transmission electron microscopy (HRTEM), and Scanning electron microscopy (SEM), respectively. This paper also reported the influence of applied voltage and reaction time on the formation and growth of CNTs, and proposed a possible growth mechanism. - Highlights: • CNTs with 3D net-like structure were grown on C fiber by an “electrochemical” route. • The formation and growth of CNTs relied on applied voltage and reaction time. • A possible growth mechanism was proposed.

Experimental Preparation and Numerical Simulation of High Thermal Conductive Cu/CNTs Nanocomposites

Directory of Open Access Journals (Sweden)

Muhsan Ali Samer

2014-07-01

Full Text Available Due to the rapid growth of high performance electronics devices accompanied by overheating problem, heat dissipater nanocomposites material having ultra-high thermal conductivity and low coefficient of thermal expansion was proposed. In this work, a nanocomposite material made of copper (Cu reinforced by multi-walled carbon nanotubes (CNTs up to 10 vol. % was prepared and their thermal behaviour was measured experimentally and evaluated using numerical simulation. In order to numerically predict the thermal behaviour of Cu/CNTs composites, three different prediction methods were performed. The results showed that rules of mixture method records the highest thermal conductivity for all predicted composites. In contrast, the prediction model which takes into account the influence of the interface thermal resistance between CNTs and copper particles, has shown the lowest thermal conductivity which considered as the closest results to the experimental measurement. The experimentally measured thermal conductivities showed remarkable increase after adding 5 vol.% CNTs and higher than the thermal conductivities predicted via Nan models, indicating that the improved fabrication technique of powder injection molding that has been used to produced Cu/CNTs nanocomposites has overcome the challenges assumed in the mathematical models.

Improvement of Mechanical and Dielectric Properties of Epoxy Resin Using CNTs/ZnO Nanocomposite.

Science.gov (United States)

Vu, Pham Gia; Truc, Trinh Anh; Chinh, Nguyen Thuy; Tham, Do Quang; Trung, Tran Huu; Oanh, Vu Ke; Hang, To Thi Xuan; Olivier, Marjorie; Hoang, Thai

2018-04-01

In this study, carbon nanotubes (CNTs)/ZnO composites had been prepared using the sol-gel method and then incorporated into an epoxy resin for reinforcement of mechanical and electrical properties. Fourier Transform Infrared (FTIR), X-ray diffraction (XRD) Field Emission Scanning Electron Microscope (FE-SEM) analyses show that the ZnO nanoparticles deposited on CNTs were crystallized in a hexagonal wurtzite structure. Average particle size of ZnO deposited on the CNT was about 8 nm. The mechanical and dielectric properties of epoxy containing CNTs/ZnO were investigated in comparison to epoxy resin and epoxy resin containing only CNT or ZnO nanoparticles. The results indicated that tensile strength and elongation at break of the nanocomposite were substantially improved with the presence of CNTs/ZnO at the equal volume. The DSC analysis associate with the dielectric results shows that the behavior of epoxy/CNTs/ZnO is identical to epoxy/ZnO composite, and the CNTs is essential to the distributed arrangement of ZnO in the epoxy resin.

Wet catalyst-support films for production of vertically aligned carbon nanotubes.

Science.gov (United States)

Alvarez, Noe T; Hamilton, Christopher E; Pint, Cary L; Orbaek, Alvin; Yao, Jun; Frosinini, Aldo L; Barron, Andrew R; Tour, James M; Hauge, Robert H

2010-07-01

A procedure for vertically aligned carbon nanotube (VA-CNT) production has been developed through liquid-phase deposition of alumoxanes (aluminum oxide hydroxides, boehmite) as a catalyst support. Through a simple spin-coating of alumoxane nanoparticles, uniform centimer-square thin film surfaces were coated and used as supports for subsequent deposition of metal catalyst. Uniform VA-CNTs are observed to grow from this film following deposition of both conventional evaporated Fe catalyst, as well as premade Fe nanoparticles drop-dried from the liquid phase. The quality and uniformity of the VA-CNTs are comparable to growth from conventional evaporated layers of Al(2)O(3). The combined use of alumoxane and Fe nanoparticles to coat surfaces represents an inexpensive and scalable approach to large-scale VA-CNT production that makes chemical vapor deposition significantly more competitive when compared to other CNT production techniques.

Aligned carbon nanotube array functionalization for enhanced atomic layer deposition of platinum electrocatalysts

Energy Technology Data Exchange (ETDEWEB)

Dameron, Arrelaine A., E-mail: arrelaine.dameron@nrel.gov [National Renewable Energy Laboratory, 1617 Cole Blvd Golden, Golden, CO 80401 (United States); Pylypenko, Svitlana; Bult, Justin B.; Neyerlin, K.C.; Engtrakul, Chaiwat; Bochert, Christopher; Leong, G. Jeremy; Frisco, Sarah L.; Simpson, Lin; Dinh, Huyen N.; Pivovar, Bryan [National Renewable Energy Laboratory, 1617 Cole Blvd Golden, Golden, CO 80401 (United States)

2012-04-15

Uniform metal deposition onto high surface area supports is a key challenge of developing successful efficient catalyst materials. Atomic layer deposition (ALD) circumvents permeation difficulties, but relies on gas-surface reactions to initiate growth. Our work demonstrates that modified surfaces within vertically aligned carbon nanotube (CNT) arrays, from plasma and molecular precursor treatments, can lead to improved catalyst deposition. Gas phase functionalization influences the number of ALD nucleation sites and the onset of ALD growth and, in turn, affects the uniformity of the coating along the length of the CNTs within the aligned arrays. The induced chemical changes for each functionalization route are identified by X-ray photoelectron and Raman spectroscopies. The most effective functionalization routes increase the prevalence of oxygen moieties at defect sites on the carbon surfaces. The striking effects of the functionalization are demonstrated with ALD Pt growth as a function of surface treatment and ALD cycles examined by electron microscopy of the arrays and the individual CNTs. Finally, we demonstrate applicability of these materials as fuel cell electrocatalysts and show that surface functionalization affects their performance towards oxygen reduction reaction.

LHCb's Time-Real Alignment in RunII

CERN Multimedia

Batozskaya, Varvara

2015-01-01

LHCb has introduced a novel real-time detector alignment and calibration strategy for LHC Run 2. Data collected at the start of the fill will be processed in a few minutes and used to update the alignment, while the calibration constants will be evaluated for each run. This procedure will improve the quality of the online alignment. Critically, this new real-time alignment and calibration procedure allows identical constants to be used in the online and offline reconstruction, thus improving the correlation between triggered and offline selected events. This offers the opportunity to optimise the event selection in the trigger by applying stronger constraints. The required computing time constraints are met thanks to a new dedicated framework using the multi-core farm infrastructure for the trigger. The motivation for a real-time alignment and calibration of the LHCb detector is discussed from both the operational and physics performance points of view. Specific challenges of this novel configur...

Alignment of the NPL Mark II watt balance

International Nuclear Information System (INIS)

Robinson, I A

2012-01-01

To reach uncertainties in the region of 1 part in 10 8 a moving-coil watt balance not only requires the accurate measurement of voltage, resistance, velocity, mass and the acceleration due to gravity but, in addition, requires the apparatus to be adjusted correctly to minimize the second order effects which can reduce the accuracy of the measurement. This paper collects together the alignment and correction techniques that have been developed at NPL over many years and are required to minimize the uncertainty of the measurement. Some of these techniques are applicable to all watt balances, whilst a few are specific to watt balances that employ a conventional beam balance to support a circular coil in a radial magnetic field, such as the NPL Mark II watt balance, now known as the NRC watt balance. (paper)

Preparation of SnO{sub 2}-CNTs supported Pt catalysts and their electrocatalytic properties for ethanol oxidation

Energy Technology Data Exchange (ETDEWEB)

Pang, H.L.; Lu, J.P. [State Key Laboratory of Chemo/Biosensing and Chemometrics, College of Chemistry and Chemical Engineering, Hunan University, Changsha 410082 (China); Chen, J.H. [State Key Laboratory of Chemo/Biosensing and Chemometrics, College of Chemistry and Chemical Engineering, Hunan University, Changsha 410082 (China)], E-mail: chenjinhua@hnu.cn; Huang, C.T.; Liu, B.; Zhang, X.H. [State Key Laboratory of Chemo/Biosensing and Chemometrics, College of Chemistry and Chemical Engineering, Hunan University, Changsha 410082 (China)

2009-03-30

SnO{sub 2}-carbon nanotubes (CNTs) composites were prepared by sol-gel method, and characterized by scanning electron microscopy and X-ray diffraction. Due to high stability in diluted acidic solution, SnO{sub 2}-CNTs composites were selected as the catalyst support and second catalyst for ethanol electrooxidation. The electrocatalytic properties of the SnO{sub 2}-CNTs supported platinum (Pt) catalyst (Pt/SnO{sub 2}-CNTs) for ethanol oxidation have been investigated by typical electrochemical methods. Under the same mass loading of Pt, the Pt/SnO{sub 2}-CNTs catalyst shows higher electrocatalytic activity and better long-term cycle stability than Pt/SnO{sub 2} catalyst. Additionally, the effect of the mass ratio of CNTs to SnO{sub 2} on the electrocatalytic activity of the electrode for ethanol oxidation was investigated, and the optimum mass ratio of CNTs to SnO{sub 2} in the Pt/SnO{sub 2}-CNTs catalyst is 1/6.3.

Emergent properties resulting from type-II band alignment in semiconductor nanoheterostructures.

Science.gov (United States)

Lo, Shun S; Mirkovic, Tihana; Chuang, Chi-Hung; Burda, Clemens; Scholes, Gregory D

2011-01-11

The development of elegant synthetic methodologies for the preparation of monocomponent nanocrystalline particles has opened many possibilities for the preparation of heterostructured semiconductor nanostructures. Each of the integrated nanodomains is characterized by its individual physical properties, surface chemistry, and morphology, yet, these multicomponent hybrid particles present ideal systems for the investigation of the synergetic properties that arise from the material combination in a non-additive fashion. Of particular interest are type-II heterostructures, where the relative band alignment of their constituent semiconductor materials promotes a spatial separation of the electron and hole following photoexcitation, a highly desirable property for photovoltaic applications. This article highlights recent progress in both synthetic strategies, which allow for material and architectural modulation of novel nanoheterostructures, as well as the experimental work that provides insight into the photophysical properties of type-II heterostructures. The effects of external factors, such as electric fields, temperature, and solvent are explored in conjunction with exciton and multiexciton dynamics and charge transfer processes typical for type-II semiconductor heterostructures.

A Metal Matrix CNTS Modified Electrode Fabricated Using Micromachining-Based Implantation Method for Improving Sensitivity and Stability

Directory of Open Access Journals (Sweden)

Yan Wang

2013-01-01

Full Text Available The metal matrix carbon nanotubes modified electrode (MCME has been fabricated by a novel process involving preparation of carbon nanotubes (CNTs/polyimide (PI composite film, wet, etching, sputtering, electroplating, and wet-etch releasing. Pretreated CNTs are dispersed in PI by mechanical ball milling and then CNTs solution is spin-coated on the substrate. The CNTs/PI composite film is etched away a layer of PI to expose tips of CNTs using buffering solution. These exposed tips of CNTs are covered by metal particles in sputtering process as metal seed layer, followed by metal supporting film formed by electroplating. The MCME is obtained after releasing PI film from the metal supporting film. The MCME shows well morphology of uniform distributional protruding tips of CNTs and increased electron transfer efficiency with strong bonding connection between CNTs and metal matrix, which greatly improves sensitivity and stability of the MCME. The oxidation peak of the MCME in cyclic voltammeter (CV test is 1.7 times more than that of CNTs suspension spin-coated metal electrode (SCME. The decline of peak current of the MCME after fifty cycles is only 1.8% much less than 67% of the SCME. Better sensitivity and stability may be helpful for CNTs modified electrodes wide application for trace test of many special materials.

Carbon nanotubes (CNTs) based advanced dermal therapeutics: current trends and future potential.

Science.gov (United States)

Kuche, Kaushik; Maheshwari, Rahul; Tambe, Vishakha; Mak, Kit-Kay; Jogi, Hardi; Raval, Nidhi; Pichika, Mallikarjuna Rao; Kumar Tekade, Rakesh

2018-05-17

The search for effective and non-invasive delivery modules to transport therapeutic molecules across skin has led to the discovery of a number of nanocarriers (viz.: liposomes, ethosomes, dendrimers, etc.) in the last few decades. However, available literature suggests that these delivery modules face several issues including poor stability, low encapsulation efficiency, and scale-up hurdles. Recently, carbon nanotubes (CNTs) emerged as a versatile tool to deliver therapeutics across skin. Superior stability, high loading capacity, well-developed synthesis protocol as well as ease of scale-up are some of the reason for growing interest in CNTs. CNTs have a unique physical architecture and a large surface area with unique surface chemistry that can be tailored for vivid biomedical applications. CNTs have been thus largely engaged in the development of transdermal systems such as tuneable hydrogels, programmable nonporous membranes, electroresponsive skin modalities, protein channel mimetic platforms, reverse iontophoresis, microneedles, and dermal buckypapers. In addition, CNTs were also employed in the development of RNA interference (RNAi) based therapeutics for correcting defective dermal genes. This review expounds the state-of-art synthesis methodologies, skin penetration mechanism, drug liberation profile, loading potential, characterization techniques, and transdermal applications along with a summary on patent/regulatory status and future scope of CNT based skin therapeutics.

High Electrocatalytic Performance of CuCoNi@CNTs Modified Glassy Carbon Electrode towards Methanol Oxidation in Alkaline Medium

Directory of Open Access Journals (Sweden)

Amina A. Hamza

2017-01-01

Full Text Available A novel non-precious multiwalled carbon nanotubes (CNTs—supported metal oxide electrocatalyst was developed for methanol electrooxidation in alkaline medium. The catalyst was fabricated by simultaneous electrodeposition of copper-cobalt-nickel ternary nanostructures (CuCoNi on a glassy carbon electrode (GCE modified with CNTs. The proposed electrode was characterized using X-ray diffraction (XRD, energy dispersive X-ray (EDX, and scanning electron microscopy (SEM. The electrochemical behavior and the electrocatalytic performance of the suggested electrode towards the oxidation of methanol were evaluated by cyclic voltammetry (CV, linear sweep voltammetry (LSV, and chronoamperometry (CA in alkaline medium. Several parameters were investigated, e.g., deposition time, potential scan rate, etc. Compared to Cu, Co, or Ni mono electrocatalysts, the electrode based on ternary-metals exhibited superior electrocatalytic activity and stability towards methanol electrooxidation. For instance, CuCoNi@CNTs/GCE has shown at least 2.5 times electrocatalytic activity and stability compared to the mono eletrocatalysts. Moreover, the present study found that the optimized loading level is 1500 s of simultaneous electrodeposition. At this loading level, it was found that the relation between the Ip/ν1/2 function and scan rate gives the characteristic features of a catalytic process. The enhanced activity and stability of CuCoNi@CNTs/GCE was attributed to (i a synergism between three metal oxides coexisting in the same structure; (ii the presence of CNTs as a support for the metal oxides, that offers high surface area for the deposited tertiary alloy and suppresses the aggregation and sintering of the metals oxide with time; as well as (iii the increase of the conductivity of the deposited semiconducting metal oxides.

Film fabrication of Fe or Fe3O4 nanoparticles mixed with palmitic acid for vertically aligned carbon nanotube growth using Langmuir-Blodgett technique

Science.gov (United States)

Nakamura, Kentaro; Kuriyama, Naoki; Takagiwa, Shota; Sato, Taiga; Kushida, Masahito

2016-03-01

Vertically aligned carbon nanotubes (VA-CNTs) were studied as a new catalyst support for polymer electrolyte fuel cells (PEFCs). Controlling the number density and the diameter of VA-CNTs may be necessary to optimize PEFC performance. As the catalyst for CNT growth, we fabricated Fe or Fe3O4 nanoparticle (NP) films by the Langmuir-Blodgett (LB) technique. The catalyst Fe or Fe3O4 NPs were widely separated by mixing with filler molecules [palmitic acid (C16)]. The number density of VA-CNTs was controlled by varying the ratio of catalyst NPs to C16 filler molecules. The VA-CNTs were synthesized from the catalyst NP-C16 LB films by thermal chemical vapor deposition (CVD) using acetylene gas as the carbon source. The developing solvents used in the LB technique and the hydrogen reduction conditions of CVD were optimized to improve the VA-CNT growth rate. We demonstrate that the proposed method can independently control both the density and the diameter of VA-CNTs.

In vitro bacterial cytotoxicity of CNTs: reactive oxygen species mediate cell damage edges over direct physical puncturing.

Science.gov (United States)

Rajavel, Krishnamoorthy; Gomathi, Rajkumar; Manian, Sellamuthu; Rajendra Kumar, Ramasamy Thangavelu

2014-01-21

Understanding the bacterial cytotoxicity of CNTs is important for a wide variety of applications in the biomedical, environmental, and health sectors. A majority of the earlier reports attributed the bactericidal cytotoxicity of CNTs to bacterial cell membrane damage by direct physical puncturing. Our results reveal that bacterial cell death via bacterial cell membrane damage is induced by reactive oxygen species (ROS) produced from CNTs and is not due to direct physical puncturing by CNTs. To understand the actual mechanism of bacterial killing, we elucidated the bacterial cytotoxicity of SWCNTs and MWCNTs against Gram-negative human pathogenic bacterial species Escherichia coli, Shigella sonnei, Klebsiella pneumoniae, and Pseudomonas aeruginosa and its amelioration upon functionalizing the CNTs with antioxidant tannic acid (TA). Interestingly, the bacterial cells treated with CNTs exhibited severe cell damage under laboratory (ambient) and sunlight irradiation conditions. However, CNTs showed no cytotoxicity to the bacterial cells when incubated in the dark. The quantitative assessments carried out by us made it explicit that CNTs are effective generators of ROS such as (1)O2, O2(•-), and (•)OH in an aqueous medium under both ambient and sunlight-irradiated conditions. Both naked and TA-functionalized CNTs showed negligible ROS production in the dark. Furthermore, strong correlations were obtained between ROS produced by CNTs and the bacterial cell mortality (with the correlation coefficient varying between 0.7618 and 0.9891) for all four tested pathogens. The absence of bactericidal cytotoxicity in both naked and functionalized CNTs in the dark reveals that the presence of ROS is the major factor responsible for the bactericidal action compared to direct physical puncturing. This understanding of the bactericidal activity of the irradiated CNTs, mediated through the generation of ROS, could be interesting for novel applications such as regulated ROS delivery

The concept of a novel hybrid smart composite reinforced with radially aligned zigzag carbon nanotubes on piezoelectric fibers

International Nuclear Information System (INIS)

Ray, M C

2010-01-01

A new hybrid piezoelectric composite (HPZC) reinforced with zigzag single-walled carbon nanotubes (CNTs) and piezoelectric fibers is proposed. The novel constructional feature of this composite is that the uniformly aligned CNTs are radially grown on the surface of piezoelectric fibers. A micromechanics model is derived to estimate the effective piezoelectric and elastic properties. It is found that the effective piezoelectric coefficient e 31 of the proposed HPZC, which accounts for the in-plane actuation, is significantly higher than that of the existing 1-3 piezoelectric composite without reinforcement with carbon nanotubes and the previously reported hybrid piezoelectric composite (Ray and Batra 2009 ASME J. Appl. Mech. 76 034503)

Incorporation of Fe3O4/CNTs nanocomposite in an epoxy coating for corrosion protection of carbon steel

Science.gov (United States)

Pham, Gia Vu; Truc Trinh, Anh; To, Thi Xuan Hang; Duong Nguyen, Thuy; Trang Nguyen, Thu; Hoan Nguyen, Xuan

2014-09-01

In this study Fe3O4/CNTs composite with magnetic property was prepared by attaching magnetic nanoparticles (Fe3O4) to carbon nanotubes (CNTs) by hydrothermal method. The obtained Fe3O4/CNTs composite was characterized by Fourier transform infrared (FTIR) spectroscopy, powder x-ray diffraction and transmission electron microscopy. The Fe3O4/CNTs composite was then incorporated into an epoxy coating at concentration of 3 wt%. Corrosion protection of epoxy coating containing Fe3O4/CNTs composite was evaluated by electrochemical impedance spectroscopy and adhesion measurement. The impedance measurements show that Fe3O4/CNTs composite enhanced the corrosion protection of epoxy coating. The corrosion resistance of the carbon steel coated by epoxy coating containing Fe3O4/CNTs composite was significantly higher than that of carbon steel coated by clear epoxy coating and epoxy coating containing CNTs. FE-SEM photographs of fracture surface of coatings showed good dispersion of Fe3O4/CNTs composite in the epoxy matrix.

Incorporation of Fe3O4/CNTs nanocomposite in an epoxy coating for corrosion protection of carbon steel

International Nuclear Information System (INIS)

Pham, Gia Vu; Trinh, Anh Truc; Hang To, Thi Xuan; Nguyen, Thuy Duong; Nguyen, Thu Trang; Nguyen, Xuan Hoan

2014-01-01

In this study Fe 3 O 4 /CNTs composite with magnetic property was prepared by attaching magnetic nanoparticles (Fe 3 O 4 ) to carbon nanotubes (CNTs) by hydrothermal method. The obtained Fe 3 O 4 /CNTs composite was characterized by Fourier transform infrared (FTIR) spectroscopy, powder x-ray diffraction and transmission electron microscopy. The Fe 3 O 4 /CNTs composite was then incorporated into an epoxy coating at concentration of 3 wt%. Corrosion protection of epoxy coating containing Fe 3 O 4 /CNTs composite was evaluated by electrochemical impedance spectroscopy and adhesion measurement. The impedance measurements show that Fe 3 O 4 /CNTs composite enhanced the corrosion protection of epoxy coating. The corrosion resistance of the carbon steel coated by epoxy coating containing Fe 3 O 4 /CNTs composite was significantly higher than that of carbon steel coated by clear epoxy coating and epoxy coating containing CNTs. FE-SEM photographs of fracture surface of coatings showed good dispersion of Fe 3 O 4 /CNTs composite in the epoxy matrix. (paper)

The rapid growth of vertically aligned carbon nanotubes using laser heating.

Science.gov (United States)

Park, J B; Jeong, S H; Jeong, M S; Lim, S C; Lee, I H; Lee, Y H

2009-05-06

Growth of densely packed vertically aligned carbon nanotubes (VA-CNTs) using laser-induced chemical vapor deposition with visible laser (lambda = 532 nm) irradiation at room temperature is reported. Using a multiple-catalyst layer (Fe/Al/Cr) on quartz as the substrate and an acetylene-hydrogen mixture as the precursor gas, VA-CNT pillars with 60 microm height and 4 microm diameter were grown at a high rate of around 1 microm s(-1) with good reproducibility. It is demonstrated that the fabrication of uniform pillar arrays of VA-CNTs can be achieved with a single irradiation for each pillar using LCVD with no annealing or preprocessing of the substrate. Here, laser fast heating is considered the primary mechanism facilitating the growth of VA-CNT pillars. Field emission characteristics of an array of VA-CNT pillars were then examined to investigate their potential application in vacuum electronic devices.

Out-of-plane growth of CNTs on graphene for supercapacitor applications

International Nuclear Information System (INIS)

Kim, Youn-Su; Kumar, Kitu; Fisher, Frank T; Yang, Eui-Hyeok

2012-01-01

This paper describes the fabrication and characterization of a hybrid nanostructure comprised of carbon nanotubes (CNTs) grown on graphene layers for supercapacitor applications. The entire nanostructure (CNTs and graphene) was fabricated via atmospheric pressure chemical vapor deposition (APCVD) and designed to minimize self-aggregation of the graphene and CNTs. Growth parameters of the CNTs were optimized by adjusting the gas flow rates of hydrogen and methane to control the simultaneous, competing reactions of carbon formation toward CNT growth and hydrogenation which suppresses CNT growth via hydrogen etching of carbon. Characterization of the supercapacitor performance of the CNT–graphene hybrid nanostructure indicated that the average measured capacitance of a fabricated graphene–CNT structure was 653.7 μF cm −2 at 10 mV s −1 with a standard rectangular cyclic voltammetry curve. Rapid charging–discharging characteristics (mV s −1 ) were exhibited with a capacitance of approximately 75% (490.3 μF cm −2 ). These experimental results indicate that this CNT–graphene structure has the potential towards three-dimensional (3D) graphene–CNT multi-stack structures for high-performance supercapacitors.

RevTrans: multiple alignment of coding DNA from aligned amino acid sequences

DEFF Research Database (Denmark)

Wernersson, Rasmus; Pedersen, Anders Gorm

2003-01-01

The simple fact that proteins are built from 20 amino acids while DNA only contains four different bases, means that the 'signal-to-noise ratio' in protein sequence alignments is much better than in alignments of DNA. Besides this information-theoretical advantage, protein alignments also benefit...... proteins. It is therefore preferable to align coding DNA at the amino acid level and it is for this purpose we have constructed the program RevTrans. RevTrans constructs a multiple DNA alignment by: (i) translating the DNA; (ii) aligning the resulting peptide sequences; and (iii) building a multiple DNA...

Flexible transfer of aligned carbon nanotube films for integration at lower temperature

International Nuclear Information System (INIS)

Chai Yang; Gong Jingfeng; Zhang Kai; Chan, Philip C H; Yuen, Matthew M F

2007-01-01

The high growth temperature of carbon nanotubes (CNTs) hinders their direct assembly on temperature-sensitive substrates. We present a method to transfer an aligned CNT film at room temperature to overcome this problem. Using a 'liftoff' technique with hydrofluoric acid solution, we separate the aligned CNT film from the silicon substrate. The lifted-off CNT film is suspended in water, remaining intact and aligned due to the crowding effect. We then transfer the suspended film to various substrates that are sensitive to high temperature. To illustrate the quality of the transferred CNT film, we demonstrate that the thermal interface resistance of the transferred CNT film is comparable with that of as-grown CNT film. This transfer process can be extended to many microelectronics applications, such as field emission devices, integrated circuit interconnects and sensors, requiring processing temperatures not compatible with CNT growth

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000909 gi|15669589 >1vhtA 3 200 2 186 2e-14 ... ref|NP_248402.1| alignment in /usr/local/projects...408.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R584_orf2.nr ... [Me

ORF Alignment: NC_005791 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005791 gi|45359158 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R428_orf1.nr ...

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000909 gi|15669211 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R428_orf1.nr ...

Scalable synthesis of aligned carbon nanotubes bundles using green natural precursor: neem oil

Directory of Open Access Journals (Sweden)

Kumar Rajesh

2011-01-01

Full Text Available Abstract Practical application of aligned carbon nanotubes (ACNTs would have to be determined by a matter of its economical and large-scale preparation. In this study, neem oil (also named Margoaa oil, extracted from the seeds of the neem--Azadirachta indica was used as carbon source to fabricate the bundles of ACNTs. ACNTs have been synthesized by spray pyrolysis of neem oil and ferrocene mixture at 825°C. The major components of neem oil are hydrocarbon with less amount of oxygen, which provided the precursor species in spray pyrolysis growth of CNTs. The bundles of ACNTs have been grown directly inside the quartz tube. The as-grown ACNTs have been characterized through Raman spectroscopy, scanning and transmission electron microscopic (SEM/TEM techniques. SEM images reveal that the bundles of ACNTs are densely packed and are of several microns in length. High-resolution TEM analysis reveals these nanotubes to be multi-walled CNTs. These multi-walled CNTs were found to have inner diameter between 15 and 30 nm. It was found that present technique gives high yield with high density of bundles of ACNTs.

Field emission from carbon nanotube bundle arrays grown on self-aligned ZnO nanorods

International Nuclear Information System (INIS)

Li Chun; Fang Guojia; Yuan Longyan; Liu Nishuang; Ai Lei; Xiang Qi; Zhao Dongshan; Pan Chunxu; Zhao Xingzhong

2007-01-01

The field emission (FE) properties of carbon nanotube (CNT) bundle arrays grown on vertically self-aligned ZnO nanorods (ZNRs) are reported. The ZNRs were first synthesized on ZnO-seed-coated Si substrate by the vapour phase transport method, and then the radically grown CNTs were grown directly on the surface of the ZNRs from ethanol flames. The CNT/ZNR composite showed a turn-on field of 1.5 V μm -1 (at 0.1 μA cm -2 ), a threshold field of 4.5 V μm -1 (at 1 mA cm -2 ) and a stable emission current with fluctuations of 5%, demonstrating significantly enhanced FE of ZNRs due to the low work function and high aspect ratio of the CNTs, and large surface-to-volume ratio of the underlying ZNRs

Aligned Layers of Silver Nano-Fibers

Directory of Open Access Journals (Sweden)

Andrii B. Golovin

2012-02-01

Full Text Available We describe a new dichroic polarizers made by ordering silver nano-fibers to aligned layers. The aligned layers consist of nano-fibers and self-assembled molecular aggregates of lyotropic liquid crystals. Unidirectional alignment of the layers is achieved by means of mechanical shearing. Aligned layers of silver nano-fibers are partially transparent to a linearly polarized electromagnetic radiation. The unidirectional alignment and density of the silver nano-fibers determine degree of polarization of transmitted light. The aligned layers of silver nano-fibers might be used in optics, microwave applications, and organic electronics.

Enhanced performance of inverted organic photovoltaic cells using CNTs-TiO(X) nanocomposites as electron injection layer.

Science.gov (United States)

Zhang, Hong; Xu, Meifeng; Cui, Rongli; Guo, Xihong; Yang, Shangyuan; Liao, Liangsheng; Jia, Quanjie; Chen, Yu; Dong, Jinquan; Sun, Baoyun

2013-09-06

In this study, we fabricated inverted organic photovoltaic cells with the structure ITO/carbon nanotubes (CNTs)-TiO(X)/P3HT:PCBM/MoO₃/Al by spin casting CNTs-TiO(X) nanocomposite (CNTs-TiO(X)) as the electron injection layer onto ITO/glass substrates. The power conversion efficiency (PCE) of the 0.1 wt% single-walled nanotubes (SWNTs)-TiO(X) nanocomposite device was almost doubled compared with the TiO(X) device, but with increasing concentration of the incorporated SWNTs in the TiO(X) film, the performance of the devices appeared to decrease rapidly. Devices with multi-walled NTs in the TiO(X) film have a similar trend. This phenomenon mainly depends on the inherent physical and chemical characteristics of CNTs such as their high surface area, their electron-accepting properties and their excellent carrier mobility. However, with increasing concentration of CNTs, CNTs-TiO(X) current leakage pathways emerged and also a recombination of charges at the interfaces. In addition, there was a significant discovery. The incorporated CNTs were highly conducive to enhancing the degree of crystallinity and the ordered arrangement of the P3HT in the active layers, due to the intermolecular π-π stacking interactions between CNTs and P3HT.

Nanostructued core–shell Sn nanowires @ CNTs with controllable thickness of CNT shells for lithium ion battery

Energy Technology Data Exchange (ETDEWEB)

Zhong, Yu; Li, Xifei; Zhang, Yong; Li, Ruying [Department of Mechanical and Materials Engineering, University of Western Ontario, London, Ontario N6A 5B9 (Canada); Cai, Mei [General Motors Research and Development Center, Warren, MI 48090-9055 (United States); Sun, Xueliang, E-mail: xsun@eng.uwo.ca [Department of Mechanical and Materials Engineering, University of Western Ontario, London, Ontario N6A 5B9 (Canada)

2015-03-30

Graphical abstract: - Highlights: • Sn nanowires encapsulated in CNTs directly grew on current collectors. • The thickness of CNTs were controlled via growth time, gas flow rate and synthesis temperature. • Thick CNTs contributed to a better capacity retention while thin CNTs led to a higher capacity. • The core–shell structures formed in one-step CVD process. - Abstract: Core–shell structure of Sn nanowires encapsulated in amorphous carbon nanotubes (Sn@CNTs) with controlled thickness of CNT shells was in situ prepared via chemical vapor deposition (CVD) method. The thickness of CNT shells was accurately controlled from 4 to 99 nm by using different growth time, flow rate of hydrocarbon gas (C{sub 2}H{sub 4}) and synthesis temperature. The microstructure and composition of the coaxial Sn@CNTs were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), and high resolution transmission electron microscopy (HRTEM) techniques. Moreover, the Sn@CNTs were studied as anode materials for Li-ion batteries and showed excellent cycle performance. The capacity was affected by the thickness of outer CNT shells: thick CNT shells contributed to a better retention while thin CNT shells led to a higher capacity. The thin CNT shell of 6 nm presented the highest capacity around 630 mAh g{sup −1}.

Nanostructued core–shell Sn nanowires @ CNTs with controllable thickness of CNT shells for lithium ion battery

International Nuclear Information System (INIS)

Zhong, Yu; Li, Xifei; Zhang, Yong; Li, Ruying; Cai, Mei; Sun, Xueliang

2015-01-01

Graphical abstract: - Highlights: • Sn nanowires encapsulated in CNTs directly grew on current collectors. • The thickness of CNTs were controlled via growth time, gas flow rate and synthesis temperature. • Thick CNTs contributed to a better capacity retention while thin CNTs led to a higher capacity. • The core–shell structures formed in one-step CVD process. - Abstract: Core–shell structure of Sn nanowires encapsulated in amorphous carbon nanotubes (Sn@CNTs) with controlled thickness of CNT shells was in situ prepared via chemical vapor deposition (CVD) method. The thickness of CNT shells was accurately controlled from 4 to 99 nm by using different growth time, flow rate of hydrocarbon gas (C 2 H 4 ) and synthesis temperature. The microstructure and composition of the coaxial Sn@CNTs were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), and high resolution transmission electron microscopy (HRTEM) techniques. Moreover, the Sn@CNTs were studied as anode materials for Li-ion batteries and showed excellent cycle performance. The capacity was affected by the thickness of outer CNT shells: thick CNT shells contributed to a better retention while thin CNT shells led to a higher capacity. The thin CNT shell of 6 nm presented the highest capacity around 630 mAh g −1

Reply to comment on 'Model calculation of the scanned field enhancement factor of CNTs'

International Nuclear Information System (INIS)

Ahmad, Amir; Tripathi, V K

2010-01-01

In the paper (Ahmad and Tripathi 2006 Nanotechnology 17 3798), we derived an expression to compute the field enhancement factor of CNTs under any positional distribution of CNTs by using the model of a floating sphere between parallel anode and cathode plates. Using this expression we can compute the field enhancement factor of a CNT in a cluster (non-uniformly distributed CNTs). This expression was used to compute the field enhancement factor of a CNT in an array (uniformly distributed CNTs). We used an approximation to calculate the field enhancement factor. Hence, our expressions are correct in that assumption only. Zhbanov et al (2010 Nanotechnology 21 358001) suggest a correction that can calculate the field enhancement factor without using the approximation. Hence, this correction can improve the applicability of this model. (reply)

Molecular dynamics simulations of the effect of waviness and agglomeration of CNTs on interface strength of thermoset nanocomposites.

Science.gov (United States)

Alian, A R; Meguid, S A

2017-02-08

Most existing molecular dynamics simulations in nanoreinforced composites assume carbon nanotubes (CNTs) to be straight and uniformly dispersed within thermoplastics. In reality, however, CNTs are typically curved, agglomerated and aggregated as a result of van der Waal interactions and electrostatic forces. In this paper, we account for both curvature and agglomeration of CNTs in extensive molecular dynamic (MD) simulations. The purpose of these simulations is to evaluate the influence of waviness and agglomeration of these curved and agglomerated CNTs on the interfacial strength of thermoset nanocomposite and upon their load transfer capability. Two aspects of the work were accordingly examined. In the first, realistic carbon nanotubes (CNTs) of the same length but varied curvatures were embedded in thermoset polymer composites and simulations of pull-out tests were conducted to evaluate the corresponding interfacial shear strength (ISS). In the second, the effect of the agglomerate size upon the ISS was determined using bundles of CNTs of different diameters. The results of our MD simulations revealed the following. The pull-out force of the curved CNTs is significantly higher than its straight counterpart and increases further with the increase in the waviness of the CNTs. This is attributed to the added pull-out energy dissipated in straightening the CNTs during the pull-out process. It also reveals that agglomeration of CNTs leads to a reduction in the ISS and poor load transferability, and that this reduction is governed by the size of the agglomerate. The simulation results were also used to develop a generalized relation for the ISS that takes into consideration the effect of waviness and agglomeration of CNTs of CNT-polymer composites.

Field emission characteristics of vertically aligned carbon nanotubes with honeycomb configuration grown onto glass substrate with titanium coating

Energy Technology Data Exchange (ETDEWEB)

Huang, Yung-Jui [Graduate Institute of Electro-Optical Engineering, National Taiwan University of Science and Technology, Taipei 10607, Taiwan (China); Chang, Hsin-Yueh; Chang, Hsuan-Chen [Department of Electronic and computer Engineering, National Taiwan University of Science and Technology, Taipei 10607, Taiwan (China); Shih, Yi-Ting; Su, Wei-Jhih [Graduate Institute of Electro-Optical Engineering, National Taiwan University of Science and Technology, Taipei 10607, Taiwan (China); Ciou, Chen-Hong [Department of Electronic and computer Engineering, National Taiwan University of Science and Technology, Taipei 10607, Taiwan (China); Chen, Yi-Ling [Graduate Institute of Electro-Optical Engineering, National Taiwan University of Science and Technology, Taipei 10607, Taiwan (China); Honda, Shin-ichi [Graduate School of Engineering, University of Hyogo, Himeji, Hyogo 671-2280 (Japan); Huang, Ying-Sheng [Graduate Institute of Electro-Optical Engineering, National Taiwan University of Science and Technology, Taipei 10607, Taiwan (China); Department of Electronic and computer Engineering, National Taiwan University of Science and Technology, Taipei 10607, Taiwan (China); Lee, Kuei-Yi, E-mail: kylee@mail.ntust.edu.tw [Graduate Institute of Electro-Optical Engineering, National Taiwan University of Science and Technology, Taipei 10607, Taiwan (China); Department of Electronic and computer Engineering, National Taiwan University of Science and Technology, Taipei 10607, Taiwan (China)

2014-03-15

Highlights: • We have successfully designed the honeycomb patterns on glass substrate by photolithography technique. • Honeycomb-VACNTs were synthesized successfully onto glass substrate by using thermal CVD and covered different Ti films on VACNTs by e-beam evaporation. • After coating the Ti films, the current density reached 7 mA/cm{sup 2} when the electric field was 2.5 V/μm. • The fluorescence of VACNTs with Ti 15 nm films exhibits the high brightness screen and emission uniformity. -- Abstract: Carbon nanotubes (CNTs) were grown successfully onto a glass substrate using thermal chemical vapor deposition (TCVD) with C{sub 2}H{sub 2} gas at 700 °C. The synthesized CNTs exhibited good crystallinity and a vertically aligned morphology. The vertically aligned CNTs (VACNTs) were patterned with a honeycomb configuration using photolithography and characterized using field emission (FE) applications. Owing to the electric field concentration, the FE current density of VACNTs with honeycomb configuration was higher than that of the un-patterned VACNTs. Ti was coated onto the VACNT surface utilizing the relatively lower work function property to enhance the FE current density. The FE current density reached up to 7.0 mA/cm{sup 2} at an applied electric field of 2.5 V/μm. A fluorescent screen was monitored to demonstrate uniform FE VACNTs with a honeycomb configuration. The designed field emitter provided an admirable example for FE applications.

CNTs in situ attached to α-Fe2O3 submicron spheres for enhancing lithium storage capacity.

Science.gov (United States)

Gao, Guo; Zhang, Qiang; Cheng, Xin-Bing; Qiu, Peiyu; Sun, Rongjin; Yin, Ting; Cui, Daxiang

2015-01-14

In this work, we developed a facile hydrothermal method for synthesis of hybrid α-Fe2O3-carbon nanotubes (CNTs) architectures (α-Fe2O3-CNTs-1 and α-Fe2O3-CNTs-2). The CNTs are in situ attached to the α-Fe2O3 submicron spheres and form three-dimensional network robust architectures. The increase in the amount of CNTs in the network α-Fe2O3-CNTs architectures will significantly enhance the cycling and rate performance, as the flexible and robust CNTs could ensure the fast electron transport pathways, enhance the electronic conductivity, and improve the structural stability of the electrode. As for pure α-Fe2O3 submicron spheres, the capacity decreased significantly and retained at 377.4 mAh g(-1) after 11 cycles, and the capacity has a slightly increasing trend at the following cycling. In contrast, the network α-Fe2O3-CNTs-2 electrode shows the most remarkable performance. At the 60th cycle, the capacity of network α-Fe2O3-CNTs-2 (764.5 mAh g(-1)) is 1.78 times than that of α-Fe2O3 submicron spheres (428.3 mAh g(-1)). The long-term cycling performance (1000 cycles) of samples at a high current density of 5 C showed that the capacity of α-Fe2O3 submicron spheres fade to ∼37.3 mAh g(-1) at the 400th cycle and gradually increased to ∼116.7 mAh g(-1) at the 1000th cycle. The capacity of network α-Fe2O3-CNTs-2 maintained at ∼220.2 mAh g(-1) before the 400th cycle, arrived at ∼326.5 mAh g(-1) in the 615th, cycle and retained this value until 1000th cycle. The network α-Fe2O3-CNTs-2 composite could significantly enhance the cycling and rate performance than pure α-Fe2O3 submicron spheres composite.

A Study of CO2 Methanation over Ni-Based Catalysts Supported by CNTs with Various Textural Characteristics

OpenAIRE

Yanyan Feng; Wen Yang; Wei Chu

2015-01-01

This work studied the influence of textural characteristics of CNTs on catalytic performance of Ni/CNTs for CO2 methanation. The CNTs supports were prepared by chemical vapor deposition method using Ni/MgO catalysts, and acetonitrile and ethanol were used as carbon sources, respectively. The Ni/CNTs catalysts were prepared via impregnation method and characterized by X-ray diffraction (XRD), N2 adsorption/desorption, and temperature-programmed reduction (H2-TPR) techniques. The results indica...

AlignMe—a membrane protein sequence alignment web server

Science.gov (United States)

Stamm, Marcus; Staritzbichler, René; Khafizov, Kamil; Forrest, Lucy R.

2014-01-01

We present a web server for pair-wise alignment of membrane protein sequences, using the program AlignMe. The server makes available two operational modes of AlignMe: (i) sequence to sequence alignment, taking two sequences in fasta format as input, combining information about each sequence from multiple sources and producing a pair-wise alignment (PW mode); and (ii) alignment of two multiple sequence alignments to create family-averaged hydropathy profile alignments (HP mode). For the PW sequence alignment mode, four different optimized parameter sets are provided, each suited to pairs of sequences with a specific similarity level. These settings utilize different types of inputs: (position-specific) substitution matrices, secondary structure predictions and transmembrane propensities from transmembrane predictions or hydrophobicity scales. In the second (HP) mode, each input multiple sequence alignment is converted into a hydrophobicity profile averaged over the provided set of sequence homologs; the two profiles are then aligned. The HP mode enables qualitative comparison of transmembrane topologies (and therefore potentially of 3D folds) of two membrane proteins, which can be useful if the proteins have low sequence similarity. In summary, the AlignMe web server provides user-friendly access to a set of tools for analysis and comparison of membrane protein sequences. Access is available at http://www.bioinfo.mpg.de/AlignMe PMID:24753425

Facile Preparation, Characterization, and Highly Effective Microwave Absorption Performance of CNTs/Fe3O4/PANI Nanocomposites

Directory of Open Access Journals (Sweden)

Deqing Zhang

2013-01-01

Full Text Available A facile method has been developed to synthesize light-weight CNTs/Fe3O4/PANI nanocomposites. The formation route was proposed as the coprecipitation of Fe2+ and Fe3+ and an additional process of in situ polymerization of aniline monomer. The structure and morphology of CNTs/Fe3O4/PANI were characterized by transmission electron microscopy (TEM, X-ray photoelectron spectroscopy (XPS, and Fourier transform infrared (FTIR spectroscopy. The TEM investigation shows that the CNTs/Fe3O4/PANI nanocomposites exhibit less intertwined structure and that many more Fe3O4 particles are attached homogeneously on the surface of CNTs, indicating that PANI can indeed help CNTs to disperse in isolated form. The wave-absorbing properties were investigated in a frequency of 2–18 GHz. The results show that the CNTs/Fe3O4/PANI nanocomposites exhibit a super absorbing behavior and possess a maximum reflection loss of −48 dB at 12.9 GHz, and the bandwidth below −20 dB is more than 5 GHz. More importantly, the absorption peak frequency ranges of the CNTs/Fe3O4/PANI composites can be tuned easily by changing the wax weight ratio and thickness of CNTs/Fe3O4/PANI paraffin wax matrix.

Carbon nanotubes-porous ceramic composite by in situ CCVD growth of CNTs

International Nuclear Information System (INIS)

Mazumder, Sangram; Sarkar, Naboneeta; Park, Jung Gyu; Han, In Sub; Kim, Ik Jin

2016-01-01

A novel approach towards the formation of Carbon nanotubes-porous alumina ceramic composite was attempted by the application of three different reaction techniques. Porous alumina ceramics having micrometer pore dimensions were developed using the direct foaming technique. NaA zeolites were simultaneously synthesized and coated within the porous ceramics by an in situ hydrothermal process and were subjected to a simple ion exchange reaction for preparing the suitable catalyst material for Carbon nanotubes (CNTs) synthesis. The catalytic chemical vapour deposition (CCVD) technique was used to grow CNTs within the porous ceramics and the effect of growth time on the synthesized CNTs were investigated. Phase compositions of the samples were analysed by X-ray diffractometer (XRD). Field Emission Scanning Electron Microscopy (FESEM) and Transmission Electron Microscopy (TEM) were used for morphology, surface quality and structural analysis. Crystallinity, defects and yield were studied by Raman spectroscopy and thermogravimetric analysis (TGA). - Highlights: • Novel processing route of MWCNTs grown on Cobalt-zeolites-porous ceramics by CCVD. • CCVD time of 120 min produced MWCNTs with most prominent tube-like structure. • 120 min produced highest yield (19.46%) of CNTs with an I_D/I_G ratio of 0.88.

Synthesis of an ultradense forest of vertically aligned triple-walled carbon nanotubes of uniform diameter and length using hollow catalytic nanoparticles.

Science.gov (United States)

Baliyan, Ankur; Nakajima, Yoshikata; Fukuda, Takahiro; Uchida, Takashi; Hanajiri, Tatsuro; Maekawa, Toru

2014-01-22

It still remains a crucial challenge to actively control carbon nanotube (CNT) structure such as the alignment, area density, diameter, length, chirality, and number of walls. Here, we synthesize an ultradense forest of CNTs of a uniform internal diameter by the plasma-enhanced chemical vapor deposition (PECVD) method using hollow nanoparticles (HNPs) modified with ligand as a catalyst. The diameters of the HNPs and internal cavities in the HNPs are uniform. A monolayer of densely packed HNPs is self-assembled on a silicon substrate by spin coating. HNPs shrink via the collapse of the internal cavities and phase transition from iron oxide to metallic iron in hydrogen plasma during the PECVD process. Agglomeration of catalytic NPs is avoided on account of the shrinkage of the NPs and ligand attached to the NPs. Diffusion of NPs into the substrate, which would inactivate the growth of CNTs, is also avoided on account of the ligand. As a result, an ultradense forest of triple-walled CNTs of a uniform internal diameter is successfully synthesized. The area density of the grown CNTs is as high as 0.6 × 10(12) cm(-2). Finally, the activity of the catalytic NPs and the NP/carbon interactions during the growth process of CNTs are investigated and discussed. We believe that the present approach may make a great contribution to the development of an innovative synthetic method for CNTs with selective properties.

Growth and structural discrimination of cortical neurons on randomly oriented and vertically aligned dense carbon nanotube networks

Directory of Open Access Journals (Sweden)

Christoph Nick

2014-09-01

Full Text Available The growth of cortical neurons on three dimensional structures of spatially defined (structured randomly oriented, as well as on vertically aligned, carbon nanotubes (CNT is studied. Cortical neurons are attracted towards both types of CNT nano-architectures. For both, neurons form clusters in close vicinity to the CNT structures whereupon the randomly oriented CNTs are more closely colonised than the CNT pillars. Neurons develop communication paths via neurites on both nanoarchitectures. These neuron cells attach preferentially on the CNT sidewalls of the vertically aligned CNT architecture instead than onto the tips of the individual CNT pillars.

A novel hydrogen peroxide biosensor based on hemoglobin-collagen-CNTs composite nanofibers.

Science.gov (United States)

Li, J; Mei, H; Zheng, W; Pan, P; Sun, X J; Li, F; Guo, F; Zhou, H M; Ma, J Y; Xu, X X; Zheng, Y F

2014-06-01

In this paper, carbon nanotubes (CNTs) were successfully incorporated in the composite composed of hemoglobin (Hb) and collagen using co-electrospinning technology. The formed Hb-collagen-CNTs composite nanofibers possessed distinct advantage of three-dimensional porous structure, biocompatibility and excellent stability. The Hb immobilized in the electrospun nanofibers retained its natural structure and the heterogeneous electron transfer rate constant (ks) of the direct electron transfer between Hb and electrodes was 5.3s(-1). In addition, the electrospun Hb-collagen-CNTs nanofibers modified electrodes showed good electrocatalytic properties toward H2O2 with a detection limit of 0.91μM (signal-to-noise ratio of 3) and the apparent Michaelis-Menten constant (Km(app)) of 32.6μM. Copyright © 2014 Elsevier B.V. All rights reserved.

One-pot catalytic conversion of cellulose into polyols with Pt/CNTs catalysts.

Science.gov (United States)

Yang, Li; Yan, Xiaopei; Wang, Qiwu; Wang, Qiong; Xia, Haian

2015-03-02

A series of Pt nanoparticles supported on carbon nanotubes (CNTs) were synthesized using the incipient-wetness impregnation method. These catalysts were characterized by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD), Raman spectroscopy, and transmission electron microscope (TEM) techniques. The characterization results indicate that the Pt nanoparticles were highly dispersed on the surface of the CNTs, and the mean size was less than 5 nm. These catalysts were utilized to convert cellulose to hexitol, ethylene glycerol (EG), and 1,2-propylene glycol (1,2-PG) under low H2 pressure. The total yields were as high as 71.4% for EG and 1,2-PG using 1Pt/CNTs as the catalyst in the hydrolytic hydrogenation of cellulose under mild reaction conditions. Copyright © 2014 Elsevier Ltd. All rights reserved.

A Wire Position Monitor System for the ISAC-II Cryomodule Components Alignment

CERN Document Server

Rawnsley, B; Dutto, G; Fong, K; Laxdal, R E; Ries, T

2004-01-01

TRIUMF is developing ISAC-II, a superconducting (SC) linac. It will comprise 9 cryomodules with a total of 48 niobium cavities and 12 SC solenoids. They must remain aligned at liquid He temperatures: cavities to ±400 μm and solenoids to ±200 μm after a vertical contraction of ~4 mm. A wire position monitor (WPM) system based on a TESLA design has been developed, built, and tested with a prototype cryomodule. The system is based on the measurement of signals induced in pickups by a 215 MHz signal carried by a wire through the WPMs. The wire is stretched between the warm tank walls parallel to the beam axis providing a position reference. The sensors, one per cavity and two per solenoid, are attached to the cold elements to monitor their motion during pre-alignment, pumping and cool down. A WPM consists of four 50 Ω striplines spaced 90° apart. A GaAs multiplexer scans the WPMs and a Bergoz card converts the RF signals to DC X and Y voltages. National Ins...

Enhanced degradation and mineralization of 4-chloro-3-methyl phenol by Zn-CNTs/O3 system.

Science.gov (United States)

Liu, Yong; Zhou, Anlan; Liu, Yanlan; Wang, Jianlong

2018-01-01

A novel zinc-carbon nanotubes (Zn-CNTs) composite was prepared, characterized and used in O 3 system for the enhanced degradation and mineralization of chlorinated phenol. The Zn-CNTs was characterized by SEM, BET and XRD, and the degradation of 4-chloro-3-methyl phenol (CMP) in aqueous solution was investigated using Zn-CNTs/O 3 system. The experimental results showed that the rate constant of total organic carbon (TOC) removal was 0.29 min -1 , much higher than that of only O 3 system (0.059 min -1 ) because Zn-CNTs/O 2 system could generate H 2 O 2 in situ, the concentration of H 2 O 2 could reach 156.14 mg/L within 60 min at pH 6.0. The high mineralization ratio of CMP by Zn-CNTs/O 3 occurred at wide pH range (3.0-9.0). The increase of Zn-CNTs dosage or gas flow rate contributed to the enhancement of CMP mineralization. The intermediates of CMP degradation were identified and the possible degradation pathway was tentatively proposed. Copyright © 2017 Elsevier Ltd. All rights reserved.

Characterization of DOM adsorption of CNTs by using excitation-emission matrix fluorescence spectroscopy and multiway analysis.

Science.gov (United States)

Peng, Mingguo; Li, Huajie; Li, Dongdong; Du, Erdeng; Li, Zhihong

2017-06-01

Carbon nanotubes (CNTs) were utilized to adsorb DOM in micro-polluted water. The characteristics of DOM adsorption on CNTs were investigated based on UV 254 , TOC, and fluorescence spectrum measurements. Based on PARAFAC (parallel factor) analysis, four fluorescent components were extracted, including one protein-like component (C4) and three humic acid-like components (C1, C2, and C3). The adsorption isotherms, kinetics, and thermodynamics of DOM adsorption on CNTs were further investigated. A Freundlich isotherm model fit the adsorption data well with high values of correlation. As a type of macro-porous and meso-porous adsorbent, CNTs preferably adsorb humic acid-like substances rather than protein-like substances. The increasing temperature will speed up the adsorption process. The self-organizing map (SOM) analysis further explains the fluorescent properties of water samples. The results provide a new insight into the adsorption behaviour of DOM fluorescent components on CNTs.

Sheet resistance, transmittance, and chromatic property of CNTs coated with PEDOT:PSS films for transparent electrodes of touch screen panels

Energy Technology Data Exchange (ETDEWEB)

Kim, Bu-Jong; Han, Sang-Hoon; Park, Jin-Seok

2014-12-01

This study demonstrates hybrid-type transparent electrodes based on carbon nanotubes (CNTs) that possess characteristics desirable for touch screen panels. This has been accomplished by depositing CNTs via spray-coating and then depositing thin conductive polymer (such as PEDOT:PSS) films on the CNTs via spin-coating. For all of the samples such as CNTs, PEDOT:PSS, and hybrid (i.e., PEDOT:PSS-coated CNTs), their surface morphologies, sheet resistances, visible transmittances, and chromatic properties are characterized as functions of their preparation conditions. In the PEDOT:PSS-coated CNTs, the PEDOT:PSS particles fill up the voids between tubes in CNTs, forming a conduction bridge for electron transfer and eventually decreasing the sheet resistance of the hybrid electrode. Also, the hybrid electrode reveals a superior color property compared with that of CNTs or the PEDOT:PSS single electrode due to the complementary color relation between CNTs and PEDOT:PSS. Experimental results show that the fabricated hybrid-type electrodes can simultaneously satisfy the requirements necessary for transparent electrodes of touch screen panels such as the sheet resistance requiring to be lower than 100 Ω/sq, visible transmittance higher than 80%, and yellowness approaching to zero. - Highlights: • Hybrid-type (PEDOT:PSS-coated CNTs) electrodes for touch panels are fabricated. • PEDOT:PSS films are coated via spin-coating on spray-deposited CNTs. • Hybrid electrodes are fabricated by varying the thickness of CNTs and PEDOT:PSS. • The resistance, transmittance, and color properties have been analyzed. • Hybrid electrodes satisfy electrical and optical properties for touch panels.

Sheet resistance, transmittance, and chromatic property of CNTs coated with PEDOT:PSS films for transparent electrodes of touch screen panels

International Nuclear Information System (INIS)

Kim, Bu-Jong; Han, Sang-Hoon; Park, Jin-Seok

2014-01-01

This study demonstrates hybrid-type transparent electrodes based on carbon nanotubes (CNTs) that possess characteristics desirable for touch screen panels. This has been accomplished by depositing CNTs via spray-coating and then depositing thin conductive polymer (such as PEDOT:PSS) films on the CNTs via spin-coating. For all of the samples such as CNTs, PEDOT:PSS, and hybrid (i.e., PEDOT:PSS-coated CNTs), their surface morphologies, sheet resistances, visible transmittances, and chromatic properties are characterized as functions of their preparation conditions. In the PEDOT:PSS-coated CNTs, the PEDOT:PSS particles fill up the voids between tubes in CNTs, forming a conduction bridge for electron transfer and eventually decreasing the sheet resistance of the hybrid electrode. Also, the hybrid electrode reveals a superior color property compared with that of CNTs or the PEDOT:PSS single electrode due to the complementary color relation between CNTs and PEDOT:PSS. Experimental results show that the fabricated hybrid-type electrodes can simultaneously satisfy the requirements necessary for transparent electrodes of touch screen panels such as the sheet resistance requiring to be lower than 100 Ω/sq, visible transmittance higher than 80%, and yellowness approaching to zero. - Highlights: • Hybrid-type (PEDOT:PSS-coated CNTs) electrodes for touch panels are fabricated. • PEDOT:PSS films are coated via spin-coating on spray-deposited CNTs. • Hybrid electrodes are fabricated by varying the thickness of CNTs and PEDOT:PSS. • The resistance, transmittance, and color properties have been analyzed. • Hybrid electrodes satisfy electrical and optical properties for touch panels

One–step preparation of CNTs/InVO_4 hollow nanofibers by electrospinning and its photocatalytic performance under visible light

International Nuclear Information System (INIS)

, Jinan 250100 (China))" data-affiliation=" (College of Environmental Science and Engineering, Shandong University, No. 27 Shanda South Road, Jinan 250100 (China))" >Zhang, Yanxiang; Ma, Dong; Wu, Juan; , Jinan 250100 (China))" data-affiliation=" (College of Environmental Science and Engineering, Shandong University, No. 27 Shanda South Road, Jinan 250100 (China))" >Zhang, Qingzhe; Xin, Yanjun; , Jinan 250100 (China))" data-affiliation=" (College of Environmental Science and Engineering, Shandong University, No. 27 Shanda South Road, Jinan 250100 (China))" >Bao, Nan

2015-01-01

Graphical abstract: - Highlights: • CNTs/InVO_4 hollow nanofibers were obtained by electrospinning method. • The properties of InVO_4 hollow nanofibers were deeply influenced by CNTs. • CNTs could reduce recombination of e"−–h"+ pairs to improve photocatalytic activity. - Abstract: A series of InVO_4 incorporated with multi-wall carbon nanotubes (CNTs) composite nanofibers were successfully synthesized by an electrospinning technique. The as-collected nanofibers were calcined at 550 °C in air to remove polyvinyl pyrrolidone (PVP), which could enable InVO_4 to crystallize. InVO_4 in the composite illustrated a hollow fibrous morphology and orthorhombic phase, and CNTs were embedded or coated on the InVO_4 hollow nanofibers. High-resolution transmission emission microscopy (HRTEM), Fourier transform infrared spectroscopy (FTIR) spectra and X-ray photoelectron spectroscopy (XPS) spectra illustrated that CNTs were existed in the composites. The optical properties measured using UV–Vis diffuse reflectance spectroscopy (DRS) confirmed that the absorbance of InVO_4 nanofibers increased in the visible light region with the incorporation of CNTs. The photocatalytic performance of the samples was investigated by the degradation rhodamine B (Rh B) under visible light irradiation. The CNTs/InVO_4 nanofibers in Rh B degradation displayed a higher photocatalytic activity than pure InVO_4 nanofibers and 10%CNTs/InVO_4 nanoparticles. The degradation showed an optimized photocatalytic oxidation for InVO_4 nanofibers incorporated with 10wt% CNTs. The enhanced photocatalytic activity might be ascribed to the role of CNTs as an electron transporter and acceptor in the composites, which could effectively inhibit the charge recombination and facilitate the charge transfer.

A novel three-dimensional carbonized PANI1600@CNTs network for enhanced enzymatic biofuel cell.

Science.gov (United States)

Kang, Zepeng; Jiao, Kailong; Cheng, Jin; Peng, Ruiyun; Jiao, Shuqiang; Hu, Zongqian

2018-03-15

A novel three-dimensional (3D) carbon composite of PANI 1600 @CNTs with rhizobium-like structure is prepared by in-situ polymerization of aniline monomers around and along the functionalized carbon nanotubes (CNTs) and then carbonized at 1600°C for enzymatic biofuel cells (EBFCs). The SEM and TEM images clearly show that the carbonized PANI grew seamlessly on the surface of CNTs and presented the rhizobium-like structure. The carbonized PANI acts like conductive "glue" and connects the adjacent tubes together, which can assemble the CNTs into a 3D network. The PANI 1600 @CNTs composite modified glassy carbon electrodes based on glucose oxidase (GOx) and laccase (Lac) exhibit high electrochemical performance. A glucose//O 2 EBFC constitutes of the fabricated anode and cathode performs a maximum power density of 1.12mWcm -2 at 0.45V. Furthermore, three of the fabricated EBFCs in series are able to lightening up a yellow light-emitting diode (LED) whose turn-on voltage is about at 1.8V. This work may be helpful for exploiting novel substrates by carbonizing the composites of conducting polymer with nano materials at high-temperature for immobilization of enzymes in the EBFCs or biosensor fields. Copyright © 2017 Elsevier B.V. All rights reserved.

Scenarios and methods that induce protruding or released CNTs after degradation of nanocomposite materials.

Science.gov (United States)

Hirth, Sabine; Cena, Lorenzo; Cox, Gerhard; Tomović, Zeljko; Peters, Thomas; Wohlleben, Wendel

2013-04-01

Nanocomposite materials may be considered as a low-risk application of nanotechnology, if the nanofillers remain embedded throughout the life-cycle of the products in which they are embedded. We hypothesize that release of free CNTs occurs by a combination of mechanical stress and chemical degradation of the polymer matrix. We experimentally address limiting cases: Mechanically released fragments may show tubular protrusions on their surface. Here we identify these protrusions unambiguously as naked CNTs by chemically resolved microscopy and a suitable preparation protocol. By size-selective quantification of fragments we establish as a lower limit that at least 95 % of the CNTs remain embedded. Contrary to classical fiber composite approaches, we link this phenomenon to matrix materials with only a few percent elongation at break, predicting which materials should still cover their CNT nanofillers after machining. Protruding networks of CNTs remain after photochemical degradation of the matrix, and we show that it takes the worst case combinations of weathering plus high-shear wear to release free CNTs in the order of mg/m 2 /year. Synergy of chemical degradation and mechanical energy input is identified as the priority scenario of CNT release, but its lab simulation by combined methods is still far from real-world validation.

Infinite dilution partial molar volumes of platinum(II) 2,4-pentanedionate in supercritical carbon dioxide.

Science.gov (United States)

Kong, Chang Yi; Siratori, Tomoya; Funazukuri, Toshitaka; Wang, Guosheng

2014-10-03

The effects of temperature and density on retention of platinum(II) 2,4-pentanedionate in supercritical fluid chromatography were investigated at temperatures of 308.15-343.15K and pressure range from 8 to 40MPa by the chromatographic impulse response method with curve fitting. The retention factors were utilized to derive the infinite dilution partial molar volumes of platinum(II) 2,4-pentanedionate in supercritical carbon dioxide. The determined partial molar volumes were small and positive at high pressures but exhibited very large and negative values in the highly compressible near critical region of carbon dioxide. Copyright © 2014 Elsevier B.V. All rights reserved.

Carbon nanotubes (CNTs) based strain sensors for a wearable monitoring and biofeedback system for pressure ulcer prevention and rehabilitation.

Science.gov (United States)

Boissy, Patrick; Genest, Jonathan; Patenaude, Johanne; Poirier, Marie-Sol; Chenel, Vanessa; Béland, Jean-Pierre; Legault, Georges-Auguste; Bernier, Louise; Tapin, Danielle; Beauvais, Jacques

2011-01-01

This paper presents an overview of the functioning principles of CNTs and their electrical and mechanical properties when used as strain sensors and describes a system embodiment for a wearable monitoring and biofeedback platform for use in pressure ulcer prevention and rehabilitation. Two type of CNTs films (multi-layered CNTs film vs purified film) were characterized electrically and mechanically for potential use as source material. The loosely woven CNTs film (multi-layered) showed substantial less sensitivity than the purified CNTs film but had an almost linear response to stress and better mechanical properties. CNTs have the potential to achieve a much higher sensitivity to strain than other piezoresistors based on regular of conductive particles such as commercially available resistive inks and could become an innovative source material for wearable strain sensors. We are currently continuing the characterization of CNTs based strain sensors and exploring their use in a design for 3-axis strain sensors.

In Situ TEM Investigation of the Electrochemical Behavior in CNTs/MnO2-Based Energy Storage Devices.

Science.gov (United States)

Tsai, Tsung-Chun; Huang, Guan-Min; Huang, Chun-Wei; Chen, Jui-Yuan; Yang, Chih-Chieh; Tseng, Tseung-Yuen; Wu, Wen-Wei

2017-09-19

Transition metal oxides have attracted much interest owing to their ability to provide high power density in lithium batteries; therefore, it is important to understand the electrochemical behavior and mechanism of lithiation-delithiation processes. In this study, we successfully and directly observed the structural evolution of CNTs/MnO 2 during the lithiation process using transmission electron microscopy (TEM). CNTs/MnO 2 were selected due to their high surface area and capacitance effect, and the lithiation mechanism of the CNT wall expansion was systematically analyzed. Interestingly, the wall spacings of CNTs/MnO 2 and CNTs were obviously expanded by 10.92% and 2.59%, respectively. The MnO 2 layer caused structural defects on the CNTs surface that could allow penetration of Li + and Mn 4+ through the tube wall and hence improve the ionic transportation speed. This study provided direct evidence for understanding the role of CNTs/MnO 2 in the lithiation process used in lithium ion batteries and also offers potential benefits for applications and development of supercapacitors.

Carbon nanotubes-porous ceramic composite by in situ CCVD growth of CNTs

Energy Technology Data Exchange (ETDEWEB)

Mazumder, Sangram; Sarkar, Naboneeta; Park, Jung Gyu [Institute of Processing and Application of Inorganic Materials (PAIM), Department of Materials Science and Engineering, Hanseo University, #360 Daegok-ri, Haemi-myeon, Seosan-si, Chungnam, 356-706 (Korea, Republic of); Han, In Sub [Korea Institute of Energy Research (KIER), #152 Gajeong-gu, Daejeon 305-343 (Korea, Republic of); Kim, Ik Jin, E-mail: ijkim@hanseo.ac.kr [Institute of Processing and Application of Inorganic Materials (PAIM), Department of Materials Science and Engineering, Hanseo University, #360 Daegok-ri, Haemi-myeon, Seosan-si, Chungnam, 356-706 (Korea, Republic of)

2016-03-01

A novel approach towards the formation of Carbon nanotubes-porous alumina ceramic composite was attempted by the application of three different reaction techniques. Porous alumina ceramics having micrometer pore dimensions were developed using the direct foaming technique. NaA zeolites were simultaneously synthesized and coated within the porous ceramics by an in situ hydrothermal process and were subjected to a simple ion exchange reaction for preparing the suitable catalyst material for Carbon nanotubes (CNTs) synthesis. The catalytic chemical vapour deposition (CCVD) technique was used to grow CNTs within the porous ceramics and the effect of growth time on the synthesized CNTs were investigated. Phase compositions of the samples were analysed by X-ray diffractometer (XRD). Field Emission Scanning Electron Microscopy (FESEM) and Transmission Electron Microscopy (TEM) were used for morphology, surface quality and structural analysis. Crystallinity, defects and yield were studied by Raman spectroscopy and thermogravimetric analysis (TGA). - Highlights: • Novel processing route of MWCNTs grown on Cobalt-zeolites-porous ceramics by CCVD. • CCVD time of 120 min produced MWCNTs with most prominent tube-like structure. • 120 min produced highest yield (19.46%) of CNTs with an I{sub D}/I{sub G} ratio of 0.88.

Enhanced Activity and Durability of Nanosized Pt-SnO2/IrO2/CNTs Catalyst for Methanol Electrooxidation.

Science.gov (United States)

Wang, Hongjuan; Wang, Xiaohui; Zheng, Jiadao; Peng, Feng; Yu, Hao

2015-05-01

Pt-SnO2/IrO2/CNTs anode catalyst for direct methanol fuel cell was designed and prepared with IrO2/CNTs as support for the subsequent immobilization of Pt and SnO2 at the same time. The structure of the catalysts and their catalytic performance in methanol electrooxidation were investigated and the roles of IrO2 and SnO2 in methanol electrooxidation were discussed as well. Results show that Pt-SnO2/IrO2/CNTs catalyst exhibits the best activity and durability for methanol electrooxidation when compared with Pt/CNTs, Pt/IrO2/CNTs and Pt-SnO2/CNTs. According to the results of electrochemical tests and physicochemical characterizations, the enhancements of Pt-SnO2/IrO2/CNTs were attributed to the special properties of IrO2 and SnO2, in which IrO2 mainly increases the methanol oxidation activity and SnO2 mainly improves the CO oxidation ability and durability. Therefore, Pt-SnO2/IrO2/CNTs exhibits excellent performance for methanol oxidation with higher electrocatalytic activity (I(f) of 1054 A g(Pt(-1)) and powerful anti-poisoning ability (the onset potential for CO oxidation of 0.3 V) and outstanding durability (the sustained time t in CP of 617 s), revealing a suitable anode catalyst for DMFCs.

Experts' understanding of partial derivatives using the Partial Derivative Machine

OpenAIRE

Roundy, David; Dorko, Allison; Dray, Tevian; Manogue, Corinne A.; Weber, Eric

2014-01-01

Partial derivatives are used in a variety of different ways within physics. Most notably, thermodynamics uses partial derivatives in ways that students often find confusing. As part of a collaboration with mathematics faculty, we are at the beginning of a study of the teaching of partial derivatives, a goal of better aligning the teaching of multivariable calculus with the needs of students in STEM disciplines. As a part of this project, we have performed a pilot study of expert understanding...

Influencing Mechanism of Electrochemical Treatment on Preparation of CNTs-grafted on Carbon Fibers

Directory of Open Access Journals (Sweden)

SONG Lei

2017-11-01

Full Text Available Based on electrochemical anodic oxidation, an innovative technique was developed to efficiently obtain the uniform catalyst coating on continuous carbon fibers. Through systematic investigation on the effect of electrochemical modified strength on the physical and chemical characteristics of carbon fiber surface, catalyst particles and the morphology of CNTs-grafted carbon fibers, tensile strength of multi-scale reinforcement and the interlaminar shear strength of its reinforced composites, the electrochemical modification process on carbon fibre surface was optimized. The results show that the morphology and distribution of catalyst particles not only affect the morphology of CNTs deposited on the surface of carbon fibres,but also affect the mechanical properties of multi-scale reinforcement and its reinforced composites of CNTs-grafted carbon fibers.

Dispersion and Filtration of Carbon Nanotubes (CNTs) and Measurement of Nanoparticle Agglomerates in Diesel Exhaust.

Science.gov (United States)

Wang, Jing; Pui, David Y H

2013-01-14

Carbon nanotubes (CNTs) tend to form bundles due to their geometry and van der Walls forces, which usually complicates studies of the CNT properties. Dispersion plays a significant role in CNT studies and we summarize dispersion techniques to generate airborne CNTs from suspensions or powders. We describe in detail our technique of CNT aerosolization with controlled degree of agglomeration using an electrospray system. The results of animal inhalation studies using the electrosprayed CNTs are presented. We have performed filtration experiments for CNTs through a screen filter. A numerical model has been established to simulate the CNT filtration experiments. Both the modeling and experimental results show that the CNT penetration is less than the penetration for a sphere with the same mobility diameter, which is mainly due to the larger interception length of the CNTs. There is a need for instruments capable of fast and online measurement of gas-borne nanoparticle agglomerates. We developed an instrument Universal NanoParticle Analyzer (UNPA) and the measurement results for diesel exhaust particulates are presented. The results presented here are pertinent to non-spherical aerosol particles, and illustrate the effects of particle morphology on aerosol behaviors.

Synthesis of Pt@TiO2@CNTs Hierarchical Structure Catalyst by Atomic Layer Deposition and Their Photocatalytic and Photoelectrochemical Activity.

Science.gov (United States)

Liao, Shih-Yun; Yang, Ya-Chu; Huang, Sheng-Hsin; Gan, Jon-Yiew

2017-04-29

Pt@TiO2@CNTs hierarchical structures were prepared by first functionalizing carbon nanotubes (CNTs) with nitric acid at 140 °C. Coating of TiO2 particles on the CNTs at 300 °C was then conducted by atomic layer deposition (ALD). After the TiO2@CNTs structure was fabricated, Pt particles were deposited on the TiO2 surface as co-catalyst by plasma-enhanced ALD. The saturated deposition rates of TiO2 on a-CNTs were 1.5 Å/cycle and 0.4 Å/cycle for substrate-enhanced process and linear process, respectively. The saturated deposition rate of Pt on TiO2 was 0.39 Å/cycle. The photocatalytic activities of Pt@TiO2@CNTs hierarchical structures were higher than those without Pt co-catalyst. The particle size of Pt on TiO2@CNTs was a key factor to determine the efficiency of methylene blue (MB) degradation. The Pt@TiO2@CNTs of 2.41 ± 0.27 nm exhibited the best efficiency of MB degradation.

Gas adsorption capacity in an all carbon nanomaterial composed of carbon nanohorns and vertically aligned carbon nanotubes.

Science.gov (United States)

Puthusseri, Divya; Babu, Deepu J; Okeil, Sherif; Schneider, Jörg J

2017-10-04

Whereas vertically aligned carbon nanotubes (VACNTs) typically show a promising adsorption behavior at high pressures, carbon nanohorns (CNHs) exhibit superior gas adsorption properties in the low pressure regime due to their inherent microporosity. These adsorption characteristics are further enhanced when both materials are opened at their tips. The so prepared composite material allows one to investigate the effect of physical entrapment of CO 2 molecules within the specific adsorption sites of VACNTs composed of opened double walled carbon nanotubes (CNTs) and in specific adsorption sites created by spherically aggregated opened single walled carbon nanohorns. Combining 50 wt% of tip opened CNTs with tip opened CNHs increases the CO 2 adsorption capacity of this material by ∼24% at 30 bar and 298 K compared to opened CNHs alone.

Fenton-like oxidation of 4-chlorophenol using H2O2 in situ generated by Zn-Fe-CNTs composite.

Science.gov (United States)

Liu, Yong; Fan, Qing; Liu, Yanlan; Wang, Jianlong

2018-05-15

In this paper, a zinc-iron-carbon nanotubes (Zn-Fe-CNTs) composite was prepared, characterized and used to develop a Fenton-like system of Zn-Fe-CNTs/O 2 for the degradation of 4-chlorophenol (4-CP), in which H 2 O 2 was generated in situ from zinc-carbon galvanic cells and oxygen in aqueous solution was activated by iron attached on the surface of CNTs to produce ·OH radicals for the oxidation of 4-CP. The experimental results showed that the particles of Zn and Fe in Zn-Fe-CNTs composite were adhered to the surface of CNTs, which accelerated the electron transfer process. The BET area of Zn-Fe-CNTs composite was 32.9 m 2 /g. The contents of Zn and Fe (% w) in the composite were 44.7% and 4.2%, respectively. The removal efficiency of 4-CP and TOC in Zn-Fe-CNTs/O 2 system was 90.8% and 52.9%, respectively, with the initial pH of 2.0, O 2 flow rate of 800 mL/min, Zn-Fe-CNTs dosage of 1.0 g/L, 4-CP concentration of 50 mg/L and reaction time of 20 min. Based on the analysis of the degradation intermediate products with LC-MS and IC, a possible degradation pathway of 4-CP in Zn-Fe-CNTs/O 2 system was proposed. Copyright © 2018 Elsevier Ltd. All rights reserved.

Synthesis of highly aligned carbon nanotubes by one-step liquid-phase process: Effects of carbon sources on morphology of carbon nanotubes

Science.gov (United States)

Yamagiwa, Kiyofumi; Kuwano, Jun

2017-06-01

This paper describes a unique and innovative synthesis technique for carbon nanotubes (CNTs) by a one-step liquid-phase process under ambient pressure. Vertically aligned multi-walled CNT arrays with a maximum height of 100 µm are prepared on stainless steel substrates, which are submerged and electrically heated in straight-chain primary alcohols with n C = 1-4 (n C: number of C atoms in the molecule) containing an appropriate amount of cobalt-based organometallic complex as a catalyst precursor. Structural isomers of butanol were also used for the synthesis to examine the effects of structural factors on the morphology of the deposited products. Notably, 2-methyl-2-propanol, which is a tertiary alcohol, produced only a small amount of low-crystallinity carbonaceous deposits, whereas vertically aligned CNTs were grown from the other isomers of butanol. These results suggest that the presence or absence of β-hydrogen in the molecular structure is a key factor for understanding the dissociation behavior of the carbon source molecules on the catalyst.

Comparative clinical evaluation of removable partial dentures made of two different materials in Kennedy Applegate class II partially edentulous situation.

Science.gov (United States)

Hundal, Maninder; Madan, Rajesh

2015-12-01

Cast Chromium Cobalt alloy has been the material of choice for fabricating Removable Partial Dentures (RPDs) but has certain drawbacks. Newer materials like the flexible Nylon based Super Polyamide have been introduced to overcome these drawbacks. The present study has compared the above two materials for nine clinical parameters. The study was carried out on 30 patients presenting with a Kennedy Applegate class II partially edentulous situation who were divided into two equal groups and clinically assessed. Statistically significant results were obtained in favor of flexible RPDs, in the parameters of 'aesthetics' and 'overall patient satisfaction'. Both groups showed more or less similar values for 'frequency of fracture of the prosthesis during usage' with the incidence being slightly higher for patients wearing the cast RPDs. The clinical parameters of 'oral soft tissue tolerance', 'gingival health', 'periodontal health' and 'adaptability in areas with undercut' were statistically at par for all the 30 patients thus suggesting the comparable biocompatibility of the two materials. The highlight of this study was the relative ease in fabrication of the flexible RPDs as compared to the cast RPDs. Based on the favorable clinical results of this study, it can be summarized that the flexible RPDs is a viable alternative to cast RPDs in Kennedy Applegate class II partially edentulous situation in the short term.

Scrutinizing the alignment limit in two-Higgs-doublet models. II. mH=125 GeV

Science.gov (United States)

Bernon, Jérémy; Gunion, John F.; Haber, Howard E.; Jiang, Yun; Kraml, Sabine

2016-02-01

In the alignment limit of a multidoublet Higgs sector, one of the Higgs mass eigenstates aligns in field space with the direction of the scalar field vacuum expectation values, and its couplings approach those of the Standard Model (SM) Higgs boson. We consider C P -conserving two-Higgs-doublet models (2HDMs) of type I and type II near the alignment limit in which the heavier of the two C P -even Higgs bosons, H , is the SM-like state observed with a mass of 125 GeV, and the couplings of H to gauge bosons approach those of the SM. We review the theoretical structure and analyze the phenomenological implications of this particular realization of the alignment limit, where decoupling of the extra states cannot occur given that the lighter C P -even state h must, by definition, have a mass below 125 GeV. For the numerical analysis, we perform scans of the 2HDM parameter space employing the software packages 2hdmc and lilith, taking into account all relevant pre-LHC constraints, constraints from the measurements of the 125 GeV Higgs signal at the LHC, as well as the most recent limits coming from searches for other Higgs-like states. Implications for Run 2 at the LHC, including expectations for observing the other scalar states, are also discussed.

Porous CNTs/Co Composite Derived from Zeolitic Imidazolate Framework: A Lightweight, Ultrathin, and Highly Efficient Electromagnetic Wave Absorber.

Science.gov (United States)

Yin, Yichao; Liu, Xiaofang; Wei, Xiaojun; Yu, Ronghai; Shui, Jianglan

2016-12-21

Porous carbon nanotubes/cobalt nanoparticles (CNTs/Co) composite with dodecahedron morphology was synthesized by in situ pyrolysis of the Co-based zeolitic imidazolate framework in a reducing atmosphere. The morphology and microstructure of the composite can be well tuned by controlling the pyrolysis conditions. At lower pyrolysis temperature, the CNTs/Co composite is composed of well-dispersed Co nanoparticles and short CNT clusters with low graphitic degree. The increase of pyrolysis temperature/time promotes the growth and graphitization of CNTs and leads to the aggregation of Co nanoparticles. The optimized CNTs/Co composite exhibits strong dielectric and magnetic losses as well as a good impedance matching property. Interestingly, the CNTs/Co composite displays extremely strong electromagnetic wave absorption with a maximum reflection loss of -60.4 dB. More importantly, the matching thickness of the absorber is as thin as 1.81 mm, and the filler loading of composite in the matrix is only 20 wt %. The highly efficient absorption is closely related to the well-designed structure and the synergistic effect between CNTs and Co nanoparticles. The excellent absorbing performance together with lightweight and ultrathin thickness endows the CNTs/Co composite with the potential for application in the electromagnetic wave absorbing field.

A facile synthesis of Zn(x)Cd(1-x)S/CNTs nanocomposite photocatalyst for H2 production.

Science.gov (United States)

Wang, Lei; Yao, Zhongping; Jia, Fangzhou; Chen, Bin; Jiang, Zhaohua

2013-07-21

The sulfide solid solution has become a promising and important visible-light-responsive photocatalyst for hydrogen production nowadays. Zn(x)Cd(1-x)S/CNT nanocomposites were synthesized to improve the dispersion, adjust the energy band gap, and enhance the separation of the photogenerated electrons and holes. The as-prepared photocatalysts were characterized by scanning electron-microscopy (SEM), transmission electron microscopy (TEM), X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and UV-visible diffuse reflectance spectra (UV-visible), respectively. And the effects of CNTs on structure, composition and optical absorption property of the sulfide solid solutions were investigated along with their inherent relationships. For Zn0.83Cd0.17S/CNTs, sulfide solid solution is assembled along the CNTs orderly, with a diameter of 100 nm or so. XPS analysis shows that there is bonding effect between the solid solutions and the CNTs due to the strong adsorption of Zn(2+) and Cd(2+) on the surface of CNTs. There are two obvious absorption edges for Zn0.83Cd0.17S/CNTs, corresponding to two kinds of sulfide solid solutions with different molar ratios of Zn/Cd. The hybridization of solid solutions with CNTs makes the absorption spectrum red shift. The photocatalytic property was evaluated by splitting Na2S + Na2SO3 solution into H2, and the highest rate of H2 evolution of 6.03 mmol h(-1) g(-1) was achieved over Zn0.83Cd0.17S/CNTs. The high activity of photocatalytic H2 production is attributed to the following factors: (1) the optimum band gap and a moderate position of the conduction band (which needs to match the irradiation spectrum of the Xe lamp best), (2) the efficient separation of photogenerated electrons and holes by hybridization, and (3) the improvement of the dispersion of nanocomposites by assembling along the CNTs as well.

Multiple spectroscopic studies on the interaction of BSA with pristine CNTs and their toxicity against Donax faba

Energy Technology Data Exchange (ETDEWEB)

Sekar, Gajalakshmi; Vijayakumar, S.; Thanigaivel, S.; Thomas, John; Mukherjee, Amitava; Chandrasekaran, Natarajan, E-mail: nchandra40@hotmail.com

2016-02-15

Enhanced biomedical applications of carbon nanotubes (CNTs) have necessitated the need for the fundamental understanding behind their interaction with biomolecules. Carbon nanotube bundles were dispersed with tween 20 to attain individual nanotubes that are active in UV–vis region. Plasmon resonance of dispersions was obtained at 252 nm of 4.88 eV. FT-Raman bands of dispersions of SWCNTs and MWCNTs at 1346 and 1573 cm{sup −1} corresponds to the existence of Disordered and Graphitic band of CNTs after dispersion. XRD revealed crystalline feature of graphitic structures of CNTs. SEM-EDAX showed tubular structures of CNTs along with the existence of lower percentage contents of metal impurities. Hyperchromic effect of BSA–CNT complex suggested the existence of ground state complex between them. Quenching nature of CNTs against the intrinsic fluorescence potential of BSA followed static mechanism. 3D fluorescence spectra of BSA confirmed the possibilities of their binding with CNTs via tryptophan and tyrosine residues, followed by the disturbances to their aromatic environment. Alterations were observed in the amide band position of FTIR spectra of BSA–CNT conjugates. Loss of alpha-helical structures and alteration in the tryptophan position were evidenced with respect to CD spectra. The toxicity profile of pristine and BSA–CNT conjugates were evaluated against Donax faba. On comparison with pristine CNTs, BSA–CNTs conjugates showed higher LC{sub 50} dose values. In addition, the histopathology of the tissues, treated with CNT–BSA conjugates has shown decreased effect on the cellular integrity rather than the pristine ones. Hence, the adsorption of biomolecules such as the proteins over CNTs surface could have possible effect on reducing their toxicity profile in nature. - Highlights: • UV–visible spectra showed hyper-chromic effect. • Binding existed with static quenching mechanism. • Aromatic environment around Trp and Tyr residues were affected

Formation of radial aligned and uniform nematic liquid crystal droplets via drop-on-demand inkjet printing into a partially-wet polymer layer

Science.gov (United States)

Parry, Ellis; Kim, Dong-Jin; Castrejón-Pita, Alfonso A.; Elston, Steve J.; Morris, Stephen M.

2018-06-01

This paper investigates the drop-on-demand inkjet printing of a nematic liquid crystal (LC) onto a variety of substrates. Achieving both a well-defined droplet boundary and uniformity of the LC director in printed droplets can be challenging when traditional alignment surfaces are employed. Despite the increasing popularity of inkjet printing LCs, the mechanisms that are involved during the deposition process such as drop impact, wetting and spreading have received very little attention, in the way of experiments, as viable routes for promoting alignment of the resultant LC droplets. In this work, radial alignment of the director and uniformity of the droplet boundary are achieved in combination via the use of a partially-wet polymer substrate, which makes use of the forces and flow generated during droplet impact and subsequent wetting process. Our findings could have important consequences for future LC inkjet applications, including the development of smart inks, printable sensors and lasers.

One-pot synthesis of FePt/CNTs nanocomposites for efficient cellular imaging and cancer therapy

Energy Technology Data Exchange (ETDEWEB)

Chen, Weihong; Zheng, Xiuwen, E-mail: xwzheng1976@163.com [Linyi University, School of Chemistry & Chemical Engineering, Shandong Provincial Key Laboratory of Detection Technology for Tumor Makers (China); Li, Shulian [Linyi Tumor Hospital (China); Zhang, Wei; Wen, Xin [Linyi University, School of Chemistry & Chemical Engineering, Shandong Provincial Key Laboratory of Detection Technology for Tumor Makers (China); Yue, Ludan [Shandong Normal University (China); Wang, Jinlong [Shandong University of Technology (China)

2015-11-15

Here, we developed a facile route to synthesize carbon nanotube-based FePt nanocomposites (FePt/CNTs) as a potential theranostic platform in the cancer treatment. FePt/CNTs were firstly synthesized via one-pot polyol route, and then functionalized with 6-arm-polyethylene glycol-amine polymer. The average size of FePt nanoparticles (NPs) is 3–4 nm, which is dispersed on the CNT surface (ca.50–150 nm). The as-prepared FePt NPs display high cytotoxicity by highly reactive oxygen species in cancer cells. Folic acid and fluorescein isothiocyanate are assembled onto the surface of FePt/CNTs for effective targeting of folate receptor-positive cancer cells and simultaneously for the visualization of cellular uptake. Therefore, the FePt/CNTs NPs capability of simultaneously performing diagnosis, therapy, and targeting is, therefore, promising for future potential widespread application in biomedicine.

A fully automated and scalable timing probe-based method for time alignment of the LabPET II scanners

Science.gov (United States)

Samson, Arnaud; Thibaudeau, Christian; Bouchard, Jonathan; Gaudin, Émilie; Paulin, Caroline; Lecomte, Roger; Fontaine, Réjean

2018-05-01

A fully automated time alignment method based on a positron timing probe was developed to correct the channel-to-channel coincidence time dispersion of the LabPET II avalanche photodiode-based positron emission tomography (PET) scanners. The timing probe was designed to directly detect positrons and generate an absolute time reference. The probe-to-channel coincidences are recorded and processed using firmware embedded in the scanner hardware to compute the time differences between detector channels. The time corrections are then applied in real-time to each event in every channel during PET data acquisition to align all coincidence time spectra, thus enhancing the scanner time resolution. When applied to the mouse version of the LabPET II scanner, the calibration of 6 144 channels was performed in less than 15 min and showed a 47% improvement on the overall time resolution of the scanner, decreasing from 7 ns to 3.7 ns full width at half maximum (FWHM).

Investigation of mechanical properties of masterbatches and composites with small additions of CNTs

International Nuclear Information System (INIS)

Burmistrov, I N; Yudintseva, T I; Ilinykh, I A; Khaydarov, B B; Mazov, I N; Anshin, S M; Kuznetsov, D V

2016-01-01

The present paper investigated physical and mechanical properties of the nanotube masterbatches and the polymer composites with low contents of carbon nanotubes (CNTs), which were obtained by diluting masterbatches. Ethylene-octene copolymer was used as the binder for the masterbatches, which provides the elasticity of the material at a content 20 wt% of CNT. Masterbatches were obtained with a 2-roller mixer, and their additive to polypropylene was carried out on a single screw injection molding machine. Strength properties of ethylene-octene copolymer increased when additing CNTs in an amount of 5-20 wt%. When the concentration of CNT in masterbatches is reduced to 0.01-0.1 wt% its strength characteristics increased up to 4-18%. The most effective strengthening of polypropylene was observed with the content of CNTs 0.1 wt%. (paper)

High Sensitivity Electrochemical Cholesterol Sensor Utilizing a Vertically Aligned Carbon Nanotube Electrode with Electropolymerized Enzyme Immobilization

Directory of Open Access Journals (Sweden)

Ditsayut Phokharatkul

2009-10-01

Full Text Available In this report, a new cholesterol sensor is developed based on a vertically aligned CNT electrode with two-step electrochemical polymerized enzyme immobilization. Vertically aligned CNTs are selectively grown on a 1 mm2 window of gold coated SiO2/Si substrate by thermal chemical vapor deposition (CVD with gravity effect and water-assisted etching. CNTs are then simultaneously functionalized and enzyme immobilized by electrochemical polymerization of polyaniline and cholesterol enzymes. Subsequently, ineffective enzymes are removed and new enzymes are electrochemically recharged. Scanning electron microscopic characterization indicates polymer-enzyme nanoparticle coating on CNT surface. Cyclic voltammogram (CV measurements in cholesterol solution show the oxidation and reduction peaks centered around 450 and −220 mV, respectively. An approximately linear relationship between the cholesterol concentration and the response current could be observed in the concentration range of 50–300 mg/dl with a sensitivity of approximately 0.22 μA/mg·dl−1, which is considerably higher compared to previously reported CNT bioprobe. In addition, good specificity toward glucose, uric acid acetaminophen and ascorbic acid have been obtained. Moreover, sensors have satisfactory stability, repeatability and life time. Therefore, the electropolymerized CNT bioprobe is promising for cholesterol detection in normal cholesterol concentration in human blood.

Synthesis of Patterned Vertically Aligned Carbon Nanotubes by PECVD Using Different Growth Techniques: A Review.

Science.gov (United States)

Gangele, Aparna; Sharma, Chandra Shekhar; Pandey, Ashok Kumar

2017-04-01

Immense development has been taken place not only to increase the bulk production, repeatability and yield of carbon nanotubes (CNTs) in last 25 years but preference is also given to acknowledge the basic concepts of nucleation and growth methods. Vertically aligned carbon nanotubes (VAC-NTs) are forest of CNTs accommodated perpendicular on a substrate. Their exceptional chemical and physical properties along with sequential arrangement and dense structure make them suitable in various fields. The effect of different type of selected substrate, carbon precursor, catalyst and their physical and chemical status, reaction conditions and many other key parameters have been thoroughly studied and analysed. The aim of this paper is to specify the trend and summarize the effect of key parameters instead of only presenting all the experiments reported till date. The identified trends will be compared with the recent observations on the growth of different types of patterned VACNTs. In this review article, we have presented a comprehensive analysis of different techniques to precisely determine the role of different parameters responsible for the growth of patterned vertical aligned carbon nanotubes. We have covered various techniques proposed in the span of more than two decades to fabricate the different structures and configurations of carbon nanotubes on different types of substrates. Apart from a detailed discussion of each technique along with their specific process and implementation, we have also provided a critical analysis of the associated constraints, benefits and shortcomings. To sum it all for easy reference for researchers, we have tabulated all the techniques based on certain main key factors. This review article comprises of an exhaustive discussion and a handy reference for researchers who are new in the field of synthesis of CNTs or who wants to get abreast with the techniques of determining the growth of VACNTs arrays.

Facile synthesis of CNTs/CaIn{sub 2}S{sub 4} composites with enhanced visible-light photocatalytic performance

Energy Technology Data Exchange (ETDEWEB)

Xia, Yang; Li, Qin, E-mail: liqin0518@mail.scuec.edu.cn; Wu, Xiaofeng; Lv, Kangle; Tang, Dingguo; Li, Mei, E-mail: limei@mail.scuec.edu.cn

2017-01-01

Highlights: • CNTs/CaIn{sub 2}S{sub 4} (CIS) composites were prepared by a microwave hydrothermal method. • CNTs were embedded tightly in the hierarchical marigold-like CIS microspheres. • Intimate contact between CNTs and CIS made interfacial charge transfer available. • The composite exhibited obviously higher photocatalytic activity than bare CIS. • The composite was applicable in both environment remediation and energy conversion. - Abstract: In response to the continuous concerns to environmental contamination and energy crisis, visible-light-driven photocatalysis has attracted broad attention for its potential applications in environment remediation and energy conversion. In this study, visible-light-responsive CNTs/CaIn{sub 2}S{sub 4} (CIS) composite photocatalyst was designed and synthesized by a facile one-step microwave hydrothermal method. The effects of CNTs content on the crystallinity, structure, light absorption, specific surface area and photocatalytic performance of CIS semiconductor were systematically studied. The results demonstrated that the prepared composite with a suitable amount of CNTs exhibited an apparently enhanced photocatalytic activity than bare CIS for both X-3B dye degradation and H{sub 2} production under visible-light irradiation. The optimal content of CNTs was found to be 1 wt%. The corresponding apparent rate constants of photocatalytic degradation and H{sub 2}-production rate are about two times as that of bare CaIn{sub 2}S{sub 4} semiconductor. Comprehensive analysis demonstrated that such enhancement was mainly attributed to the strong coupling interface between CNTs and CIS, which largely improved the separation efficiency of photogenerated charge carriers in space. However, excessive CNTs resulted in a decreased photocatalytic activity due to the shield of active sites and absorbed photons on the surface of CIS photocatalyst. This work could shed new light on the design and synthesis of carbon material

Facile one-pot synthesis of CoS_2-MoS_2/CNTs as efficient electrocatalyst for hydrogen evolution reaction

International Nuclear Information System (INIS)

Liu, Yan-Ru; Hu, Wen-Hui; Li, Xiao; Dong, Bin; Shang, Xiao; Han, Guan-Qun; Chai, Yong-Ming; Liu, Yun-Qi; Liu, Chen-Guang

2016-01-01

Highlights: • Ternary hybrid CoS_2-MoS_2/CNTs electrocatalysts have been prepared. • CNTs as support may provide good conductivity and low the agglomeration of MoS_2. • CoS_2 with intrinsic metallic conductivity may enhance the activity for HER. • Ternary CoS_2-MoS_2/CNTs have the better activity and stability for HER. - Abstract: Ternary hybrid cobalt disulfide-molybdenum disulfides supported on carbon nanotubes (CoS_2-MoS_2/CNTs) electrocatalysts have been prepared via a simple hydrothermal method. CNTs as support may provide good conductivity and low the agglomeration of layered MoS_2 structure. CoS_2 with intrinsic metallic conductivity may enhance the activity of the ternary hybrid electrocatalysts for hydrogen evolution reaction (HER). X-ray diffraction (XRD) data confirm the formation of ternary hybrid nanocomposites composed of CNTs, CoS_2 and amorphous MoS_2. Scanning electron microscopy (SEM) images show that strong combination between MoS_2, CNTs and regular orthohexagonal CoS_2 has been obtained. The dispersion of each component is good and no obvious agglomeration can be observed. It is found that compared with CoS_2/CNTs and MoS_2/CNTs, the ternary CoS_2-MoS_2/CNTs have the better activity for HER with a low onset potential of 70 mV (vs. RHE) and a small Talel slope of 67 mV dec"−"1, and are extremely stable after 1000 cycles. In addition, the optimal doping ratio of Co to Mo is 2:1, which have better HER activity. It is proved that the introduction of carbon materials and Co atoms could improve the performances of MoS_2-based electrocatalysts for HER.

Performance characterization of CNTs and γ-Al2O3 supported cobalt catalysts in Fischer-Tropsch reaction

International Nuclear Information System (INIS)

Ali, Sardar; Zabidi, Noor Asmawati Mohd; Subbarao, Duvvuri

2014-01-01

Catalysts were prepared via a wet impregnation method. Different physicochemical properties of the samples were revealed by transmission electron microscope (TEM), temperature programmed reduction (H 2 -TPR) and carbon dioxide desorption (CO 2 -desorption). Fischer-Tropsch reaction (FTS) was carried out in a fixed-bed microreactor at 220°C and 1 atm, with H 2 /CO = 2v/v and space velocity, SV of 12L/g.h for 5 h. Various characterization techniques revealed that there was a stronger interaction between Co and Al 2 O 3 support compared to that of CNTs support. CNTs support increased the reducibility and decreased Co particle size. A significant increase in % CO conversion and FTS reaction rate was observed over CNTs support compared to that of Co/Al 2 O 3 . Co/CNTs resulted in higher C 5+ hydrocarbons selectivity compared to that of Co/Al 2 O 3 catalyst. CNTs are a better support for Co compared to Al 2 O 3

Fast Water Transport in CNTs: length dependence and entrane/exit effects

DEFF Research Database (Denmark)

Walther, Jens Honore; Koumoutsakos, Petros

Superfast water transport in carbon nanotube (CNT) membranes has been reported in experimental studies. We use Molecular Dynamics simulations to elucidate the mechanisms of water entry, exit and transport in 2nm-diameter hydrophobic CNTs embedded in a hydrophilic membrane matrix. We demonstrate......, for the first time, that under imposed pressures of the order of 1 bar, water entry into the CNT cavity and exit from the CNT end, can occur only on pre-wetted membranes. We conduct large scale simulations for up to 500nm long CNTs and observe a previously unseen dependence of the flow enhancement rates...

The precise self-assembly of individual carbon nanotubes using magnetic capturing and fluidic alignment

Energy Technology Data Exchange (ETDEWEB)

Shim, Joon S; Rust, Michael J; Do, Jaephil; Ahn, Chong H [Department of Electrical and Computer Engineering, Microsystems and BioMEMS Laboratory, University of Cincinnati, Cincinnati, OH 45221 (United States); Yun, Yeo-Heung; Schulz, Mark J [Department of Mechanical Engineering, University of Cincinnati, 45221 (United States); Shanov, Vesselin, E-mail: chong.ahn@uc.ed [Department of Chemical and Materials Engineering, University of Cincinnati, 45221 (United States)

2009-08-12

A new method for the self-assembly of a carbon nanotube (CNT) using magnetic capturing and fluidic alignment has been developed and characterized in this work. In this new method, the residual iron (Fe) catalyst positioned at one end of the CNT was utilized as a self-assembly driver to attract and position the CNT, while the assembled CNT was aligned by the shear force induced from the fluid flow through the assembly channel. The self-assembly procedures were successfully developed and the electrical properties of the assembled multi-walled carbon nanotube (MWNT) and single-walled carbon nanotube (SWNT) were fully characterized. The new assembly method developed in this work shows its feasibility for the precise self-assembly of parallel CNTs for electronic devices and nanobiosensors.

Lamellar-crossing-structured Ni(OH){sub 2}/CNTs/Ni(OH){sub 2} nanocomposite for electrochemical supercapacitor materials

Energy Technology Data Exchange (ETDEWEB)

Wu, Qingnan [Department of Chemistry, State Key Laboratory of Pollution Control and Resource Reuse, Tongji University, Shanghai 200092 (China); Wen, Ming, E-mail: m_wen@tongji.edu.cn [Department of Chemistry, State Key Laboratory of Pollution Control and Resource Reuse, Tongji University, Shanghai 200092 (China); Shanghai Key Lab of Chemical Assessment and Sustainability, Tongji University, Shanghai 200092 (China); Chen, Shipei [Department of Chemistry, State Key Laboratory of Pollution Control and Resource Reuse, Tongji University, Shanghai 200092 (China); Wu, Qingsheng [Department of Chemistry, State Key Laboratory of Pollution Control and Resource Reuse, Tongji University, Shanghai 200092 (China); Shanghai Key Lab of Chemical Assessment and Sustainability, Tongji University, Shanghai 200092 (China)

2015-10-15

Ni(OH){sub 2}/CNTs/Ni(OH){sub 2} lamellar-crossing-nanostructure with a single lamellar spacing of ∼5 nm was effectively constructed through two-phase-interface reaction process followed by the CNTs crossed among the lamellar-nanostructured Ni(OH){sub 2}. The resultant nanocomposite can offer large active surface areas and short diffusion paths for electrons and ions, and is investigated as a potential pseudocapacitor electrode material for electrochemical energy storage applications. Electrochemical data demonstrate that the as-prepared nanocomposite exhibits a high specific capacitance of ∼1600 F g{sup −1} at the scan rate of 1 mV s{sup −1} in 6 M KOH solution at normal pressure and temperature, which is great higher than Ni(OH){sub 2} (∼1200 F g{sup −1}). Furthermore, Ni(OH){sub 2}/CNTs/Ni(OH){sub 2} nanocomposite shows a higher energy density (∼125 Wh kg{sup −1}, 2 A g{sup −1}) and has a slightly decrease of 5% in specific capacitance after 1000 continuous charge/discharge cycles. - Graphical abstract: As-constructed Ni(OH){sub 2}/CNTs/Ni(OH){sub 2} lamellar-crossing-nanostructure exhibits remarkable enhancement in electrochemical stability and high specific capacity of ∼1600 F g{sup −1} at a scan rate of 1 mV s{sup −1}, suggesting promising potential for supercapacitor applications. - Highlights: • New designed lamellar-crossing-structured Ni(OH){sub 2}/CNTs/Ni(OH){sub 2} nanocomposites have been firstly reported in this work. • Ni(OH){sub 2}/CNTs/Ni(OH){sub 2} lamellar-crossing-nanostructures show firm nanostructure and excellent electrochemical stability. • Ni(OH){sub 2}/CNTs/Ni(OH){sub 2} nanocomposites exhibit excellent specific capacitance. • Ni(OH){sub 2}/CNTs/Ni(OH){sub 2} nanocomposites have the potential application in electrochemical energy storage applications.

Oxygen-promoted catalyst sintering influences number density, alignment, and wall number of vertically aligned carbon nanotubes.

Science.gov (United States)

Shi, Wenbo; Li, Jinjing; Polsen, Erik S; Oliver, C Ryan; Zhao, Yikun; Meshot, Eric R; Barclay, Michael; Fairbrother, D Howard; Hart, A John; Plata, Desiree L

2017-04-20

A lack of synthetic control and reproducibility during vertically aligned carbon nanotube (CNT) synthesis has stifled many promising applications of organic nanomaterials. Oxygen-containing species are particularly precarious in that they have both beneficial and deleterious effects and are notoriously difficult to control. Here, we demonstrated diatomic oxygen's ability, independent of water, to tune oxide-supported catalyst thin film dewetting and influence nanoscale (diameter and wall number) and macro-scale (alignment and density) properties for as-grown vertically aligned CNTs. In particular, single- or few-walled CNT forests were achieved at very low oxygen loading, with single-to-multi-walled CNT diameters ranging from 4.8 ± 1.3 nm to 6.4 ± 1.1 nm over 0-800 ppm O 2 , and an expected variation in alignment, where both were related to the annealed catalyst morphology. Morphological differences were not the result of subsurface diffusion, but instead occurred via Ostwald ripening under several hundred ppm O 2 , and this effect was mitigated by high H 2 concentrations and not due to water vapor (as confirmed in O 2 -free water addition experiments), supporting the importance of O 2 specifically. Further characterization of the interface between the Fe catalyst and Al 2 O 3 support revealed that either oxygen-deficit metal oxide or oxygen-adsorption on metals could be functional mechanisms for the observed catalyst nanoparticle evolution. Taken as a whole, our results suggest that the impacts of O 2 and H 2 on the catalyst evolution have been underappreciated and underleveraged in CNT synthesis, and these could present a route toward facile manipulation of CNT forest morphology through control of the reactive gaseous atmosphere alone.

Zn-Fe-CNTs catalytic in situ generation of H2O2 for Fenton-like degradation of sulfamethoxazole.

Science.gov (United States)

Liu, Yong; Fan, Qin; Wang, Jianlong

2018-01-15

A novel Fenton-like catalyst (Zn-Fe-CNTs) capable of converting O 2 to H 2 O 2 and further to OH was prepared through infiltration fusion method followed by chemical replacement in argon atmosphere. The catalyst was characterized by SEM, EDS, TEM, XRD and XPS. The reaction between Zn-Fe-CNTs and O 2 in aqueous solution could generate H 2 O 2 in situ, which was further transferred to OH. The Fenton-like degradation of sulfamethoxazole (SMX) using Zn-Fe-CNTs as catalyst was evaluated. The results indicated that Zn-Fe-CNTs had a coral porous structure with a BET area of 51.67m 2 /g, exhibiting excellent adsorption capacity for SMX, which enhanced its degradation. The particles of Zn 0 and Fe 0 /Fe 2 O 3 were observed on the surface of Zn-Fe-CNTs. The mixture of Zn 0 and CNTs could reduce O 2 into H 2 O 2 by micro-electrolysis and Fe 0 /Fe 2 O 3 could catalyze in-situ generation of H 2 O 2 to produce OH through Fenton-like process. When initial pH=1.5, T=25°C, O 2 flow rate=400mL/min, Zn-Fe-CNTs=0.6g/L, SMX=25mg/L and reaction time=10min, the removal efficiency of SMX and TOC was 100% and 51.3%, respectively. The intermediates were detected and the possible pathway of SMX degradation and the mechanism of Zn-Fe-CNTs/O 2 process were tentatively proposed. Copyright © 2017 Elsevier B.V. All rights reserved.

An efficient fabrication of vertically aligned carbon nanotubes on flexible aluminum foils by catalyst-supported chemical vapor deposition

International Nuclear Information System (INIS)

Yoshikawa, Naoki; Kishi, Naoki; Sugai, Toshiki; Shinohara, Hisanori; Asari, Takuma; Hayashi, Shigeo

2008-01-01

An efficient and versatile growth of thin-layer carbon nanotubes on a flexible aluminum foil (for kitchen use) by catalyst-supported chemical vapor deposition is reported. The aluminum foil used in the present experiment is commercially available for kitchen use. The electron-beam vapor deposition and dip-coating have been used for preparing catalysts on the aluminum foil. Vertically aligned thin-layer CNTs with typical diameters of 2.5-6.0 nm and lengths up to 90 μm are obtained when ethanol is used in combination with Fe and Co catalyst particles at a growth temperature of around 650 deg. C under an Ar/H 2 gas flow. Thermo-gravimetric analyses together with HR-TEM observations indicate that the purity of the CNTs synthesized by the current technique is very high

Investigation of H2S separation from H2S/CH4 mixtures using functionalized and non-functionalized vertically aligned carbon nanotube membranes

Science.gov (United States)

Gilani, Neda; Towfighi, Jafar; Rashidi, Alimorad; Mohammadi, Toraj; Omidkhah, Mohammad Reza; Sadeghian, Ahmad

2013-04-01

Separation of H2S from binary mixtures of H2S/CH4 using vertically aligned carbon nanotube membranes fabricated in anodic aluminum oxide (AAO) template was studied experimentally. Carbon nanotubes (CNTs) were grown in five AAO templates with different pore diameters using chemical vapor deposition, and CNT/AAO membranes with tubular carbon nanotube structure and open caps were selected for separation of H2S. For this, two tubular CNT/AAO membranes were fabricated with the CNT inner diameters of 23 and 8 nm. It was found that permeability and selectivity of the membrane with inner diameter of 23 nm for CNT were independent of upstream feed pressure and H2S feed concentration unlike that of CNT having an inner diameter of 8 nm. Selectivity of these membranes for separation of H2S was obtained in the ranges of 1.36-1.58 and 2.11-2.86, for CNTs with internal diameters of 23 and 8 nm, respectively. In order to enhance the separation of H2S from H2S/CH4 mixtures, dodecylamine was used to functionalize the CNT/AAO membrane with higher selectivity. The results showed that for amido-functionalized membrane, both upstream feed pressure and H2S partial pressure in the feed significantly increased H2S permeability, and selectivity for H2S being in the range of 3.0-5.57 respectively.

Fabrication and atomic force microscopy/friction force microscopy (AFM/FFM) studies of polyacrylamide-carbon nanotubes (PAM-CNTs) copolymer thin films

International Nuclear Information System (INIS)

Li Xuefeng; Guan Wenchao; Yan Haibiao; Huang Lan

2004-01-01

A novel polyacrylamide-carbon nanotubes (PAM-CNTs) copolymer has been prepared by ultraviolet radiation initiated polymerization. The PAM-CNTs copolymer was characterized by the instruments of Fourier transform infrared spectroscopy, UV-vis absorbance spectra, fluorescence spectra and transmission electron microscope. The morphology and microtribological properties of PAM-CNTs thin films on mica were investigated by atomic force microscopy/friction force microscopy (AFM/FFM). The friction of the films was stable with the change of applied load and the friction coefficient decreased significantly as the CNTs addition. The results show that the rigid rod-like CNTs in polymer would enhance load-bearing and anti-wear properties of the thin films

Dispersion of Co/CNTs via strong electrostatic adsorption method: Thermal treatment effect

Energy Technology Data Exchange (ETDEWEB)

Akbarzadeh, Omid, E-mail: omid.akbarzadeh63@gmail.com; Abdullah, Bawadi, E-mail: bawadi-abdullah@petronas.com.my; Subbarao, Duvvuri, E-mail: duvvuri-subbarao@petronas.com.my [Department of Chemical Engineering, Universiti Teknologi PETRONAS, Bandar Seri Iskandar, 31750 Tronoh, Perak (Malaysia); Zabidi, Noor Asmawati Mohd, E-mail: noorasmawati-mzabidi@petronas.com.my [Department of Fundamental and Applied Sciences, Universiti Teknologi PETRONAS, Bandar Seri Iskandar, 31750 Tronoh, Perak (Malaysia)

2015-07-22

The effect of different thermal treatment temperature on the structure of multi-walled carbon nanotubes (MWCNTs) and Co particle dispersion on CNTs support is studied using Strong electrostatic adsorption (SEA) method. The samples tested by N{sub 2}-adsorption, field emission scanning electron microscopy (FE-SEM) and transmission electron microscopy (TEM). N{sub 2}-adsorption results showed BET surface area increased using thermal treatment and TEM images showed that increasing the thermal treatment temperature lead to flaky CNTs and defects introduced on the outer surface and Co particle dispersion increased.

Electrical and Raman spectroscopic studies of vertically aligned multi-walled carbon nanotubes.

Science.gov (United States)

Mathur, Ashish; Tweedie, Mark; Roy, Susanta Sinha; Maguire, P D; McLaughlin, James A

2009-07-01

Microwave plasma enhanced chemical vapour deposition (MPECVD) was used for the production of carbon nanotubes. Vertically aligned multi-walled carbon nanotubes (MWCNTs) were grown on silicon substrates coated with cobalt thin films of thickness ranging from 0.5 nm to 3 nm. Prior to the nanotube growth the catalyst were treated with N2 plasma for 5-10 minutes that break the films into small nanoparticles which favour the growth of nanotubes. The CNTs were grown at a substrate temperature of 700 degrees C for 5, 10 and 15 minutes. The height of the CNT films ranging from 10 microm-30 microm indicating that the initial growth rate of the CNTs are very high at a rate of approximately 100 nm/sec. Electrical resistivity of the above samples was evaluated from I-V measurements. The activation energy (E(a)) was also calculated from the temperature dependent studies and it was found that the E(a) lies in the range of 15-35 meV. Raman spectroscopy was used to identify the quality of the nanotubes.

Preparation and characterisation of core-shell CNTs@MIPs nanocomposites and selective removal of estrone from water samples.

Science.gov (United States)

Gao, Ruixia; Su, Xiaoqian; He, Xiwen; Chen, Langxing; Zhang, Yukui

2011-01-15

This paper reports the preparation of carbon nanotubes (CNTs) functionalized with molecularly imprinted polymers (MIPs) for advanced removal of estrone. CNTs@Est-MIPs nanocomposites with a well-defined core-shell structure were obtained using a semi-covalent imprinting strategy, which employed a thermally reversible covalent bond at the surface of silica-coated CNTs for a large-scale production. The morphology and structure of the products were characterised by transmission electron microscopy and Fourier transform infrared spectroscopy. The adsorption properties were demonstrated by equilibrium rebinding experiments and Scatchard analysis. The results demonstrate that the imprinted nanocomposites possess favourable selectivity, high capacity and fast kinetics for template molecule uptake, yielding an adsorption capacity of 113.5 μmol/g. The synthetic process is quite simple, and the different batches of synthesized CNTs@Est-MIPs nanocomposites showed good reproducibility in template binding. The feasibility of removing estrogenic compounds from environmental water using the CNTs@Est-MIPs nanocomposites was demonstrated using water samples spiked with estrone. Copyright © 2010 Elsevier B.V. All rights reserved.

Adsorption of methyl orange by synthesized and functionalized-CNTs with 3-aminopropyltriethoxysilane loaded TiO2 nanocomposites.

Science.gov (United States)

Ahmad, Amirah; Razali, Mohd Hasmizam; Mamat, Mazidah; Mehamod, Faizatul Shimal Binti; Anuar Mat Amin, Khairul

2017-02-01

This study aims to develop a highly efficient adsorbent material. CNTs are prepared using a chemical vapor deposition method with acetylene and synthesized mesoporous Ni-MCM41 as the carbon source and catalyst, respectively, and are then functionalized using 3-aminopropyltriethoxysilane (APTES) through the co-condensation method and loaded with commercial TiO 2 . Results of X-ray powder diffraction (XRD), Raman spectra, and Fourier transform infrared spectroscopy (FTIR) confirm that the synthesized CNTs grown are multi-walled carbon nanotubes (MWNTs). Transmission electron microscopy shows good dispersion of TiO 2 nanoparticles onto functionalized-CNTs loaded TiO 2 , with the diameter of a hair-like structure measuring between 3 and 8 nm. The functionalized-CNTs loaded TiO 2 are tested as an adsorbent for removal of methyl orange (MO) in aqueous solution, and results show that 94% of MO is removed after 10 min of reaction, and 100% after 30 min. The adsorption kinetic model of functionalized-CNTs loaded TiO 2 follows a pseudo-second order with a maximum adsorption capacity of 42.85 mg/g. This study shows that functionalized-CNTs loaded TiO 2 has considerable potential as an adsorbent material due to the short adsorption time required to achieve equilibrium. Copyright © 2016 Elsevier Ltd. All rights reserved.

Spinning, structure and properties of PP/CNTs and PP/carbon black composite fibers

Science.gov (United States)

Marcincin, A.; Hricova, M.; Ujhelyiova, A.

2014-08-01

In this paper, the effect of the compatibilisers-dispersants and other nanofillers on melt spinning of the polypropylene (PP) composites, containing carbon nanotubes (CNTs), and carbon black pigment (CBP) has been investigated. Further, the structure and selected properties of composite fibers, such as mechanical and electrical have been studied. The results revealed, that percolation threshold for PP/CBP composite fibres was situated within the concentration of 15 - 20 wt%, what is several times higher than for PP/CNTs fibers.

Synthesis of three-dimensional rare-earth ions doped CNTs-GO-Fe3O4 hybrid structures using one-pot hydrothermal method

International Nuclear Information System (INIS)

Gao, Guo; Zhang, Qiang; Cheng, Xin-Bing; Sun, Rongjin; Shapter, Joseph G.; Yin, Ting; Cui, Daxiang

2015-01-01

Rechargeable lithium ion batteries (LIBs) are currently the dominant power source for all sorts of electronic devices due to their low cost and high energy density. The cycling stability of LIBs is significantly compromised due to the broad satellite peak for many anode materials. Herein, we develop a facile hydrothermal process for preparing rare-earth (Er, Tm) ions doped three-dimensional (3D) transition metal oxides/carbon hybrid nanocomposites, namely CNTs-GO-Fe 3 O 4 , CNTs-GO-Fe 3 O 4 -Er and CNTs-GO-Fe 3 O 4 -Tm. The GO sheets and CNTs are interlinked by ultrafine Fe 3 O 4 nanoparticles forming three-dimensional (3D) architectures. When evaluated as anode materials for LIBs, the CNTs-GO-Fe 3 O 4 hybrid composites have a bigger broad satellite peak. As for the CNTs-GO-Fe 3 O 4 -Er and CNTs-GO-Fe 3 O 4 -Tm hybrid composites, the broad satellite peak can be completely eliminated. When the current density changes from 5 C back to 0.1 C, the capacity of CNTs-GO-Fe 3 O 4 -Tm hybrid composites can recover to 1023.9 mAhg −1 , indicating an acceptable rate capability. EIS tests show that the charge transfer resistance does not change significantly after 500 cycles, demonstrating that the cycling stability of CNTs-GO-Fe 3 O 4 -Tm hybrid composites are superior to CNTs-GO-Fe 3 O 4 and CNTs-GO-Fe 3 O 4 -Er hybrid structures. - Graphical abstract: One-pot hydrothermal method for synthesis of rare-earth ions doped CNTs-GO-Fe 3 O 4 hybrid structures as anode materials of LIBs have been reported. - Highlights: • We report the synthesis of rare-earth ions doped CNTs-GO-Fe 3 O 4 hybrid structures. • The hybrid structures can improve the cycling stability of lithium storage. • As for anode materials, the broad satellite peak can be completely eliminated. • When the rate return back to 0.1 C, the capacity can recover to 1023.9 mAhg −1 . • After 500 cycles, the hybrid structures still exhibited excellent cycling stability

Alignment-Annotator web server: rendering and annotating sequence alignments.

Science.gov (United States)

Gille, Christoph; Fähling, Michael; Weyand, Birgit; Wieland, Thomas; Gille, Andreas

2014-07-01

Alignment-Annotator is a novel web service designed to generate interactive views of annotated nucleotide and amino acid sequence alignments (i) de novo and (ii) embedded in other software. All computations are performed at server side. Interactivity is implemented in HTML5, a language native to web browsers. The alignment is initially displayed using default settings and can be modified with the graphical user interfaces. For example, individual sequences can be reordered or deleted using drag and drop, amino acid color code schemes can be applied and annotations can be added. Annotations can be made manually or imported (BioDAS servers, the UniProt, the Catalytic Site Atlas and the PDB). Some edits take immediate effect while others require server interaction and may take a few seconds to execute. The final alignment document can be downloaded as a zip-archive containing the HTML files. Because of the use of HTML the resulting interactive alignment can be viewed on any platform including Windows, Mac OS X, Linux, Android and iOS in any standard web browser. Importantly, no plugins nor Java are required and therefore Alignment-Anotator represents the first interactive browser-based alignment visualization. http://www.bioinformatics.org/strap/aa/ and http://strap.charite.de/aa/. © The Author(s) 2014. Published by Oxford University Press on behalf of Nucleic Acids Research.

Effect of iron catalyst thickness on vertically aligned carbon nanotube forest straightness for CNT-MEMS

International Nuclear Information System (INIS)

Moulton, Kellen; Jensen, Brian D; Morrill, Nicholas B; Konneker, Adam M; Vanfleet, Richard R; Allred, David D; Davis, Robert C

2012-01-01

This paper examines the effect of iron catalyst thickness on the straightness of growth of carbon nanotubes (CNTs) for microelectromechanical systems fabricated using the CNT-templated-microfabrication (CNT-M) process. SEM images of samples grown using various iron catalyst thicknesses show that both straight sidewalls and good edge definition are achieved using an iron thickness between 7 and 8 nm. Below this thickness, individual CNTs are well aligned, but the sidewalls of CNT forests formed into posts and long walls are not always straight. Above this thickness, the CNT forest sidewalls are relatively straight, but edge definition is poor, with significantly increased sidewall roughness. The proximity of a device or feature to other regions of iron catalyst also affects CNT growth. By using an iron catalyst thickness appropriate for straight growth, and by adding borders of iron around features or devices, a designer can greatly improve straightness of growth for CNT-MEMS. (paper)

Density controlled carbon nanotube array electrodes

Science.gov (United States)

Ren, Zhifeng F [Newton, MA; Tu, Yi [Belmont, MA

2008-12-16

CNT materials comprising aligned carbon nanotubes (CNTs) with pre-determined site densities, catalyst substrate materials for obtaining them and methods for forming aligned CNTs with controllable densities on such catalyst substrate materials are described. The fabrication of films comprising site-density controlled vertically aligned CNT arrays of the invention with variable field emission characteristics, whereby the field emission properties of the films are controlled by independently varying the length of CNTs in the aligned array within the film or by independently varying inter-tubule spacing of the CNTs within the array (site density) are disclosed. The fabrication of microelectrode arrays (MEAs) formed utilizing the carbon nanotube material of the invention is also described.

Type II band alignment in Ge1-x-ySixSny/Ge1-α-βSiαSnβ heterojunctions

Science.gov (United States)

Dey, Swagata; Mukhopadhyay, Bratati; Sen, Gopa; Basu, P. K.

2018-02-01

We have examined type II band alignment in Ge1-x-ySixSny/Ge1-α-βSiαSβ heterojunctions grown on virtual substrates in Si platform. It is found that, for different values of x, y, α and β, direct band gap type II band line up can be achieved for both tensile and compressive strains. The calculated band gap energy corresponds to the mid infrared to far infrared regions in the electromagnetic spectrum.

Modeling and experimental study of resistive switching in vertically aligned carbon nanotubes

Science.gov (United States)

Ageev, O. A.; Blinov, Yu F.; Ilina, M. V.; Ilin, O. I.; Smirnov, V. A.

2016-08-01

Model of the resistive switching in vertically aligned carbon nanotube (VA CNT) taking into account the processes of deformation, polarization and piezoelectric charge accumulation have been developed. Origin of hysteresis in VA CNT-based structure is described. Based on modeling results the VACNTs-based structure has been created. The ration resistance of high-resistance to low-resistance states of the VACNTs-based structure amounts 48. The correlation the modeling results with experimental studies is shown. The results can be used in the development nanoelectronics devices based on VA CNTs, including the nonvolatile resistive random-access memory.

Modeling and experimental study of resistive switching in vertically aligned carbon nanotubes

International Nuclear Information System (INIS)

Ageev, O A; Blinov, Yu F; Ilina, M V; Ilin, O I; Smirnov, V A

2016-01-01

Model of the resistive switching in vertically aligned carbon nanotube (VA CNT) taking into account the processes of deformation, polarization and piezoelectric charge accumulation have been developed. Origin of hysteresis in VA CNT-based structure is described. Based on modeling results the VACNTs-based structure has been created. The ration resistance of high-resistance to low-resistance states of the VACNTs-based structure amounts 48. The correlation the modeling results with experimental studies is shown. The results can be used in the development nanoelectronics devices based on VA CNTs, including the nonvolatile resistive random-access memory. (paper)

A Phase-Separation Route to Synthesize Porous CNTs with Excellent Stability for Na+ Storage.

Science.gov (United States)

Chen, Zhi; Wang, Taihong; Zhang, Ming; Cao, Guozhong

2017-06-01

Porous carbon nanotubes (CNTs) are obtained by removing MoO 2 nanoparticles from MoO 2 @C core@shell nanofibers which are synthesized by phase-segregation via a single-needle electrospinning method. The specific surface area of porous CNTs is 502.9 m 2 g -1 , and many oxygen-containing functional groups (COH, CO) are present. As anodes for sodium-ion batteries, the porous CNT electrode displays excellent rate performance and cycling stability (110 mA h g -1 after 1200 cycles at 5 A g -1 ). Those high properties can be attributed to the porous structure and surface modification to steadily store Na + with high capacity. The work provides a facile and broadly applicable way to fabricate the porous CNTs and their composites for batteries, catalysts, and fuel cells. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Facile one-pot synthesis of CoS{sub 2}-MoS{sub 2}/CNTs as efficient electrocatalyst for hydrogen evolution reaction

Energy Technology Data Exchange (ETDEWEB)

Liu, Yan-Ru; Hu, Wen-Hui; Li, Xiao [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); Dong, Bin, E-mail: dongbin@upc.edu.cn [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); College of Science, China University of Petroleum (East China), Qingdao 266580 (China); Shang, Xiao [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); Han, Guan-Qun [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); College of Science, China University of Petroleum (East China), Qingdao 266580 (China); Chai, Yong-Ming [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); Liu, Yun-Qi, E-mail: liuyq@upc.edu.cn [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); Liu, Chen-Guang [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China)

2016-10-30

Highlights: • Ternary hybrid CoS{sub 2}-MoS{sub 2}/CNTs electrocatalysts have been prepared. • CNTs as support may provide good conductivity and low the agglomeration of MoS{sub 2}. • CoS{sub 2} with intrinsic metallic conductivity may enhance the activity for HER. • Ternary CoS{sub 2}-MoS{sub 2}/CNTs have the better activity and stability for HER. - Abstract: Ternary hybrid cobalt disulfide-molybdenum disulfides supported on carbon nanotubes (CoS{sub 2}-MoS{sub 2}/CNTs) electrocatalysts have been prepared via a simple hydrothermal method. CNTs as support may provide good conductivity and low the agglomeration of layered MoS{sub 2} structure. CoS{sub 2} with intrinsic metallic conductivity may enhance the activity of the ternary hybrid electrocatalysts for hydrogen evolution reaction (HER). X-ray diffraction (XRD) data confirm the formation of ternary hybrid nanocomposites composed of CNTs, CoS{sub 2} and amorphous MoS{sub 2}. Scanning electron microscopy (SEM) images show that strong combination between MoS{sub 2}, CNTs and regular orthohexagonal CoS{sub 2} has been obtained. The dispersion of each component is good and no obvious agglomeration can be observed. It is found that compared with CoS{sub 2}/CNTs and MoS{sub 2}/CNTs, the ternary CoS{sub 2}-MoS{sub 2}/CNTs have the better activity for HER with a low onset potential of 70 mV (vs. RHE) and a small Talel slope of 67 mV dec{sup −1}, and are extremely stable after 1000 cycles. In addition, the optimal doping ratio of Co to Mo is 2:1, which have better HER activity. It is proved that the introduction of carbon materials and Co atoms could improve the performances of MoS{sub 2}-based electrocatalysts for HER.

LLUVIA-II: A program for two-dimensional, transient flow through partially saturated porous media

International Nuclear Information System (INIS)

Eaton, R.R.; Hopkins, P.L.

1992-08-01

LLUVIA-II is a program designed for the efficient solution of two- dimensional transient flow of liquid water through partially saturated, porous media. The code solves Richards equation using the method-of-lines procedure. This document describes the solution procedure employed, input data structure, output, and code verification

Growth of Cu2O on Ga-doped ZnO and their interface energy alignment for thin film solar cells

International Nuclear Information System (INIS)

Wong, L. M.; Chiam, S. Y.; Wang, S. J.; Pan, J. S.; Huang, J. Q.; Chim, W. K.

2010-01-01

Cu 2 O thin films are deposited by direct current reactive magnetron sputtering on borofloat glass and indium tin oxide (ITO) coated glass at room temperature. The effect of oxygen partial pressure on the structures and properties of Cu 2 O thin films are investigated. We show that oxygen partial pressure is a crucial parameter in achieving pure phases of CuO and Cu 2 O. Based on this finding, we fabricate heterojunctions of p-type Cu 2 O with n-type gallium doped ZnO (GZO) on ITO coated glass substrates by pulsed laser deposition for GZO thin films. The energy band alignment for thin films of Cu 2 O/GZO on ITO glass is characterized using high-resolution x-ray photoelectron spectroscopy. The energy band alignment for the Cu 2 O/GZO heterojunctions is determined to be type II with a valence band offset of 2.82 eV and shows negligible effects of variation with gallium doping. The higher conduction band of the Cu 2 O relative to that of GZO in the obtained band alignment shows that the heterojunctions are suitable for solar cell application based on energy levels consideration.

Facile synthesis of hybrid CNTs/NiCo2S4 composite for high performance supercapacitors

Science.gov (United States)

Li, Delong; Gong, Youning; Pan, Chunxu

2016-07-01

In this work, a novel carbon nanotubes (CNTs)/NiCo2S4 composite for high performance supercapacitors was prepared via a simple chemical bath deposition combined with a post-anion exchange reaction. The morphologies and phase structures of the composites were characterized using scanning electron microscopy (SEM), X-ray diffraction (XRD), Raman spectroscopy (Raman), X-ray photoelectron spectroscopy (XPS) and low-temperature sorption of nitrogen (BET). The electro-chemical tests revealed that the CNT/NiCo2S4 composite exhibited high electrochemical performance, because the CNTs were used as a conductive network for the NiCo2S4 hexagonal nanoplates. Compared with pure NiCo2S4 and the mechanically mixed CNTs/NiCo2S4 composite, the CNTs/NiCo2S4 composite electrode material exhibited excellent supercapacitive performance, such as a high specific capacitance up to 1537 F/g (discharge current density of 1 A/g) and an outstanding rate capability of 78.1% retention as the discharge current density increased to 100 A/g. It is therefore expected to be a promising alternative material in the area of energy storage.

Facile synthesis of hybrid CNTs/NiCo2S4 composite for high performance supercapacitors.

Science.gov (United States)

Li, Delong; Gong, Youning; Pan, Chunxu

2016-07-11

In this work, a novel carbon nanotubes (CNTs)/NiCo2S4 composite for high performance supercapacitors was prepared via a simple chemical bath deposition combined with a post-anion exchange reaction. The morphologies and phase structures of the composites were characterized using scanning electron microscopy (SEM), X-ray diffraction (XRD), Raman spectroscopy (Raman), X-ray photoelectron spectroscopy (XPS) and low-temperature sorption of nitrogen (BET). The electro-chemical tests revealed that the CNT/NiCo2S4 composite exhibited high electrochemical performance, because the CNTs were used as a conductive network for the NiCo2S4 hexagonal nanoplates. Compared with pure NiCo2S4 and the mechanically mixed CNTs/NiCo2S4 composite, the CNTs/NiCo2S4 composite electrode material exhibited excellent supercapacitive performance, such as a high specific capacitance up to 1537 F/g (discharge current density of 1 A/g) and an outstanding rate capability of 78.1% retention as the discharge current density increased to 100 A/g. It is therefore expected to be a promising alternative material in the area of energy storage.

Interweaved Si@C/CNTs and CNFs composites as anode materials for Li-ion batteries

Energy Technology Data Exchange (ETDEWEB)

Zhang, Miao [School of Physics and Telecommunication Engineering, South China Normal University, Guangzhou 510006 (China); Hou, Xianhua, E-mail: houxh@scnu.edu.cn [School of Physics and Telecommunication Engineering, South China Normal University, Guangzhou 510006 (China); Engineering Research Center of Materials and Technology for Electrochemical Energy Storage Ministry of Education, Guangzhou 510006 (China); Wang, Jie; Li, Min [School of Physics and Telecommunication Engineering, South China Normal University, Guangzhou 510006 (China); Hu, Shejun [School of Physics and Telecommunication Engineering, South China Normal University, Guangzhou 510006 (China); Engineering Research Center of Materials and Technology for Electrochemical Energy Storage Ministry of Education, Guangzhou 510006 (China); Shao, Zongping [Nanjing University of Technology, College of Chemistry and Chemical Engineering, Nanjing 210009 (China); Liu, Xiang [Institute of Advanced Materials, Nanjing University of Technology, Nanjing 210009 (China)

2014-03-05

Graphical abstract: In summary, a serious of high-energy wet ball milling, closed spray drying and subsequent chemical vapor deposition methods were introduced successfully to fabricated novel Si@C/CNTs and CNFs composites with carbon nanotubes and carbon nanofibres interweaved with carbon coated silicon spherical composites as superior anodes in lithium-ion batteries. The core-shell structure of Si@C composites can accommodate the volume change of electrode during charge and discharge. Meanwhile, the citric acid pyrolyzed carbon was coated on the surface of the silicon perfectly and constructs the connection network of nano silicon particles. Moreover, the carbon nanotubes and carbon nanofibres, which is interweaved with nano-silicon, also allows high electrical conductivity, improved solid–electrolyte interface formation and structural integrity. Compared with pure silicon and Si@C composites, the novel Si@C/CNTs and CNFs composites had the best combination of reversible capacity and cycleablity, and this anode materials exhibited excellent electrochemical performance. The Si/C composite had a fairly high initial discharge capacity of 2168.7 mA h g{sup −1} with an efficiency of 73%, and the discharge capacity of the 50th cycle maintained surprisingly of 1194.9 mA h g{sup −1}. Meanwhile, spray drying and chemical vapor deposition are environmentally friendly, economical, and relatively high-yield method for the production of the Si@C/CNTs and CNFs composites in large quantities. Consequently, the novel Si@C/CNTs and CNFs composite electrodes may be a potential alternative to graphite for high energy density lithium ion batteries. Highlights: • The core/shell structured silicon/carbon composites were prepared by a facile way. • The as-prepared Si@C/CNTs and CNFs composites shows excellent electrochemical performance. • The preparation method has mild experiment conditions and high production rate. • The structure benefited electronic transfer and

Enhanced hydrogen storage properties of MgH2 co-catalyzed with K2NiF6 and CNTs.

Science.gov (United States)

Sulaiman, N N; Ismail, M

2016-12-06

The composite of MgH 2 /K 2 NiF 6 /carbon nanotubes (CNTs) is prepared by ball milling, and its hydrogenation properties are studied for the first time. MgH 2 co-catalyzed with K 2 NiF 6 and CNTs exhibited an improvement in the onset dehydrogenation temperature and isothermal de/rehydrogenation kinetics compared with the MgH 2 -K 2 NiF 6 composite. The onset dehydrogenation temperature of MgH 2 doped with 10 wt% K 2 NiF 6 and 5 wt% CNTs is 245 °C, which demonstrated a reduction of 25 °C compared with the MgH 2 + 10 wt% K 2 NiF 6 composite. In terms of rehydrogenation kinetics, MgH 2 doped with 10 wt% K 2 NiF 6 and 5 wt% CNTs samples absorbed 3.4 wt% of hydrogen in 1 min at 320 °C, whereas the MgH 2 + 10 wt% K 2 NiF 6 sample absorbed 2.6 wt% of hydrogen under the same conditions. For dehydrogenation kinetics at 320 °C, the MgH 2 + 10 wt% K 2 NiF 6 + 5 wt% CNTs sample released 3.3 wt% hydrogen after 5 min of dehydrogenation. By contrast, MgH 2 doped with 10 wt% K 2 NiF 6 released 3.0 wt% hydrogen in the same time period. The apparent activation energy, E a , for the dehydrogenation of MgH 2 doped with 10 wt% K 2 NiF 6 reduced from 100.0 kJ mol -1 to 70.0 kJ mol -1 after MgH 2 was co-doped with 10 wt% K 2 NiF 6 and 5 wt% CNTs. Based on the experimental results, the hydrogen storage properties of the MgH 2 /K 2 NiF 6 /CNTs composite is enhanced because of the catalytic effects of the active species of KF, KH and Mg 2 Ni that are formed in situ during dehydrogenation, as well as the unique structure of CNTs.

In vivo biodistribution of CNTs using a BALB/c mouse experimental model.

Science.gov (United States)

Fufă, Mariana Oana Mihaela; Mihaiescu, Dan Eduard; Mogoantă, Laurenţiu; Bălşeanu, Tudor Adrian; Mogoşanu, George Dan; Grumezescu, Alexandru Mihai; Bolocan, Alexandra

2015-01-01

Due to their unique behaviors, carbon nanotubes (CNTs)-based systems meet essential requirements for modern applications, such as electronics, optics, photovoltaics, fuel cells, aerospace engineering, military and biomedical applications. CNTs biocompatibility and toxic effects were assessed both in vitro and in vivo, in terms of hemocompatibility, cytocompatibility, immunoreactions and genetic behavior. The aim of this paper is to evaluate the in vivo biodistribution and biocompatibility of carbon nanopowder synthesized by plasma processing, using a BALB/c mouse experimental model. Three months old BALB/c mice were aseptically injected with 100 μL of 1 mg/mL dispersions. The obtained carbon-based nano-systems were dispersed in saline solution and subsequently sterilized by using a 30 minutes treatment with UV irradiation. The reference mice were injected with 100 μL of saline. The mice were kept under standard conditions of light, temperature, humidity, food and water (ad libitum) before the vital organ harvest. The animal welfare was daily monitored. At two and 10 days after the inoculation, the animals were euthanized under general anesthesia, for the sampling of internal organs (brain, myocardium, pancreas, liver, lung, kidney and spleen). No animal died during the experiment. Brain, myocardium and pancreas were histologically normal, with no tissue damage, inflammatory infiltrate or inorganic deposits. CNTs were evidenced only in hepatic, renal, pulmonary and spleen tissue samples. Increased amounts of inorganic granular structures were reported after 10 days of treatment, when compared to the short-term (two days) inoculation. Our BALB/c mouse experimental model was found to be useful for the in vivo assessment of biodistribution and biocompatibility of CNTs.

Femtosecond laser modification of an array of vertically aligned carbon nanotubes intercalated with Fe phase nanoparticles.

Science.gov (United States)

Labunov, Vladimir; Prudnikava, Alena; Bushuk, Serguei; Filatov, Serguei; Shulitski, Boris; Tay, Beng Kang; Shaman, Yury; Basaev, Alexander

2013-09-03

Femtosecond lasers (FSL) are playing an increasingly important role in materials research, characterization, and modification. Due to an extremely short pulse width, interactions of FSL irradiation with solid surfaces attract special interest, and a number of unusual phenomena resulted in the formation of new materials are expected. Here, we report on a new nanostructure observed after the interaction of FSL irradiation with arrays of vertically aligned carbon nanotubes (CNTs) intercalated with iron phase catalyst nanoparticles. It was revealed that the FSL laser ablation transforms the topmost layer of CNT array into iron phase nanospheres (40 to 680 nm in diameter) located at the tip of the CNT bundles of conical shape. Besides, the smaller nanospheres (10 to 30 nm in diameter) are found to be beaded at the sides of these bundles. Some of the larger nanospheres are encapsulated into carbon shells, which sometime are found to contain CNTs. The mechanism of creation of such nanostructures is proposed.

Prediction of energy absorption characteristics of aligned carbon nanotube/epoxy nanocomposites

International Nuclear Information System (INIS)

Weidt, D; Figiel, Ł; Buggy, M

2012-01-01

This research aims ultimately at improving the impact performance of laminates by applying a coating of epoxy containing carbon nanotubes (CNTs). Here, 2D and 3D computational modelling was carried out to predict energy absorption characteristics of aligned CNT/epoxy nanocomposites subjected to macroscopic compression under different strain rates (quasi-static and impact rates). The influence of the rate-dependent matrix behaviour, CNT aspect ratio and CNT volume fraction on the energy absorption characteristics of the nanocomposites was evaluated. A strong correlation between those parameters was found, which provides an insight into a rate-dependent behaviour of the nanocomposites, and can help to tune their energy absorption characteristics.

Evidence of Type-II Band Alignment in III-nitride Semiconductors: Experimental and theoretical investigation for In0.17Al0.83N/GaN heterostructures

Science.gov (United States)

Wang, Jiaming; Xu, Fujun; Zhang, Xia; An, Wei; Li, Xin-Zheng; Song, Jie; Ge, Weikun; Tian, Guangshan; Lu, Jing; Wang, Xinqiang; Tang, Ning; Yang, Zhijian; Li, Wei; Wang, Weiying; Jin, Peng; Chen, Yonghai; Shen, Bo

2014-01-01

Type-II band alignment structure is coveted in the design of photovoltaic devices and detectors, since it is beneficial for the transport of photogenerated carriers. Regrettably, for group-III-nitride wide bandgap semiconductors, all existing devices are limited to type-I heterostructures, owing to the unavailable of type-II ones. This seriously restricts the designing flexibility for optoelectronic devices and consequently the relevant performance of this material system. Here we show a brandnew type-II band alignment of the lattice-matched In0.17Al0.83N/GaN heterostructure from the perspective of both experimental observations and first-principle theoretical calculations. The band discontinuity is dominated by the conduction band offset ΔEC, with a small contribution from the valence band offset ΔEV which equals 0.1 eV (with being above). Our work may open up new prospects to realize high-performance III-Nitrides optoelectronic devices based on type-II energy band engineering. PMID:25283334

Synthesis and characterization of self-bridged silver vanadium oxide/CNTs composite and its enhanced lithium storage performance.

Science.gov (United States)

Liang, Liying; Liu, Haimei; Yang, Wensheng

2013-02-07

The improvement of the electrochemical properties of electrode materials with large capacity and good capacity retention is becoming an important task in the field of lithium ion batteries (LIBs). We designed a function-oriented hybrid material consisting of silver vanadium oxide (β-AgVO(3)) nanowires modified with uniform Ag nanoparticles and multi-walled carbon nanotubes (CNTs) as a high-performance cathode material for LIBs. The Ag nanoparticles which precipitated automatically in the synthetic process act as a bridge between the β-AgVO(3) nanowires and CNTs, creating a self-bridged network structure. The Ag particles at the junction of the nanowires and CNTs facilitate electron transport from the CNTs to the nanowires, and thereby improve the electrical conductivity of the β-AgVO(3) nanowires and the composite. Moreover, the self-bridged network is hierarchically porous with a high surface area. When used as a cathode material, this composite electrode reveals high discharge capacities, excellent rate capability, and good cycling stability. The improved performance of the composite arises from its unique nanosized β-AgVO(3) nanowires with short diffusion pathway for lithium ions, efficient electron collection and transfer in the presence of Ag nanoparticles, together with excellent electrical conductivity of CNTs.

Ternary CNTs@TiO₂/CoO Nanotube Composites: Improved Anode Materials for High Performance Lithium Ion Batteries.

Science.gov (United States)

Madian, Mahmoud; Ummethala, Raghunandan; Naga, Ahmed Osama Abo El; Ismail, Nahla; Rümmeli, Mark Hermann; Eychmüller, Alexander; Giebeler, Lars

2017-06-20

TiO₂ nanotubes (NTs) synthesized by electrochemical anodization are discussed as very promising anodes for lithium ion batteries, owing to their high structural stability, high surface area, safety, and low production cost. However, their poor electronic conductivity and low Li⁺ ion diffusivity are the main drawbacks that prevent them from achieving high electrochemical performance. Herein, we report the fabrication of a novel ternary carbon nanotubes (CNTs)@TiO₂/CoO nanotubes composite by a two-step synthesis method. The preparation includes an initial anodic fabrication of well-ordered TiO₂/CoO NTs from a Ti-Co alloy, followed by growing of CNTs horizontally on the top of the oxide films using a simple spray pyrolysis technique. The unique 1D structure of such a hybrid nanostructure with the inclusion of CNTs demonstrates significantly enhanced areal capacity and rate performances compared to pure TiO₂ and TiO₂/CoO NTs, without CNTs tested under identical conditions. The findings reveal that CNTs provide a highly conductive network that improves Li⁺ ion diffusivity, promoting a strongly favored lithium insertion into the TiO₂/CoO NT framework, and hence resulting in high capacity and an extremely reproducible high rate capability.

Separation of methane-nitrogen mixtures using synthesis vertically aligned carbon nanotube membranes

Science.gov (United States)

Gilani, Neda; Daryan, Jafar Towfighi; Rashidi, Alimorad; Omidkhah, Mohammad Reza

2012-03-01

In this paper, capabilities of carbon nanotube (CNT) membranes fabricated in cylindrical pores of anodic aluminum oxide (AAO) substrate to separate the binary mixtures of CH4/N2 are studied experimentally. For this purpose, the permeability and selectivity of three CNT/AAO membranes with different growth time as 6 h, 12 h and 18 h are investigated. CNTs are grown vertically through holes of AAO with average pore diameter of 45 nm by chemical vapor deposition (CVD) of acetylene gas. CNT/AAO membranes with the same CNTs' outer diameters and different inner diameters are synthesized. The AAO are characterized by SEM analysis. In addition, SEM, TEM, BET N2 adsorption analysis and Raman spectroscopy are employed to characterize aligned CNTs. Study on permeability and selectivity of membranes for three binary mixtures of CH4/N2 showed that when the CNT inner diameters are 34 nm and 24 nm, viscous flow is the governing mechanism and insignificant selectivities of 1.2-1.24 are achieved. However, the membrane with CNT inner diameter and wall thickness of 8 nm and 16 nm respectively is considerably selective for CH4 over N2. It was also found that CH4 mole fraction in the feed and upstream feed pressure have major effect on permeability and selectivity. The membrane with 18 h synthesis time showed the selectivity is in the range of 1.8-3.85. The enhancement factor for N2 single gas diffusivity was also found to be about three times larger than that predicted by Knudsen diffusion model.

Using precipitated Cr on the surface of Cu-Cr alloy powders as catalyst synthesizing CNTs/Cu composite powders by water-assisted CVD

Science.gov (United States)

Zhou, Honglei; Liu, Ping; Chen, Xiaohong; Bi, Liming; Zhang, Ke; Liu, Xinkuan; Li, Wei; Ma, Fengcang

2018-02-01

Given that the conventional catalyst is easily soluble in the matrix to result in the poor performance of the CNTs/Cu composite materials, the Cr nano-particles precipitated on the surface of Cu-Cr particles are first used as catalysts to prepare the CNTs/Cu composite powders by means of water-assisted chemical vapor deposition in situ synthesis. The results show that the morphological difference of the precipitated Cr nano-particle is obvious with the change of solution and aging treatment, and the morphology, length and diameter of the synthetic CNTs are also different. The catalyst of Cr nano-particle has the best morphology and the synthesized CNTs had a good wettability with Cu particles when the Cu-Cr composite powders was solution-treated at 1023 K for 60 min and then was aged at 723 K for 120 min. The length, diameter, yield and purity of the synthesized CNTs can be also affected by the moisture content in the reaction gas. It is the most suitable for the growth of CNTs when the moisture content is 0.4%, and the high purity and defect-free CNTs with the smooth pipe wall, a diameter of 20 ˜ 30 nm and a length of up to 1800 nm can be obtained. The yield of CNTs with the moisture content of 0.4% reached to 138%, which was increased by 119% to compare with that without moisture. In this paper, a feasible technology was offered for the preparation of high performance CNTs/Cu composites.

Facile method for the synthesis of a magnetic CNTs-C@Fe-chitosan composite and its application in tetracycline removal from aqueous solutions.

Science.gov (United States)

Ma, Jie; Zhuang, Yuan; Yu, Fei

2015-06-28

A magnetic CNTs-C@Fe-chitosan composite (CNTs-C@Fe-CS) was prepared based on as-prepared carbon nanotubes (APCNTs). The metal nanoparticles in APCNTs could be utilized directly without any purification treatment, and the carbon shells provide an effective barrier against oxidation, acid dissolution, and movement of the MNPs, thus ensuring the long-term stability of CNTs-C@Fe-CS. The results showed that CNTs-C@Fe-CS contained more abundant oxygen and nitrogen containing functional groups after chitosan modification and the composite had good magnetization characteristics, even in acidic solutions. Then CNTs-C@Fe-CS was used as an adsorbent for the removal of tetracycline from aqueous solutions. Adsorption experiments indicated that CNTs-C@Fe-CS have a good adsorption capacity (qe) of tetracycline (104 mg g(-1)). The Freundlich isotherm model fitted the experimental data better than the Langmuir isotherm model. Kinetic regression results showed that the adsorption kinetics was more accurately represented by a pseudo second-order model. Intra-particle diffusion was involved in the adsorption, but it was not the only rate-controlling step. Cu(2+) and humic acid could promote the adsorption of tetracycline on CNTs-C@Fe-CS. The CNTs-C@Fe-CS adsorbents could be effectively and quickly separated by applying an external magnetic field and the adsorption capacity was still maintained at 99.3 mg g(-1) after being used 10 times. Therefore, CNTs-C@Fe-CS is a promising magnetic nanomaterial for preconcentration and separation of organic pollutants for environmental remediation.

Mechanism of H2O-Induced Conductance Changes in AuCl4-Functionalized CNTs

KAUST Repository

Murat, Altynbek

2015-04-30

We employ ab initio self-interaction corrected density functional theory combined with the nonequilibrium Green\\'s function method to study the electronic and quantum transport properties of carbon nanotubes (CNTs) functionalized with AuCl4 molecules. In particular, we investigate the electronic structure and characterize the conductance for different concentrations and configurations of randomly distributed AuCl4 molecules with and without the adsorption of H2O. We thus propose a mechanism that explains the origin of the recently observed resistivity changes of AuCl4-functionalized CNTs upon H2O adsorption. We find that water adsorption shifts the highest occupied Cl and Au states down in energy and thereby reduces the scattering of the electrons around the Fermi energy, hence enhancing the conductivity. Our results help in the development of highly sensitive nanoscale H2O vapor sensors based on AuCl4-functionalized CNTs. © 2015 American Chemical Society.

Performance characterization of CNTs and γ-Al{sub 2}O{sub 3} supported cobalt catalysts in Fischer-Tropsch reaction

Energy Technology Data Exchange (ETDEWEB)

Ali, Sardar, E-mail: alikhan-635@yahoo.com [Centralized Analytical Laboratory, Universiti Teknologi PETRONAS, Bandar Seri Iskandar, 31750 Tronoh, Perak (Malaysia); Zabidi, Noor Asmawati Mohd, E-mail: noorasmawati-mzabidi@petronas.com.my [Department of Fundamental and Applied Sciences, Universiti Teknologi PETRONAS, Bandar Seri Iskandar, 31750 Tronoh, Perak (Malaysia); Subbarao, Duvvuri, E-mail: duvvuri-subbarao@petronas.com.my [Department of Chemical Engineering, Universiti Teknologi PETRONAS, Bandar Seri Iskandar, 31750 Tronoh, Perak (Malaysia)

2014-10-24

Catalysts were prepared via a wet impregnation method. Different physicochemical properties of the samples were revealed by transmission electron microscope (TEM), temperature programmed reduction (H{sub 2}-TPR) and carbon dioxide desorption (CO{sub 2}-desorption). Fischer-Tropsch reaction (FTS) was carried out in a fixed-bed microreactor at 220°C and 1 atm, with H{sub 2}/CO = 2v/v and space velocity, SV of 12L/g.h for 5 h. Various characterization techniques revealed that there was a stronger interaction between Co and Al{sub 2}O{sub 3} support compared to that of CNTs support. CNTs support increased the reducibility and decreased Co particle size. A significant increase in % CO conversion and FTS reaction rate was observed over CNTs support compared to that of Co/Al{sub 2}O{sub 3}. Co/CNTs resulted in higher C{sub 5+} hydrocarbons selectivity compared to that of Co/Al{sub 2}O{sub 3} catalyst. CNTs are a better support for Co compared to Al{sub 2}O{sub 3}.

The effect of CNTs on structures and catalytic properties of AuPd clusters for H2O2 synthesis.

Science.gov (United States)

Yang, Hua-feng; Xie, Peng-yang; Yu, Hui-you; Li, Xiao-nian; Wang, Jian-guo

2012-12-28

The structures and catalytic properties of AuPd clusters supported on carbon nanotubes (CNTs) for H(2)O(2) synthesis have been investigated by means of density functional theory calculations. Firstly, the structures of AuPd clusters are strongly influenced by CNTs, in which the bottom layers are mainly composed of Pd and the top layers are a mix of Au and Pd due to the stronger binding of Pd than Au on CNTs. Especially, it is found that O(2) adsorption on the Pd/CNTs interfacial sites is much weaker than that on the only Pd sites, which is in contrast to transition metal oxide (for example TiO(2), Al(2)O(3), CeO(2)) supported metal clusters. Furthermore, Pd ensembles on the interfacial sites have far superior catalytic properties for H(2)O(2) formation than those away from CNT supports due to the changes in electronic structures caused by the CNTs. Therefore, our study provides a physical insight into the enhanced role of carbon supports in H(2)O(2) synthesis over supported AuPd catalysts.

Synthesis of Vertically Aligned Carbon Nanotubes on Silicalite-1 Monolayer-Supported Substrate

Directory of Open Access Journals (Sweden)

Wei Zhao

2014-01-01

Full Text Available Monodisperse magnetic Fe3O4 nanoparticles (NPs with the size of ca. 3.5 nm were prepared and used as the catalysts for the synthesis of vertically aligned carbon nanotube (VACNT arrays. A silicalite-1 microcrystal monolayer was used as the support layer between catalyst NPs and the silicon substrate. Compared to our previous report which used radio-frequency- (rf- sputtered Fe2O3 film as the catalyst, Fe3O4 NPs that were synthesized by wet chemical method showed an improved catalytic ability with less agglomeration. The silicalite-1 crystal monolayer acted as an effective “buffer” layer to prevent the catalyst NPs from agglomerating during the reaction process. It is believed that this is the first report that realizes the vertical alignment of CNTs over the zeolite monolayer, namely, silicalite-1 microcrystal monolayer, instead of using the intermediate anodic aluminum oxide (AAO scaffold to regulate the growth direction of CNT products.

Synthesis and Characterization of Self-Standing and Highly Flexible δ-MnO2@CNTs/CNTs Composite Films for Direct Use of Supercapacitor Electrodes.

Science.gov (United States)

Wu, Peng; Cheng, Shuang; Yang, Lufeng; Lin, Zhiqiang; Gui, Xuchun; Ou, Xing; Zhou, Jun; Yao, Minghai; Wang, Mengkun; Zhu, Yuanyuan; Liu, Meilin

2016-09-14

Self-standing and flexible films worked as pseudocapacitor electrodes have been fabricated via a simple vacuum-filtration procedure to stack δ-MnO2@carbon nanotubes (CNTs) composite layer and pure CNT layer one by one with CNT layers ended. The lightweight CNTs layers served as both current collector and supporter, while the MnO2@CNTs composite layers with birnessite-type MnO2 worked as active layer and made the main contribution to the capacitance. At a low discharge current of 0.2 A g(-1), the layered films displayed a high areal capacitance of 0.293 F cm(-2) with a mass of 1.97 mg cm(-2) (specific capacitance of 149 F g(-1)) and thickness of only 16.5 μm, and hence an volumetric capacitance of about 177.5 F cm(-3). Moreover, the films also exhibited a good rate capability (only about 15% fading for the capacitance when the discharge current increased to 5 A g(-1) from 0.2 A g(-1)), outstanding cycling stability (about 90% of the initial capacitance was remained after 5,000 cycles) and high flexibility (almost no performance change when bended to different angles). In addition, the capacitance of the films increased proportionally with the stacked layers and the geometry area. E.g., when the stacked layers were three times many with a mass of 6.18 mg cm(-2), the areal capacitance of the films was increased to 0.764 F cm(-2) at 0.5 A g(-1), indicating a high electronic conductivity. It is not overstated to say that the flexible and lightweight layered films emerged high potential for future practical applications as supercapacitor electrodes.

Oxygen reduction reaction of (C-PCTNB@CNTs): A nitrogen and phosphorus dual-doped carbon electro-catalyst derived from polyphosphazenes

Science.gov (United States)

Dar, Sami Ullah; Ud Din, Muhammad Aizaz; Hameed, Muhammad Usman; Ali, Shafqat; Akram, Raheel; Wu, Zhanpeng; Wu, Dezhen

2018-01-01

This research describes the synthesis of a novel type of poly [cyclotriphosphazene-co-1,3,5-triol nitrobenzene] (PCTNB) microspheres with uniform size and diameter of more than 2 μm having well characterization. These microspheres are further used to wrap the CNTs by a facile route using template based non-covalent method to form PCTNB@CNTs composite. This composite is further well analyzed before it is subjected to pyrolysis. The direct carbonization of the PCTNB@CNTs is performed at 600 °C at a rate of 5 °C/min under N2 atmosphere to render the N, P, O doped carbonized PCTNB@CNTs having enhanced electronic features to be applied as an ORR electrocatalysts in fuel cells accompanied by TEM, XPS, Raman, FT-IR, TGA and BET analyses. Here, we have designed a metal-free, N, P, O doped (C-PCTNB@CNTs) electro-catalyst which exhibit significantly high ORR performance in acidic PEM cells showing much higher onset potential of (0.94 V) and half-wave potential of (0.85 V) with electron transfer number (n) 3.9 at 0.4-0.7 V as compared to other non-metallic electro-catalysts. Thus, (C-PCTNB@CNTs) is a metal-free, methanol tolerant carbon-based ORR catalyst, and it opens up new avenues for clean energy generation for affordable and durable fuel cells.

Synthesis of CNTs/CuO and its catalytic performance on the thermal decomposition of ammonium perchlorate

Directory of Open Access Journals (Sweden)

Ping Cui

2016-05-01

Full Text Available Copper oxide (CuO nanoparticles were successfully deposited on carbon nanotubes’ (CNTs surface via complex-precipitation method, the nanocomposite was characterized by transmission electron microscopy (TEM, scanning electron microscopy (SEM, X-ray photoelectron spectroscopy (XPS, X-ray powder diffraction (XRD, Raman spectroscopy, Fourier transform infrared (FT-IR and Brunauer–Emmett–Teller (BET. The catalytic performance of CNTs/CuO on ammonium perchlorate (AP decomposition was analyzed by differential thermal analyzer (DTA, the DTA results showed its excellent catalytic effect on AP decomposition, as 8 wt.% CNTs/CuO was added in AP, the second exothermic peak temperature decreased by 158 °C. Such composite may be a promising candidate for catalyzing the AP thermal decomposition.

Effect of the addition CNTs on performance of CaP/chitosan/coating deposited on magnesium alloy by electrophoretic deposition

Energy Technology Data Exchange (ETDEWEB)

Zhang, Jie [Department of Neuro Intern, First Affiliated Hospital of Harbin Medical University, Harbin 150001 (China); Pharmaceutical Research Institute in Heilongjiang Province, Jiamusi University, Jiamusi 154007 (China); Wen, Zhaohui, E-mail: wenzhaohui1968@163.com [Department of Neuro Intern, First Affiliated Hospital of Harbin Medical University, Harbin 150001 (China); Zhao, Meng [Department of Neuro Intern, First Affiliated Hospital of Harbin Medical University, Harbin 150001 (China); Li, Guozhong, E-mail: hydlgz1962@163.com [Department of Neuro Intern, First Affiliated Hospital of Harbin Medical University, Harbin 150001 (China); Dai, Changsong, E-mail: changsd@hit.edu.cn [School of Chemistry Engineering and Technology, Harbin Institute of Technology, Harbin 150001 (China)

2016-01-01

CaP/chitosan/carbon nanotubes (CNTs) coating on AZ91D magnesium alloy was prepared via electrophoretic deposition (EPD) followed by conversion in a phosphate buffer solution (PBS). The bonding between the layer and the substrate was studied by an automatic scratch instrument. The phase compositions and microstructures of the composite coatings were determined by using X-ray diffraction (XRD), Fourier-transformed infrared spectroscopy (FTIR), Raman spectroscopy and scanning electron microscope (SEM). The element concentration and gentamicin concentration were respectively determined by inductively coupled plasma optical emission spectrometer (ICP-OES) test and ultraviolet spectrophotometer (UV). The cell counting kit (CCK) assay was used to evaluate the cytotoxicity of samples to SaOS-2 cells. The results showed that a few CNTs with their original tubular morphology could be found in the CaP/chitosan coating and they were beneficial for the crystal growth of phosphate and improvement of the coating bonding when the addition amount of CNTs in 500 ml of electrophoretic solution was from 0.05 g to 0.125 g. The loading amount of gentamicin increased and the releasing speed of gentamicin decreased after CNTs was added into the CaP/chitosan coating for immersion loading and EPD loading. The cell viability of Mg based CaP/chitosan/CNTs was higher than that of Mg based CaP/chitosan from 16 days to 90 days. - Highlights: • CaP/chitosan/CNTs coating on AZ91D was prepared. • The addition of CNTs could improve the performance of CaP/chitosan coating. • A new method of loading gentamicin by EPD was proposed.

Synthesis and characterization of a novel tube-in-tube nanostructured PPy/MnO2/CNTs composite for supercapacitor

International Nuclear Information System (INIS)

Li, Juan; Que, Tingli; Huang, Jianbin

2013-01-01

Graphical abstract: A novel tube-in-tube nanostructured PPy/MnO 2 /CNTs composite have been successfully fabricated. Its inner tubules are CNTs and the outer tubules are template-synthesized PPy. Most MnO 2 nanoparticles are sandwiched between the inner and outer wall, some relatively large particles are also latched onto the outside wall of the PPy tube. The composite yields a good electrochemical reversibility through 1000 cycles’ cyclic voltammogram (CV) test and galvanostatic charge–discharge experiments at different current densities. Display Omitted Highlights: ► We fabricate a ternary organic–inorganic complex of PPy/MnO 2 /CNTs composite. ► We characterize its morphological structures and properties by several techniques. ► The composite possesses the typical tube-in-tube nanostructures. ► Most MnO 2 nanoparticles are sandwiched between the inner CNTs and outer PPy wall. ► The composite has good electrochemical reversibility for supercapacitor. -- Abstract: Ternary organic–inorganic complex of polypyrrole/manganese dioxide/carbon nanotubes (PPy/MnO 2 /CNTs) composite was prepared by in situ chemical oxidation polymerization of pyrrole in the host of inorganic matrix of MnO 2 and CNTs, using complex of methyl orange (MO)/FeCl 3 was used as a reactive self-degraded soft-template. The morphological structures of the composite were characterized by scanning electron microscopy (SEM), transmission electron microscopy (TEM), high-resolution transmission electron microscopic (HRTEM), Fourier transform infrared spectroscopy (FT-IR) and X-ray diffraction (XRD), respectively. All the results indicate that the PPy/MnO 2 /CNTs composite possesses the typical tube-in-tube nanostructures: the inner tubules are CNTs and the outer tubules are template-synthesized PPy. MnO 2 nanoparticles may either sandwich the space between the inner and outer tubules or directly latch onto the wall of the PPy tubes. The composite yields a good electrochemical

Progressive multiple sequence alignments from triplets

Directory of Open Access Journals (Sweden)

Stadler Peter F

2007-07-01

Full Text Available Abstract Background The quality of progressive sequence alignments strongly depends on the accuracy of the individual pairwise alignment steps since gaps that are introduced at one step cannot be removed at later aggregation steps. Adjacent insertions and deletions necessarily appear in arbitrary order in pairwise alignments and hence form an unavoidable source of errors. Research Here we present a modified variant of progressive sequence alignments that addresses both issues. Instead of pairwise alignments we use exact dynamic programming to align sequence or profile triples. This avoids a large fractions of the ambiguities arising in pairwise alignments. In the subsequent aggregation steps we follow the logic of the Neighbor-Net algorithm, which constructs a phylogenetic network by step-wisely replacing triples by pairs instead of combining pairs to singletons. To this end the three-way alignments are subdivided into two partial alignments, at which stage all-gap columns are naturally removed. This alleviates the "once a gap, always a gap" problem of progressive alignment procedures. Conclusion The three-way Neighbor-Net based alignment program aln3nn is shown to compare favorably on both protein sequences and nucleic acids sequences to other progressive alignment tools. In the latter case one easily can include scoring terms that consider secondary structure features. Overall, the quality of resulting alignments in general exceeds that of clustalw or other multiple alignments tools even though our software does not included heuristics for context dependent (mismatch scores.

Synthesis of three-dimensional rare-earth ions doped CNTs-GO-Fe{sub 3}O{sub 4} hybrid structures using one-pot hydrothermal method

Energy Technology Data Exchange (ETDEWEB)

Gao, Guo, E-mail: guogao@sjtu.edu.cn [Institute of Nano Biomedicine and Engineering, Department of Instrument Science and Technology, Key Laboratory for Thin Film and Microfabrication Technology of Ministry of Education, School of Electronic Information and Electrical Engineering, Shanghai Jiao Tong University, Shanghai 200240 (China); Zhang, Qiang; Cheng, Xin-Bing [Beijing Key Laboratory of Green Chemical Reaction Engineering and Technology, Department of Chemical Engineering, Tsinghua University, Beijing 100084 (China); Sun, Rongjin [Institute of Nano Biomedicine and Engineering, Department of Instrument Science and Technology, Key Laboratory for Thin Film and Microfabrication Technology of Ministry of Education, School of Electronic Information and Electrical Engineering, Shanghai Jiao Tong University, Shanghai 200240 (China); Shapter, Joseph G., E-mail: joe.shapter@flinders.edu.au [School of Chemical and Physical Sciences, Flinders University, Bedford Park, Adelaide 5042 (Australia); Yin, Ting [Institute of Nano Biomedicine and Engineering, Department of Instrument Science and Technology, Key Laboratory for Thin Film and Microfabrication Technology of Ministry of Education, School of Electronic Information and Electrical Engineering, Shanghai Jiao Tong University, Shanghai 200240 (China); Cui, Daxiang, E-mail: dxcui@sjtu.edu.cn [Institute of Nano Biomedicine and Engineering, Department of Instrument Science and Technology, Key Laboratory for Thin Film and Microfabrication Technology of Ministry of Education, School of Electronic Information and Electrical Engineering, Shanghai Jiao Tong University, Shanghai 200240 (China)

2015-11-15

Rechargeable lithium ion batteries (LIBs) are currently the dominant power source for all sorts of electronic devices due to their low cost and high energy density. The cycling stability of LIBs is significantly compromised due to the broad satellite peak for many anode materials. Herein, we develop a facile hydrothermal process for preparing rare-earth (Er, Tm) ions doped three-dimensional (3D) transition metal oxides/carbon hybrid nanocomposites, namely CNTs-GO-Fe{sub 3}O{sub 4}, CNTs-GO-Fe{sub 3}O{sub 4}-Er and CNTs-GO-Fe{sub 3}O{sub 4}-Tm. The GO sheets and CNTs are interlinked by ultrafine Fe{sub 3}O{sub 4} nanoparticles forming three-dimensional (3D) architectures. When evaluated as anode materials for LIBs, the CNTs-GO-Fe{sub 3}O{sub 4} hybrid composites have a bigger broad satellite peak. As for the CNTs-GO-Fe{sub 3}O{sub 4}-Er and CNTs-GO-Fe{sub 3}O{sub 4}-Tm hybrid composites, the broad satellite peak can be completely eliminated. When the current density changes from 5 C back to 0.1 C, the capacity of CNTs-GO-Fe{sub 3}O{sub 4}-Tm hybrid composites can recover to 1023.9 mAhg{sup −1}, indicating an acceptable rate capability. EIS tests show that the charge transfer resistance does not change significantly after 500 cycles, demonstrating that the cycling stability of CNTs-GO-Fe{sub 3}O{sub 4}-Tm hybrid composites are superior to CNTs-GO-Fe{sub 3}O{sub 4} and CNTs-GO-Fe{sub 3}O{sub 4}-Er hybrid structures. - Graphical abstract: One-pot hydrothermal method for synthesis of rare-earth ions doped CNTs-GO-Fe{sub 3}O{sub 4} hybrid structures as anode materials of LIBs have been reported. - Highlights: • We report the synthesis of rare-earth ions doped CNTs-GO-Fe{sub 3}O{sub 4} hybrid structures. • The hybrid structures can improve the cycling stability of lithium storage. • As for anode materials, the broad satellite peak can be completely eliminated. • When the rate return back to 0.1 C, the capacity can recover to 1023.9 mAhg{sup −1}. • After 500

Ternary CNTs@TiO2/CoO Nanotube Composites: Improved Anode Materials for High Performance Lithium Ion Batteries

Science.gov (United States)

Madian, Mahmoud; Ummethala, Raghunandan; Abo El Naga, Ahmed Osama; Ismail, Nahla; Rümmeli, Mark Hermann; Eychmüller, Alexander; Giebeler, Lars

2017-01-01

TiO2 nanotubes (NTs) synthesized by electrochemical anodization are discussed as very promising anodes for lithium ion batteries, owing to their high structural stability, high surface area, safety, and low production cost. However, their poor electronic conductivity and low Li+ ion diffusivity are the main drawbacks that prevent them from achieving high electrochemical performance. Herein, we report the fabrication of a novel ternary carbon nanotubes (CNTs)@TiO2/CoO nanotubes composite by a two-step synthesis method. The preparation includes an initial anodic fabrication of well-ordered TiO2/CoO NTs from a Ti-Co alloy, followed by growing of CNTs horizontally on the top of the oxide films using a simple spray pyrolysis technique. The unique 1D structure of such a hybrid nanostructure with the inclusion of CNTs demonstrates significantly enhanced areal capacity and rate performances compared to pure TiO2 and TiO2/CoO NTs, without CNTs tested under identical conditions. The findings reveal that CNTs provide a highly conductive network that improves Li+ ion diffusivity, promoting a strongly favored lithium insertion into the TiO2/CoO NT framework, and hence resulting in high capacity and an extremely reproducible high rate capability. PMID:28773032

Ternary CNTs@TiO2/CoO Nanotube Composites: Improved Anode Materials for High Performance Lithium Ion Batteries

Directory of Open Access Journals (Sweden)

Mahmoud Madian

2017-06-01

Full Text Available TiO2 nanotubes (NTs synthesized by electrochemical anodization are discussed as very promising anodes for lithium ion batteries, owing to their high structural stability, high surface area, safety, and low production cost. However, their poor electronic conductivity and low Li+ ion diffusivity are the main drawbacks that prevent them from achieving high electrochemical performance. Herein, we report the fabrication of a novel ternary carbon nanotubes (CNTs@TiO2/CoO nanotubes composite by a two-step synthesis method. The preparation includes an initial anodic fabrication of well-ordered TiO2/CoO NTs from a Ti-Co alloy, followed by growing of CNTs horizontally on the top of the oxide films using a simple spray pyrolysis technique. The unique 1D structure of such a hybrid nanostructure with the inclusion of CNTs demonstrates significantly enhanced areal capacity and rate performances compared to pure TiO2 and TiO2/CoO NTs, without CNTs tested under identical conditions. The findings reveal that CNTs provide a highly conductive network that improves Li+ ion diffusivity, promoting a strongly favored lithium insertion into the TiO2/CoO NT framework, and hence resulting in high capacity and an extremely reproducible high rate capability.

Ultrasonographic Evaluation of Zone II Partial Flexor Tendon Lacerations of the Fingers: A Cadaveric Study.

Science.gov (United States)

Kazmers, Nikolas H; Gordon, Joshua A; Buterbaugh, Kristen L; Bozentka, David J; Steinberg, David R; Khoury, Viviane

2018-04-01

Accurate assessment of zone II partial flexor tendon lacerations in the finger is clinically important. Surgical repair is recommended for lacerations of greater than 50% to 60%. Our goal was to evaluate ultrasonographic test characteristics and accuracy in identifying partial flexor tendon lacerations in a cadaveric model. From fresh-frozen above-elbow human cadaveric specimens, 32 flexor digitorum profundus tendons were randomly selected to remain intact or receive low- or high-grade lacerations involving 10% to 40% and 60% to 90% of the radioulnar width within Verdan Zone II, respectively. Static and dynamic ultrasonography using a linear array 14-MHz transducer was performed by a blinded musculoskeletal radiologist. Sensitivities, specificities, and other standard test performance metrics were calculated. Actual and measured percentages of tendon laceration were compared by the paired t test. After randomization, 24 tendons were lacerated (12 low- and 12 high-grade), whereas 8 remained intact. The sensitivity and specificity in detecting the presence versus absence of a partial laceration were 0.54 and 0.75, respectively, with positive and negative likelihood ratio values of 2.17 and 0.61. For low-grade lacerations, the sensitivity and specificity were 0.25 and 0.85, compared to 0.83 and 0.85 for high-grade lacerations. Ultrasonography underestimated the percentage of tendon involvement by a mean of 18.1% for the study population as a whole (95% confidence interval, 9.0% to 27.2%; P partial flexor digitorum profundus lacerations in a cadaveric model. © 2017 by the American Institute of Ultrasound in Medicine.

Facile Synthesis of Coaxial CNTs/MnOx-Carbon Hybrid Nanofibers and Their Greatly Enhanced Lithium Storage Performance.

Science.gov (United States)

Yang, Zunxian; Lv, Jun; Pang, Haidong; Yan, Wenhuan; Qian, Kun; Guo, Tailiang; Guo, Zaiping

2015-12-01

Carbon nanotubes (CNTs)/MnOx-Carbon hybrid nanofibers have been successfully synthesized by the combination of a liquid chemical redox reaction (LCRR) and a subsequent carbonization heat treatment. The nanostructures exhibit a unique one-dimensional core/shell architecture, with one-dimensional CNTs encapsulated inside and a MnOx-carbon composite nanoparticle layer on the outside. The particular porous characteristics with many meso/micro holes/pores, the highly conductive one-dimensional CNT core, as well as the encapsulating carbon matrix on the outside of the MnOx nanoparticles, lead to excellent electrochemical performance of the electrode. The CNTs/MnOx-Carbon hybrid nanofibers exhibit a high initial reversible capacity of 762.9 mAhg(-1), a high reversible specific capacity of 560.5 mAhg(-1) after 100 cycles, and excellent cycling stability and rate capability, with specific capacity of 396.2 mAhg(-1) when cycled at the current density of 1000 mAg(-1), indicating that the CNTs/MnOx-Carbon hybrid nanofibers are a promising anode candidate for Li-ion batteries.

Growth of CNTs on Fe-Si catalyst prepared on Si and Al coated Si substrates

International Nuclear Information System (INIS)

Teng, F-Y; Ting, J-M; Sharma, Sahendra P; Liao, Kun-Hou

2008-01-01

In this paper we report the effect of Al interlayers on the growth characteristics of carbon nanotubes (CNTs) using as-deposited and plasma etched Fe-Si catalyst films as the catalysts. Al interlayers having various thicknesses ranging from 2 to 42 nm were deposited on Si substrates prior to the deposition of Fe-Si catalysts. It was found that the Al interlayer diffuses into the Fe-Si catalyst during the plasma etching prior to the CNT growth, leading to the swelling and amorphization of the catalyst. This allows enhanced carbon diffusion in the catalyst and therefore a faster growth rate of the resulting CNTs. It was also found that use of an Al interlayer having a thickness of ∼3 ± 1 nm is most effective. Due to the effectiveness of this, the normally required catalyst etching is no longer needed for the growth of CNTs

Growth of CNTs on Fe-Si catalyst prepared on Si and Al coated Si substrates.

Science.gov (United States)

Teng, F-Y; Ting, Jyh-Ming; Sharma, Sahendra P; Liao, Kun-Hou

2008-03-05

In this paper we report the effect of Al interlayers on the growth characteristics of carbon nanotubes (CNTs) using as-deposited and plasma etched Fe-Si catalyst films as the catalysts. Al interlayers having various thicknesses ranging from 2 to 42 nm were deposited on Si substrates prior to the deposition of Fe-Si catalysts. It was found that the Al interlayer diffuses into the Fe-Si catalyst during the plasma etching prior to the CNT growth, leading to the swelling and amorphization of the catalyst. This allows enhanced carbon diffusion in the catalyst and therefore a faster growth rate of the resulting CNTs. It was also found that use of an Al interlayer having a thickness of ∼3 ± 1 nm is most effective. Due to the effectiveness of this, the normally required catalyst etching is no longer needed for the growth of CNTs.

Unveiling the Role of CNTs on the Phase Formation of 1D Ferroelectrics

KAUST Repository

Mahajan, Amit

2015-05-21

Carbon nanotubes (CNTs) have the potential to act as templates or bottom electrodes for three dimension (3D) capacitor arrays, which utilise one dimension (1D) ferroelectric nanostructures to increase memory size and density. However, growing a ferroelectric on the surface of CNTs is non-trivial. Here, we demonstrate that multi-walled (MW) CNTs decrease the time and temperature for formation of lead zirconium titanate Pb(Zr1-xTix)O3 (PZT) by ~100 ºC commensurate with a decrease in activation energy from 68±15 kJ/mol to 27±2 kJ/mol. As a consequence, monophasic PZT was obtained at 575 ºC for MWCNTs/PZT whereas for pure PZT traces of pyrochlore were still present at 650 ºC, where PZT phase formed due to homogeneous nucleation. The piezoelectric nature of MWCNT/PZT synthesised at 500 ºC for 1 h was proved. Although further work is required to prove the concept of 3D capacitor arrays, our result suggests that it is feasible to utilise MWCNTs as templates/electrodes for the formation of 1D PZT nano ferroelectrics.

Exploring aligned-carbon-nanotubes@polyaniline arrays on household Al as supercapacitors.

Science.gov (United States)

Huang, Fan; Lou, Fengliu; Chen, De

2012-05-01

Herein, we demonstrate a new approach towards the construction of supercapacitors consisting of carbon nanotubes (CNTs) and conducting polymers (ECPs) with high specific power, high specific energy, and stable cycling performance through a 3D design of a thin film of polyaniline (PANI) on an aligned small carbon nanotube (ACNT) array on household Al foils. The thin-film strategy is used to fully exploit the specific capacitance of PANI, and obtain regular pores, strong interaction between PANI and CNTs, and reduced electrical resistance for the electrodes. A facile process is developed to fabricate a highly flexible supercapacitor using this binder-free composite on household Al foil as the current collector. It exhibits high specific energy of 18.9 Wh kg(-1) , high maximum specific power of 11.3 kW kg(-1) of the active material in an aqueous electrolyte at 1.0 A g(-1) , and excellent rate performance and cycling stability. A high specific energy of 72.4 Wh kg(-1) , a high maximum specific power of 24.9 kW kg(-1) , and a good cycling performance of the active material are obtained in an organic electrolyte. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Mass Transport Through Carbon Nanotube-Polystyrene Bundles

Science.gov (United States)

Lin, Rongzhou; Tran, Tuan

2016-05-01

Carbon nanotubes have been widely used as test channels to study nanofluidic transport, which has been found to have distinctive properties compared to transport of fluids in macroscopic channels. A long-standing challenge in the study of mass transport through carbon nanotubes (CNTs) is the determination of flow enhancement. Various experimental investigations have been conducted to measure the flow rate through CNTs, mainly based on either vertically aligned CNT membranes or individual CNTs. Here, we proposed an alternative approach that can be used to quantify the mass transport through CNTs. This is a simple method relying on the use of carbon nanotube-polystyrene bundles, which are made of CNTs pulled out from a vertically aligned CNT array and glued together by polystyrene. We experimentally showed by using fluorescent tagging that the composite bundles allowed measureable and selective mass transport through CNTs. This type of composite bundle may be useful in various CNT research areas as they are simple to fabricate, less likely to form macroscopic cracks, and offer a high density of CNT pores while maintaining the aligned morphology of CNTs.

Enhanced activity of Pt/CNTs anode catalyst for direct methanol fuel cells using Ni2P as co-catalyst

Science.gov (United States)

Li, Xiang; Luo, Lanping; Peng, Feng; Wang, Hongjuan; Yu, Hao

2018-03-01

The direct methanol fuel cell is a promising energy conversion device because of the utilization of the state-of-the-art platinum (Pt) anode catalyst. In this work, novel Pt/Ni2P/CNTs catalysts were prepared by the H2 reduction method. It was found that the activity and stability of Pt for methanol oxidation reaction (MOR) could be significantly enhanced while using nickel phosphide (Ni2P) nanoparticles as co-catalyst. X-ray photoelectron spectroscopy revealed that the existence of Ni2P affected the particle size and electronic distribution of Pt obviously. Pt/CNTs catalyst, Pt/Ni2P/CNTs catalysts with different Ni2P amount were synthesized, among which Pt/6%Ni2P/CNTs catalyst exhibited the best MOR activity of 1400 mAmg-1Pt, which was almost 2.5 times of the commercial Pt/C-JM catalyst. Moreover, compared to other Pt-based catalysts, this novel Pt/Ni2P/CNTs catalyst also exhibited higher onset current density and better steady current density. The result of this work may provide positive guidance to the research on high efficiency and stability of Pt-based catalyst for direct methanol fuel cells.

On the Growth and Microstructure of Carbon Nanotubes Grown by Thermal Chemical Vapor Deposition

Directory of Open Access Journals (Sweden)

Handuja Sangeeta

2010-01-01

Full Text Available Abstract Carbon nanotubes (CNTs were deposited on various substrates namely untreated silicon and quartz, Fe-deposited silicon and quartz, HF-treated silicon, silicon nitride-deposited silicon, copper foil, and stainless steel mesh using thermal chemical vapor deposition technique. The optimum parameters for the growth and the microstructure of the synthesized CNTs on these substrates are described. The results show that the growth of CNTs is strongly influenced by the substrate used. Vertically aligned multi-walled CNTs were found on quartz, Fe-deposited silicon and quartz, untreated silicon, and on silicon nitride-deposited silicon substrates. On the other hand, spaghetti-type growth was observed on stainless steel mesh, and no CNT growth was observed on HF-treated silicon and copper. Silicon nitride-deposited silicon substrate proved to be a promising substrate for long vertically aligned CNTs of length 110–130 μm. We present a possible growth mechanism for vertically aligned and spaghetti-type growth of CNTs based on these results.

Composites Based on Core-Shell Structured HBCuPc@CNTs-Fe3O4 and Polyarylene Ether Nitriles with Excellent Dielectric and Mechanical Properties

Science.gov (United States)

Pu, Zejun; Zhong, Jiachun; Liu, Xiaobo

2017-10-01

Core-shell structured magnetic carbon nanotubes (CNTs-Fe3O4) coated with hyperbranched copper phthalocyanine (HBCuPc) (HBCuPc@CNTs-Fe3O4) hybrids were prepared by the solvent-thermal method. The results indicated that the HBCuPc molecules were decorated on the surface of CNTs-Fe3O4 through coordination behavior of phthalocyanines, and the CNTs-Fe3O4 core was completely coaxial wrapped by a functional intermediate HBCuPc shell. Then, polymer-based composites with a relatively high dielectric constant and low dielectric loss were fabricated by using core-shell structured HBCuPc@CNTs-Fe3O4 hybrids as fillers and polyarylene ether nitriles (PEN) as the polymer matrix. The cross-sectional scanning electron microscopy (SEM) images of composites showed that there is almost no agglomeration and internal delamination. In addition, the rheological analysis reveals that the core-shell structured HBCuPc@CNTs-Fe3O4 hybrids present better dispersion and stronger interface adhesion with the PEN matrix than CNTs-Fe3O4, thus resulting in significant improvement of the mechanical, thermal and dielectric properties of polymer-based composites.

Uniform implantation of CNTs on total activated carbon surfaces: a smart engineering protocol for commercial supercapacitor applications.

Science.gov (United States)

Jiang, Jian; Li, Linpo; Liu, Yani; Liu, Siyuan; Xu, Maowen; Zhu, Jianhui

2017-04-07

The main obstacles to building better supercapacitors are still trade-offs between energy and power parameters. To promote commercial supercapacitor behaviors, proper optimization toward electrode configurations/architectures may be a feasible and effective way. We herein propose a smart and reliable electrode engineering protocol, by in situ implantation of carbon nanotubes (CNTs) on total activated carbon (AC) surfaces via a mild chemical vapor deposition process at ∼550 °C, using nickel nitrate hydroxide (NNH) thin films and waste ethanol solvents as the catalyst and carbon sources, respectively. The direct and conformal growth of NNH layers onto carbonaceous scaffold guarantees the later uniform implantation of long and high-quality CNTs on total AC outer surfaces. Such fluffy and entangled CNTs preserve ionic diffusion channels, well connect neighboring ACs and function as superhighways for electrons transfer, endowing electrodes with outstanding capacitive behaviors including large output capacitances of ∼230 F g -1 in 1 M Na 2 SO 4 neutral solution and ∼502.5 F g -1 in 6 M KOH using Ni valence state variation, and very negligible capacity decay in long-term cycles. Furthermore, a full symmetric supercapacitor device of CNTs@ACs//CNTs@ACs has been constructed, capable of delivering both high specific energy and power densities (maximum values reaching up to ∼97.2 Wh kg -1 and ∼10.84 kW kg -1 ), which holds great potential in competing with current mainstream supercapacitors.

Gas-phase noncovalent functionalization of carbon nanotubes with a Ni(II) tetraaza[14]annulene complex

Science.gov (United States)

Basiuk, Vladimir A.; Henao-Holguín, Laura Verónica; Álvarez-Zauco, Edgar; Bassiouk, María; Basiuk, Elena V.

2013-04-01

The noncovalent functionalization of carbon nanotubes (CNTs) with aromatic polyazamacrocyclic compounds, based on π-π-interactions, keeps the intrinsic electronic structure of CNTs totally intact and allows for combining unique properties of the two interacting components. In addition to porphyrins and phthalocyanines, there are other, simpler compounds exhibiting similar properties, potentially useful for photovoltaic, catalytic and electrochemical applications: for example, tetraaza[14]annulenes. Many of them are highly thermally stable, which makes it possible to employ physical vapor deposition for the preparation of macrocycle-nanotube hybrids. One of such compounds is Ni(II) complex of 5,7,12,14-tetramethyldibenzo-1,4,8,11-tetraazacyclotetradeca-3,5,7,10,12,14-hexaene (also called Ni(II)-tetramethyldibenzotetraaza[14]annulene, or NiTMTAA for simplicity). In the present work, we attempted the noncovalent functionalization of both single-walled and multi-walled CNTs with NiTMTAA in the gas phase at two selected temperatures of 220 and 270 °C, which does not require the use of organic solvents and therefore can be considered as ecologically friendly. The nanohybrids obtained were characterized by means of scanning and transmission electron microscopy, energy dispersive X-ray, Fourier-transform infrared and Raman spectroscopy, as well as thermogravimetric analysis. An additional insight into the structure of adsorption complexes of NiTMTAA on CNTs was provided from density functional theory and molecular mechanics calculations.

Gas-phase noncovalent functionalization of carbon nanotubes with a Ni(II) tetraaza[14]annulene complex

Energy Technology Data Exchange (ETDEWEB)

Basiuk, Vladimir A., E-mail: basiuk@nucleares.unam.mx [Instituto de Ciencias Nucleares, Universidad Nacional Autónoma de México, Circuito Exterior, Ciudad Universitaria, 04510, México D.F. (Mexico); Henao-Holguín, Laura Verónica [Instituto de Ciencias Nucleares, Universidad Nacional Autónoma de México, Circuito Exterior, Ciudad Universitaria, 04510, México D.F. (Mexico); Álvarez-Zauco, Edgar [Facultad de Ciencias, Universidad Nacional Autónoma de México, Circuito Exterior C.U., 04510, México D.F. (Mexico); Bassiouk, María [Instituto de Ciencias Nucleares, Universidad Nacional Autónoma de México, Circuito Exterior, Ciudad Universitaria, 04510, México D.F. (Mexico); Basiuk, Elena V. [Centro de Ciencias Aplicadas y Desarrollo Tecnológico, Universidad Nacional Autónoma de México, Circuito Exterior, Ciudad Universitaria, 04510, México D.F. (Mexico)

2013-04-01

The noncovalent functionalization of carbon nanotubes (CNTs) with aromatic polyazamacrocyclic compounds, based on π–π-interactions, keeps the intrinsic electronic structure of CNTs totally intact and allows for combining unique properties of the two interacting components. In addition to porphyrins and phthalocyanines, there are other, simpler compounds exhibiting similar properties, potentially useful for photovoltaic, catalytic and electrochemical applications: for example, tetraaza[14]annulenes. Many of them are highly thermally stable, which makes it possible to employ physical vapor deposition for the preparation of macrocycle–nanotube hybrids. One of such compounds is Ni(II) complex of 5,7,12,14-tetramethyldibenzo-1,4,8,11-tetraazacyclotetradeca-3,5,7,10,12, 14-hexaene (also called Ni(II)-tetramethyldibenzotetraaza[14]annulene, or NiTMTAA for simplicity). In the present work, we attempted the noncovalent functionalization of both single-walled and multi-walled CNTs with NiTMTAA in the gas phase at two selected temperatures of 220 and 270 °C, which does not require the use of organic solvents and therefore can be considered as ecologically friendly. The nanohybrids obtained were characterized by means of scanning and transmission electron microscopy, energy dispersive X-ray, Fourier-transform infrared and Raman spectroscopy, as well as thermogravimetric analysis. An additional insight into the structure of adsorption complexes of NiTMTAA on CNTs was provided from density functional theory and molecular mechanics calculations.

Gas-phase noncovalent functionalization of carbon nanotubes with a Ni(II) tetraaza[14]annulene complex

International Nuclear Information System (INIS)

Basiuk, Vladimir A.; Henao-Holguín, Laura Verónica; Álvarez-Zauco, Edgar; Bassiouk, María; Basiuk, Elena V.

2013-01-01

The noncovalent functionalization of carbon nanotubes (CNTs) with aromatic polyazamacrocyclic compounds, based on π–π-interactions, keeps the intrinsic electronic structure of CNTs totally intact and allows for combining unique properties of the two interacting components. In addition to porphyrins and phthalocyanines, there are other, simpler compounds exhibiting similar properties, potentially useful for photovoltaic, catalytic and electrochemical applications: for example, tetraaza[14]annulenes. Many of them are highly thermally stable, which makes it possible to employ physical vapor deposition for the preparation of macrocycle–nanotube hybrids. One of such compounds is Ni(II) complex of 5,7,12,14-tetramethyldibenzo-1,4,8,11-tetraazacyclotetradeca-3,5,7,10,12, 14-hexaene (also called Ni(II)-tetramethyldibenzotetraaza[14]annulene, or NiTMTAA for simplicity). In the present work, we attempted the noncovalent functionalization of both single-walled and multi-walled CNTs with NiTMTAA in the gas phase at two selected temperatures of 220 and 270 °C, which does not require the use of organic solvents and therefore can be considered as ecologically friendly. The nanohybrids obtained were characterized by means of scanning and transmission electron microscopy, energy dispersive X-ray, Fourier-transform infrared and Raman spectroscopy, as well as thermogravimetric analysis. An additional insight into the structure of adsorption complexes of NiTMTAA on CNTs was provided from density functional theory and molecular mechanics calculations.

Synthesis and characterization of a novel tube-in-tube nanostructured PPy/MnO{sub 2}/CNTs composite for supercapacitor

Energy Technology Data Exchange (ETDEWEB)

Li, Juan, E-mail: lj-panpan@163.com [College of Chemistry and Chemical Engineering, Xinjiang University, Urumqi 830046 (China); Beijing National Laboratory for Molecular Sciences (BNLMS), State Key Laboratory for Structural Chemistry of Unstable and Stable Species, College of Chemistry and Molecular Engineering, Peking University, Beijing 100871 (China); Que, Tingli [College of Chemistry and Chemical Engineering, Xinjiang University, Urumqi 830046 (China); Huang, Jianbin, E-mail: JBhuang@pku.edu.cn [College of Chemistry and Chemical Engineering, Xinjiang University, Urumqi 830046 (China); Beijing National Laboratory for Molecular Sciences (BNLMS), State Key Laboratory for Structural Chemistry of Unstable and Stable Species, College of Chemistry and Molecular Engineering, Peking University, Beijing 100871 (China)

2013-02-15

Graphical abstract: A novel tube-in-tube nanostructured PPy/MnO{sub 2}/CNTs composite have been successfully fabricated. Its inner tubules are CNTs and the outer tubules are template-synthesized PPy. Most MnO{sub 2} nanoparticles are sandwiched between the inner and outer wall, some relatively large particles are also latched onto the outside wall of the PPy tube. The composite yields a good electrochemical reversibility through 1000 cycles’ cyclic voltammogram (CV) test and galvanostatic charge–discharge experiments at different current densities. Display Omitted Highlights: ► We fabricate a ternary organic–inorganic complex of PPy/MnO{sub 2}/CNTs composite. ► We characterize its morphological structures and properties by several techniques. ► The composite possesses the typical tube-in-tube nanostructures. ► Most MnO{sub 2} nanoparticles are sandwiched between the inner CNTs and outer PPy wall. ► The composite has good electrochemical reversibility for supercapacitor. -- Abstract: Ternary organic–inorganic complex of polypyrrole/manganese dioxide/carbon nanotubes (PPy/MnO{sub 2}/CNTs) composite was prepared by in situ chemical oxidation polymerization of pyrrole in the host of inorganic matrix of MnO{sub 2} and CNTs, using complex of methyl orange (MO)/FeCl{sub 3} was used as a reactive self-degraded soft-template. The morphological structures of the composite were characterized by scanning electron microscopy (SEM), transmission electron microscopy (TEM), high-resolution transmission electron microscopic (HRTEM), Fourier transform infrared spectroscopy (FT-IR) and X-ray diffraction (XRD), respectively. All the results indicate that the PPy/MnO{sub 2}/CNTs composite possesses the typical tube-in-tube nanostructures: the inner tubules are CNTs and the outer tubules are template-synthesized PPy. MnO{sub 2} nanoparticles may either sandwich the space between the inner and outer tubules or directly latch onto the wall of the PPy tubes. The composite

Easy solid-phase synthesis of pH-insensitive heterogeneous CNTs/FeS Fenton-like catalyst for the removal of antibiotics from aqueous solution.

Science.gov (United States)

Ma, Jie; Yang, Mingxuan; Yu, Fei; Chen, Junhong

2015-04-15

We report a facile solid method to synthesize efficient carbon-based Fenton-like catalyst (CNTs/FeS) using as-prepared carbon nanotubes (APCNTs), which makes full use of the iron nanoparticles in APCNTs without needless purification. Furthermore, the CNTs/FeS was characterized by transmission electron microscopy (TEM), X-ray diffraction (XRD), thermogravimetric (TG) and other analysis techniques, and then the CNTs/FeS was used as a Fenton-like catalyst for removing ciprofloxacin from aqueous solution. Response Surface Methodology (RSM) was applied to find the effect of the reaction parameter and the optimum operating condition. Results shows the catalytic reaction had better suitability than previous studies in a wide range of pH values (pH 3-8) and the Fenton-like catalyst CNTs/FeS exhibits good catalytic activity for removing of antibiotic, which be attributed to the synergistic effect of adsorption-advanced oxidation and significantly improves efficiency of advanced oxidation. More importantly, the CNTs/FeS catalyst exhibit good regeneration performance and retains a high catalytic capacity (>75%) even after four reaction cycles. The catalytic mechanism were also studied further, the removal mechanism of ciprofloxacin by a CNTs/FeS heterogeneous Fenton-like process primarily involves three removal pathways occurring simultaneously: (a) adsorption removal by CNTs, (b) Fenton-like degradation catalyzed by FeS, (c) catalytic degradation by CNTs catalyst. And these actions also have synergistic effects for ciprofloxacin removal. Copyright © 2014 Elsevier Inc. All rights reserved.

FABRICATION OF CNTS BY TOLUENE DECOMPOSITION IN A NEW REACTOR BASED ON AN ATMOSPHERIC PRESSURE PLASMA JET COUPLED TO A CVD SYSTEM

Directory of Open Access Journals (Sweden)

FELIPE RAMÍREZ-HERNÁNDEZ

2017-03-01

Full Text Available Here, we present a method to produce carbon nanotubes (CNTs based on the coupling between two conventional techniques used for the preparation of nanostructures: an arc-jet as a source of plasma and a chemical vapour deposition (CVD system. We call this system as an “atmospheric pressure plasma (APP-enhanced CVD” (APPE-CVD. This reactor was used to grow CNTs on non-flat aluminosilicate substrates by the decomposition of toluene (carbon source in the presence of ferrocene (as a catalyst. Both, CNTs and by-products of carbon were collected at three different temperatures (780, 820 and 860 °C in different regions of the APPE-CVD system. These samples were analysed by thermogravimetric analysis (TGA and DTG, scanning electron microscopy (SEM and Raman spectroscopy in order to determine the effect of APP on the thermal stability of the as-grown CNTs. It was found that the amount of metal catalyst in the synthesised CNTs is reduced by applying APP, being 820 °C the optimal temperature to produce CNTs with a high yield and carbon purity (95 wt. %. In contrast, when the synthesis temperature was fixed at 780 °C or 860 °C, amorphous carbon or CNTs with different structural defects, respectively, was formed through APEE-CVD reactor. We recommended the use of non-flat aluminosilicate particles as supports to increase CNT yield and facilitate the removal of deposits from the substrate surface. The approach that we implemented (to synthesise CNTs by using the APPE-CVD reactor may be useful to produce these nanostructures on a gram-scale for use in basic studies. The approach may also be scaled up for mass production.

Highly Sensitive and Selective In-Situ SERS Detection of Pb(2+), Hg(2+), and Cd(2+) Using Nanoporous Membrane Functionalized with CNTs.

Science.gov (United States)

Shaban, Mohamed; Galaly, A R

2016-05-04

Porous Anodic Alumina (PAA) membrane was functionalized with CoFe2O4 nanoparticles and used as a substrate for the growing of very long helical-structured Carbon Nanotubes (CNTs) with a diameter less than 20 nm. The structures and morphologies of the fabricated nanostructures were characterized by field emission- scanning electron microscopy (FE-SEM), energy dispersive X-ray (EDX), and Raman spectroscopy. By uploading the CNTs on PAA, the characteristic Raman peaks of CNTs and PAA showed 4 and 3 times enhancement, respectively, which leads to more sensitive Surface-Enhanced Raman Spectroscopy (SERS) substrates. For comparison, PAA and CNTs/PAA arrays were used as SERS substrates for the detection of Hg(2+), Cd(2+), and Pb(2+). The proposed sensor demonstrated high sensitivity and selectivity between these heavy metal ions. CNTs/PAA sensor showed excellent selectivity toward Pb(2+) over other metal ions, where the enhancement factor is decreased from ~17 for Pb(2+) to ~12 for Hg(2+) and to ~4 for Cd(2+). Therefore, the proposed CNTs/PAA sensor can be used as a powerful tool for the determination of heavy metal ions in aqueous solutions.

Highly Sensitive and Selective In-Situ SERS Detection of Pb2+, Hg2+, and Cd2+ Using Nanoporous Membrane Functionalized with CNTs

Science.gov (United States)

Shaban, Mohamed; Galaly, A. R.

2016-01-01

Porous Anodic Alumina (PAA) membrane was functionalized with CoFe2O4 nanoparticles and used as a substrate for the growing of very long helical-structured Carbon Nanotubes (CNTs) with a diameter less than 20 nm. The structures and morphologies of the fabricated nanostructures were characterized by field emission- scanning electron microscopy (FE-SEM), energy dispersive X-ray (EDX), and Raman spectroscopy. By uploading the CNTs on PAA, the characteristic Raman peaks of CNTs and PAA showed 4 and 3 times enhancement, respectively, which leads to more sensitive Surface-Enhanced Raman Spectroscopy (SERS) substrates. For comparison, PAA and CNTs/PAA arrays were used as SERS substrates for the detection of Hg2+, Cd2+, and Pb2+. The proposed sensor demonstrated high sensitivity and selectivity between these heavy metal ions. CNTs/PAA sensor showed excellent selectivity toward Pb2+ over other metal ions, where the enhancement factor is decreased from ~17 for Pb2+ to ~12 for Hg2+ and to ~4 for Cd2+. Therefore, the proposed CNTs/PAA sensor can be used as a powerful tool for the determination of heavy metal ions in aqueous solutions. PMID:27143512

Flexible and Lightweight Pressure Sensor Based on Carbon Nanotube/Thermoplastic Polyurethane-Aligned Conductive Foam with Superior Compressibility and Stability.

Science.gov (United States)

Huang, Wenju; Dai, Kun; Zhai, Yue; Liu, Hu; Zhan, Pengfei; Gao, Jiachen; Zheng, Guoqiang; Liu, Chuntai; Shen, Changyu

2017-12-06

Flexible and lightweight carbon nanotube (CNT)/thermoplastic polyurethane (TPU) conductive foam with a novel aligned porous structure was fabricated. The density of the aligned porous material was as low as 0.123 g·cm -3 . Homogeneous dispersion of CNTs was achieved through the skeleton of the foam, and an ultralow percolation threshold of 0.0023 vol % was obtained. Compared with the disordered foam, mechanical properties of the aligned foam were enhanced and the piezoresistive stability of the flexible foam was improved significantly. The compression strength of the aligned TPU foam increases by 30.7% at the strain of 50%, and the stress of the aligned foam is 22 times that of the disordered foam at the strain of 90%. Importantly, the resistance variation of the aligned foam shows a fascinating linear characteristic under the applied strain until 77%, which would benefit the application of the foam as a desired pressure sensor. During multiple cyclic compression-release measurements, the aligned conductive CNT/TPU foam represents excellent reversibility and reproducibility in terms of resistance. This nice capability benefits from the aligned porous structure composed of ladderlike cells along the orientation direction. Simultaneously, the human motion detections, such as walk, jump, squat, etc. were demonstrated by using our flexible pressure sensor. Because of the lightweight, flexibility, high compressibility, excellent reversibility, and reproducibility of the conductive aligned foam, the present study is capable of providing new insights into the fabrication of a high-performance pressure sensor.

Synthesis and characterization of novel plasmonic Ag/AgX-CNTs (X = Cl, Br, I) nanocomposite photocatalysts and synergetic degradation of organic pollutant under visible light.

Science.gov (United States)

Shi, Huixian; Chen, Jiangyao; Li, Guiying; Nie, Xin; Zhao, Huijun; Wong, Po-Keung; An, Taicheng

2013-08-14

A series of novel well-defined Ag/AgX (X = Cl, Br, I) loaded carbon nanotubes (CNTs) composite photocatalysts (Ag/AgX-CNTs) were fabricated for the first time via a facile ultrasonic assistant deposition-precipitation method at the room temperature (25 ± 1 °C). X-ray diffraction, X-ray photoelectron spectroscopy, nitrogen adsorption-desorption analysis, scanning electron microscopy, and ultraviolet-visible light absorption spectra analysis were used to characterize the structure, morphology, and optical properties of the as-prepared photocatalysts. Results confirmed the existence of the direct interfacial contact between Ag/AgX nanoparticles and CNTs, and Ag/AgX-CNTs nanocomposites exhibit superior absorbance in the visible light (VL) region owing to the surface plasmon resonance (SPR) of Ag nanoparticles. The fabricated composite photocatalysts were employed to remove 2,4,6-tribromophenol (TBP) in aqueous phase. A remarkably enhanced VL photocatalytic degradation efficiency of Ag/AgX-CNTs nanocomposites was observed when compared to that of pure AgX or CNTs. The photocatalytic activity enhancement of Ag/AgX-CNTs was due to the effective electron transfer from photoexcited AgX and plasmon-excited Ag(0) nanoparticles to CNTs. This can effectively decrease the recombination of electron-hole pairs, lead to a prolonged lifetime of the photoholes that promotes the degradation efficiency.

Partial Discharge Tests using the Cigré II method

DEFF Research Database (Denmark)

Casale, M. Di Lorenzo del; Schifani, R.; Holbøll, Joachim

2000-01-01

In this paper, the results of an experimental project on insulating material aging, performed in both Denmark and Italy, are reported. This study was concerned with partial discharge (PD) behavior at temperatures between 30 and 80°C using CIGRE method II. The material tested was a commercial...... polymethylmethacrylate (PMMA) which was chosen not for its good dielectric properties but rather because much of its discharge resistance data at ambient temperature is already well documented. A description is given of the theoretical and experimental methodology followed in this work. Mixed Weibull analysis techniques...... in terms of the PD amplitude and phase distribution characteristics were employed to distinguish the presence of different aging mechanisms. Such a difference was observed at 30 and at 80°C. At 30°C the analysis inferred a single discharge aging process acting until breakdown, while at 80°C the results...

Embedded Aligned Carbon Nanotube Sheets for Strain and Damage sensing in Composite Structures

Science.gov (United States)

Aly, Karim Aly Abdelomoaty Elsayed

The world demand for fiber reinforced composite materials has been steadily increasing because of the widespread adoption of this class of material in many markets. The automotive, aerospace, marine and energy sectors account for a large percentage of this grow. Outstanding fatigue performance, high specific stiffness and strength, and low density are among the most important properties that fiber reinforced polymer composites offer. Furthermore, their properties can be tailored to meet the specific needs of the final applications. However, this class of material is composed of multiple layers of inhomogeneous and anisotropic constituents, i.e. fibers and matrix. Therefore, this laminated nature make the composite material prone to intrinsic damage including interfacial debonding and delamination and their strength and failure are dependent on the fiber architecture and direction of the applied stresses. Consequently, it is of prime importance to monitor the health of these structures. New and improved methods for early detection of damage and structural health monitoring of composite materials may allow for enhanced reliability, lifetime and performance while minimizing maintenance time during a composite part's service life. Over the last few decades different non-destructive methods and materials have been investigated for use as strain sensors. Since the discovery of carbon nanotubes (CNTs), they have attracted much research interest due to their superior electrical, thermal and mechanical properties as well as their high aspect ratio. In this context, CNTs have been used in the recent years to enable sensing capabilities. In this dissertation, the usage of CNTs for performing strain and damage sensing in composites is evaluated. This was enabled by embedding aligned sheets of two millimeters long, interconnected CNTs into laminated structures that were then subjected to different forms of mechanical loading. The localization of the CNT sheets inside the host

Porous VO(x)N(y) nanoribbons supported on CNTs as efficient and stable non-noble electrocatalysts for the oxygen reduction reaction.

Science.gov (United States)

Huang, K; Bi, K; Lu, Y K; Zhang, R; Liu, J; Wang, W J; Tang, H L; Wang, Y G; Lei, M

2015-11-30

Novel nanocomposites of carbon nanotubes supported porous VO(x)N(y) nonoribbons (VO(x)N(y)-CNTs) have been synthesized by the annealing of the sol-gel mixture of CNTs and V2O5 under NH3 atmosphere as well as the ageing process in air. Besides the morphological and structural characterizations revealed by TEM, SEAD, EDS, XRD and XPS measurements, typical electrochemical tests including cyclic voltammetry (CV), rotating disk electrode (RDE) and chronoamperometry have been employed to determine the oxygen reduction reaction (ORR) performance of VO(x)N(y)-CNTs. Inspiringly, the results indicate that VO(x)N(y)-CNTs catalyst exhibits a 0.4 mA/cm(2) larger diffusion-limited current density, a 0.10  V smaller onset potential value, a 10.73% less of ORR current decay and an excellent methanol-tolerance compared with commercial Pt/C catalyst. Therefore, we have reasonable grounds to believe that this new VO(x)N(y)-CNTs nanocomposites can be regarded as a promising non-precious methanol-tolerant ORR catalyst candidate for alkaline fuel cells.

Development and commissioning of an x-ray beam alignment flag for NSLS-II

Energy Technology Data Exchange (ETDEWEB)

Kosciuk, B., E-mail: bkosciuk@bnl.gov; Hu, Y.; Keister, J.; Seletskiy, S. [National Synchrotron Light Source-II, Brookhaven National Laboratory, Upton, New York 11973 (United States)

2016-07-27

The NSLS-II Synchrotron Light Source is a 3 GeV electron storage ring recently commissioned and is now entering operations at Brookhaven National Laboratory. One of the major tasks was to commission the six project beamline front ends which required a diagnostic to resolve x-ray beam position for the purpose of beam alignment at low current. Since none of the front ends were outfitted with any x-ray diagnostics in the baseline design, an x-ray beam profile monitor or “flag” that could be easily installed into existing front end vacuum chambers was proposed to satisfy this requirement. Here we present the development of this novel device which utilizes a polycrystalline CVD diamond luminescent screen to produce a visible image of the x-ray beam cross-section and is then captured with a CCD camera.

Fabrication and Characterization of Polyimide-CNTs hybrid membrane to enhance high performance CO2 separation

Directory of Open Access Journals (Sweden)

Tutuk Djoko Kusworo

2015-03-01

Full Text Available This study investigates the CO2 separation performance of a hybrid membranes flat sheet based on polyimide incorporated with carbon nanotubes (CNTs particles. CNTs was selected and its loading were a 1 wt% in total solid. The hybrid composite membranes were fabricated in order to increase their separation performance for the gaseous mixture of CO2 and CH4. Hybrid Composite  membrane incorporated carbon nanotubes were mannufactured  by the dry-wet phase inversion technique using flat sheet membrane casting machine system,  in which the CNTs were embedded into the polyimide membrane and the resulting membranes were characterized. The results from the FESEM, DSC and FTIR analysis confirmed that chemical modification on carbon nanotubes surface had taken place. Sieve-in-a-cage’ morphology observed shows the poor adhesion between polymer and unmodified CNT. The results revealed that the good multi-wall carbon nanotubes dispersion leads to enhanced gas permeation properties. It is also concluded that addition of carbon nanotubes particles into the matrix of Polyimide polymer has significant effect on the membrane structure and properties.

In situ deposition of hierarchical architecture assembly from Sn-filled CNTs for lithium-ion batteries.

Science.gov (United States)

Hou, Xiaoyu; Jiang, Hao; Hu, Yanjie; Li, Yunfeng; Huo, Junchao; Li, Chunzhong

2013-07-24

In this paper, we have demonstrated a hierarchical architecture assembly from Sn-filled CNTs, which was in situ deposited on Cu foils to form binder-free electrode by incorporating flame aerosol deposition (FAD) with chemical vapor deposition (CVD) processes. The reversible capacity of Sn-filled CNTs hierarchical architecture anode exhibited above 1000 mA h g(-1) before 30th cycle and stabilized at 437 mA h g(-1) after 100 cycles at a current density of 100 mA g(-1). Even at as high as 2 A g(-1), the capacity still maintained 429 mA h g(-1). The desirable cycling life and rate capacities performance were attributed to great confinement of tin in the interior of CNTs and the superior conducting network constructed by the 3D hierarchical architecture. The novel, rapid and scalable synthetic route was designed to prepare binder-free electrode with high electrochemical performance and avoid long-time mixing of active materials, binder, and carbon black, which is expected to be one of promising preparation of Sn/C anodes in lithium-ion batteries.

PEP-II Alignment

CERN Document Server

Gaydosh, M

2003-01-01

The PEP-II Asymmetric B-factory consists of two independent storage rings, one located atop the other in the 2200m-circumference PEP tunnel. The high-energy ring, which stores a 9-GeV electron beam, is an upgrade of the existing PEP collider. It re-utilizes all of the PEP magnets and incorporates a state-of-the-art copper vacuum chamber and a new RF system capable of supporting a one-amp stored beam. The low-energy ring, which stores 3.1-GeV positrons, is new construction. Injection is achieved by extracting electrons and positrons at collision energies from the SLC and transporting them each in a dedicated bypass line. The low-emittance SLC beams will be used for the injection process.

Rational control on floating catalysts for the growth of carbon nanotube assemblies: From vertically aligned carbon nanotube arrays to carbon nanotube films

International Nuclear Information System (INIS)

Chen, Hongyuan; Chen, Minghai; Zhang, Yongyi; Li, Qingwen

2015-01-01

Graphical abstract: - Highlights: • Floating catalyst CVD for the growth of CNT films and arrays was investigated. • The structure of CNT array grown in floating catalyst CVD was revealed. • Temperature was proved as a key for the growth of different CNT assemblies. • The increase of growth temperature induced the growth of single-walled CNT film. - Abstract: Floating catalyst chemical vapor deposition (FCCVD) has been widely used for the growth of various carbon nanotube (CNT) macrostructures, mainly including vertically aligned CNT (VACNT) arrays and none-woven CNT films. However, it is still unclear for the reason why these CNT macrostructures with largely different morphologies were received via the similar method. In this research, it revealed that the growth temperature largely affected the nucleation status of floating catalysts and thus controlled the morphologies of CNT macrostructures from VACNT arrays to none-woven CNT films. In low temperatures (below 800 °C), VACNTs were grown by bottom-up mechanism with several CNTs, but not one individual from bottom to up along the array height direction. Furthermore, VACNT arrays were only grown on some substrates that can induce iron atoms aggregating to catalyst particles with a suitable size. When increasing the growth temperature higher than 800 °C, more catalyst particles were nucleated in the gas flow, which induced the formation of none-woven CNT films composed of thin CNTs (single-walled CNTs and double-walled CNTs). This research was significative for understanding CNT growth mechanism via FCCVD process and the synthesis of different CNT macrostructures by this strategy.

Rational control on floating catalysts for the growth of carbon nanotube assemblies: From vertically aligned carbon nanotube arrays to carbon nanotube films

Energy Technology Data Exchange (ETDEWEB)

Chen, Hongyuan; Chen, Minghai, E-mail: mhchen2008@sinano.ac.cn; Zhang, Yongyi; Li, Qingwen

2015-10-30

Graphical abstract: - Highlights: • Floating catalyst CVD for the growth of CNT films and arrays was investigated. • The structure of CNT array grown in floating catalyst CVD was revealed. • Temperature was proved as a key for the growth of different CNT assemblies. • The increase of growth temperature induced the growth of single-walled CNT film. - Abstract: Floating catalyst chemical vapor deposition (FCCVD) has been widely used for the growth of various carbon nanotube (CNT) macrostructures, mainly including vertically aligned CNT (VACNT) arrays and none-woven CNT films. However, it is still unclear for the reason why these CNT macrostructures with largely different morphologies were received via the similar method. In this research, it revealed that the growth temperature largely affected the nucleation status of floating catalysts and thus controlled the morphologies of CNT macrostructures from VACNT arrays to none-woven CNT films. In low temperatures (below 800 °C), VACNTs were grown by bottom-up mechanism with several CNTs, but not one individual from bottom to up along the array height direction. Furthermore, VACNT arrays were only grown on some substrates that can induce iron atoms aggregating to catalyst particles with a suitable size. When increasing the growth temperature higher than 800 °C, more catalyst particles were nucleated in the gas flow, which induced the formation of none-woven CNT films composed of thin CNTs (single-walled CNTs and double-walled CNTs). This research was significative for understanding CNT growth mechanism via FCCVD process and the synthesis of different CNT macrostructures by this strategy.

ANADP II Program Committee Closing Remarks 2013

OpenAIRE

Program Committee

2014-01-01

Aligning National Approaches to Digital Preservation: An Action Assembly Biblioteca de Catalunya (National Library of Catalonia) November 18-20, 2013, Barcelona, Spain summary The Aligning National Approaches to Digital Preservation (ANADP) II Action Assembly will align digital preservation efforts internationally between communities—including national libraries, academic libraries, public libraries, research centers, archives, corporations, and funding agencies. ANADP II will be a highly par...

Using ESTs for phylogenomics: Can one accurately infer a phylogenetic tree from a gappy alignment?

Directory of Open Access Journals (Sweden)

Hartmann Stefanie

2008-03-01

Full Text Available Abstract Background While full genome sequences are still only available for a handful of taxa, large collections of partial gene sequences are available for many more. The alignment of partial gene sequences results in a multiple sequence alignment containing large gaps that are arranged in a staggered pattern. The consequences of this pattern of missing data on the accuracy of phylogenetic analysis are not well understood. We conducted a simulation study to determine the accuracy of phylogenetic trees obtained from gappy alignments using three commonly used phylogenetic reconstruction methods (Neighbor Joining, Maximum Parsimony, and Maximum Likelihood and studied ways to improve the accuracy of trees obtained from such datasets. Results We found that the pattern of gappiness in multiple sequence alignments derived from partial gene sequences substantially compromised phylogenetic accuracy even in the absence of alignment error. The decline in accuracy was beyond what would be expected based on the amount of missing data. The decline was particularly dramatic for Neighbor Joining and Maximum Parsimony, where the majority of gappy alignments contained 25% to 40% incorrect quartets. To improve the accuracy of the trees obtained from a gappy multiple sequence alignment, we examined two approaches. In the first approach, alignment masking, potentially problematic columns and input sequences are excluded from from the dataset. Even in the absence of alignment error, masking improved phylogenetic accuracy up to 100-fold. However, masking retained, on average, only 83% of the input sequences. In the second approach, alignment subdivision, the missing data is statistically modelled in order to retain as many sequences as possible in the phylogenetic analysis. Subdivision resulted in more modest improvements to alignment accuracy, but succeeded in including almost all of the input sequences. Conclusion These results demonstrate that partial gene

Using ESTs for phylogenomics: can one accurately infer a phylogenetic tree from a gappy alignment?

Science.gov (United States)

Hartmann, Stefanie; Vision, Todd J

2008-03-26

While full genome sequences are still only available for a handful of taxa, large collections of partial gene sequences are available for many more. The alignment of partial gene sequences results in a multiple sequence alignment containing large gaps that are arranged in a staggered pattern. The consequences of this pattern of missing data on the accuracy of phylogenetic analysis are not well understood. We conducted a simulation study to determine the accuracy of phylogenetic trees obtained from gappy alignments using three commonly used phylogenetic reconstruction methods (Neighbor Joining, Maximum Parsimony, and Maximum Likelihood) and studied ways to improve the accuracy of trees obtained from such datasets. We found that the pattern of gappiness in multiple sequence alignments derived from partial gene sequences substantially compromised phylogenetic accuracy even in the absence of alignment error. The decline in accuracy was beyond what would be expected based on the amount of missing data. The decline was particularly dramatic for Neighbor Joining and Maximum Parsimony, where the majority of gappy alignments contained 25% to 40% incorrect quartets. To improve the accuracy of the trees obtained from a gappy multiple sequence alignment, we examined two approaches. In the first approach, alignment masking, potentially problematic columns and input sequences are excluded from from the dataset. Even in the absence of alignment error, masking improved phylogenetic accuracy up to 100-fold. However, masking retained, on average, only 83% of the input sequences. In the second approach, alignment subdivision, the missing data is statistically modelled in order to retain as many sequences as possible in the phylogenetic analysis. Subdivision resulted in more modest improvements to alignment accuracy, but succeeded in including almost all of the input sequences. These results demonstrate that partial gene sequences and gappy multiple sequence alignments can pose a

MCNP6 model of the University of Washington clinical neutron therapy system (CNTS).

Science.gov (United States)

Moffitt, Gregory B; Stewart, Robert D; Sandison, George A; Goorley, John T; Argento, David C; Jevremovic, Tatjana

2016-01-21

A MCNP6 dosimetry model is presented for the Clinical Neutron Therapy System (CNTS) at the University of Washington. In the CNTS, fast neutrons are generated by a 50.5 MeV proton beam incident on a 10.5 mm thick Be target. The production, scattering and absorption of neutrons, photons, and other particles are explicitly tracked throughout the key components of the CNTS, including the target, primary collimator, flattening filter, monitor unit ionization chamber, and multi-leaf collimator. Simulations of the open field tissue maximum ratio (TMR), percentage depth dose profiles, and lateral dose profiles in a 40 cm × 40 cm × 40 cm water phantom are in good agreement with ionization chamber measurements. For a nominal 10 × 10 field, the measured and calculated TMR values for depths of 1.5 cm, 5 cm, 10 cm, and 20 cm (compared to the dose at 1.7 cm) are within 0.22%, 2.23%, 4.30%, and 6.27%, respectively. For the three field sizes studied, 2.8 cm × 2.8 cm, 10.4 cm × 10.3 cm, and 28.8 cm × 28.8 cm, a gamma test comparing the measured and simulated percent depth dose curves have pass rates of 96.4%, 100.0%, and 78.6% (depth from 1.5 to 15 cm), respectively, using a 3% or 3 mm agreement criterion. At a representative depth of 10 cm, simulated lateral dose profiles have in-field (⩾ 10% of central axis dose) pass rates of 89.7% (2.8 cm × 2.8 cm), 89.6% (10.4 cm × 10.3 cm), and 100.0% (28.8 cm × 28.8 cm) using a 3% and 3 mm criterion. The MCNP6 model of the CNTS meets the minimum requirements for use as a quality assurance tool for treatment planning and provides useful insights and information to aid in the advancement of fast neutron therapy.

Enhanced permeability, selectivity, and antifouling ability of CNTs/Al2O3 membrane under electrochemical assistance.

Science.gov (United States)

Fan, Xinfei; Zhao, Huimin; Liu, Yanming; Quan, Xie; Yu, Hongtao; Chen, Shuo

2015-02-17

Membrane filtration provides effective solutions for removing contaminants, but achieving high permeability, good selectivity, and antifouling ability remains a great challenge for existing membrane filtration technologies. In this work, membrane filtration coupled with electrochemistry has been developed to enhance the filtration performance of a CNTs/Al2O3 membrane. The as-prepared CNTs/Al2O3 membrane, obtained by coating interconnected CNTs on an Al2O3 substrate, presented good pore-size tunability, mechanical stability, and electroconductivity. For the removal of a target (silica spheres as a probe) with a size comparable to the membrane pore size, the removal efficiency and flux at +1.5 V were 1.1 and 1.5 times higher, respectively, than those without electrochemical assistance. Moreover, the membrane also exhibited a greatly enhanced removal efficiency for contaminants smaller than the membrane pores, providing enhancements of 4 orders of magnitude and a factor of 5.7 for latex particles and phenol, respectively. These results indicated that both the permeability and the selectivity of CNTs/Al2O3 membranes can be significantly improved by electrochemical assistance, which was further confirmed by the removal of natural organic matter (NOM). The permeate flux and NOM removal efficiency at +1.5 V were about 1.6 and 3.0 times higher, respectively, than those without electrochemical assistance. In addition, the lost flux of the fouled membrane was almost completely recovered by an electrochemically assisted backwashing process.

Flexible Field Emitter for X-ray Generation by Implanting CNTs into Nickel Foil

Science.gov (United States)

Sun, Bin; Wang, Yan; Ding, Guifu

2016-09-01

This paper reports on a flexible Ni micro wire with CNTs embedded into its surface. By using micromachining technology, for the first time, we could implant nanoscale materials into micro-scale metal substrate at room temperature. Thanks to the effective direct contact and the strong interactions between CNTs and the substrate, field emission current of 1.11 mA (current density of 22.2 mA/cm2) could be achieved from the micro wire. Moreover, the wire shows excellent mechanical properties for large amplitude bending, which is beneficial for geometric designing. To check the practical application of the wire, a simplified X-ray imaging system was set up by modifying a conventional tube. The gray shade that appears on the sensitive film after being exposed to the radiation confirms the X-ray generation.

On the influence of various physicochemical properties of the CNTs based implantable devices on the fibroblasts' reaction in vitro.

Science.gov (United States)

Benko, Aleksandra; Frączek-Szczypta, Aneta; Menaszek, Elżbieta; Wyrwa, Jan; Nocuń, Marek; Błażewicz, Marta

2015-11-01

Coating the material with a layer of carbon nanotubes (CNTs) has been a subject of particular interest for the development of new biomaterials. Such coatings, made of properly selected CNTs, may constitute an implantable electronic device that facilitates tissue regeneration both by specific surface properties and an ability to electrically stimulate the cells. The goal of the presented study was to produce, evaluate physicochemical properties and test the applicability of highly conductible material designed as an implantable electronic device. Two types of CNTs with varying level of oxidation were chosen. The process of coating involved suspension of the material of choice in the diluent followed by the electrophoretic deposition to fabricate layers on the surface of a highly biocompatible metal-titanium. Presented study includes an assessment of the physicochemical properties of the material's surface along with an electrochemical evaluation and in vitro biocompatibility, cytotoxicity and apoptosis studies in contact with the murine fibroblasts (L929) in attempt to answer the question how the chemical composition and CNTs distribution in the layer alters the electrical properties of the sample and whether any of these properties have influenced the overall biocompatibility and stimulated adhesion of fibroblasts. The results indicate that higher level of oxidation of CNTs yielded materials more conductive than the metal they are deposited on. In vitro study revealed that both materials were biocompatible and that the cells were not affected by the amount of the functional group and the morphology of the surface they adhered to.

Effect of the addition CNTs on performance of CaP/chitosan/coating deposited on magnesium alloy by electrophoretic deposition.

Science.gov (United States)

Zhang, Jie; Wen, Zhaohui; Zhao, Meng; Li, Guozhong; Dai, Changsong

2016-01-01

CaP/chitosan/carbon nanotubes (CNTs) coating on AZ91D magnesium alloy was prepared via electrophoretic deposition (EPD) followed by conversion in a phosphate buffer solution (PBS). The bonding between the layer and the substrate was studied by an automatic scratch instrument. The phase compositions and microstructures of the composite coatings were determined by using X-ray diffraction (XRD), Fourier-transformed infrared spectroscopy (FTIR), Raman spectroscopy and scanning electron microscope (SEM). The element concentration and gentamicin concentration were respectively determined by inductively coupled plasma optical emission spectrometer (ICP-OES) test and ultraviolet spectrophotometer (UV). The cell counting kit (CCK) assay was used to evaluate the cytotoxicity of samples to SaOS-2 cells. The results showed that a few CNTs with their original tubular morphology could be found in the CaP/chitosan coating and they were beneficial for the crystal growth of phosphate and improvement of the coating bonding when the addition amount of CNTs in 500 ml of electrophoretic solution was from 0.05 g to 0.125 g. The loading amount of gentamicin increased and the releasing speed of gentamicin decreased after CNTs was added into the CaP/chitosan coating for immersion loading and EPD loading. The cell viability of Mg based CaP/chitosan/CNTs was higher than that of Mg based CaP/chitosan from 16 days to 90 days. Copyright © 2015 Elsevier B.V. All rights reserved.

Novel real-time alignment and calibration of LHCb detector for Run II and tracking for the upgrade.

CERN Document Server

AUTHOR|(CDS)2091576

2016-01-01

LHCb has introduced a novel real-time detector alignment and calibration strategy for LHC Run II. Data collected at the start of the fill is processed in a few minutes and used to update the alignment, while the calibration constants are evaluated for each run. The procedure aims to improve the quality of the online selection and performance stability. The required computing time constraints are met thanks to a new dedicated framework using the multi-core farm infrastructure for the trigger. A similar scheme is planned to be used for Run III foreseen to start in 2020. At that time LHCb will run at an instantaneous luminosity of $2 \\times 10^{33}$ cm$^2$ s$^1$ and a fully software based trigger strategy will be used. The new running conditions and the tighter timing constraints in the software trigger (only 13 ms per event are available) represent a big challenge for track reconstruction. The new software based trigger strategy implies a full detector read-out at the collision rate of 40 MHz. High performance ...

RGO/Au NPs/N-doped CNTs supported on nickel foam as an anode for enzymatic biofuel cells.

Science.gov (United States)

Zhang, He; Zhang, Lingling; Han, Yujie; Yu, You; Xu, Miao; Zhang, Xueping; Huang, Liang; Dong, Shaojun

2017-11-15

In this study, three-dimensional reduced graphene oxide/Au NPs/nitrogen-doped carbon nanotubes (RGO/Au NPs/N-doped CNTs) assembly supported on nickel foam was utilized as an anode for enzymatic biofuel cells (EBFCs). 3D RGO/Au NPs was obtained by electrodepositing reduced graphene oxide on nickel foam (Ni foam), while Au NPs were co-deposited during the process. Afterwards, nitrogen doped CNTs (N-CNTs) were allowed to grow seamlessly on the surfaces of 3D RGO/Au NPs via a simple chemical vapor deposition (CVD) process. In this nanostructure, Au NPs co-deposition and nitrogen doping offer more active sites for bioelectrocatalysis. Additionally, N-CNTs were demonstrated providing high specific surface area for enzyme immobilization and facilitating the electron transfer between glucose oxidase (GOx) and electrode. The resulting bioanode achieved efficient glucose oxidation with high current densities of 7.02mAcm -2 (0.3V vs. Ag/AgCl). Coupling with a Pt cathode, the fabricated glucose/air biofuel cell exhibited an open-circuit potential of 0.32V and generated a maximum power density 235µWcm -2 at 0.15V. This novel electrode substrate achieved high performance in current density at bioelectrochemical systems and could be useful for further exploiting the application of three dimensional carbon-based nanomaterials in EBFCs. Copyright © 2017 Elsevier B.V. All rights reserved.

Effects of K and Pt promoters on the performance of cobalt catalyst supported on CNTs

International Nuclear Information System (INIS)

Zabidi, Noor Asmawati Mohd; Ali, Sardar; Subbarao, Duvvuri

2014-01-01

This paper presents a comparative study on the effects of incorporation of potassium (K) and platinum (Pt) as promoters on the physicochemical properties of cobalt catalyst. The catalyst was prepared by a wet impregnation method on a CNTs support. Samples were characterized using transmission electron microscopy (TEM), H 2 -temperature-programmed reduction (TPR) and X-ray photoelectron spectroscopy (XPS) techniques. Fischer-Tropsch Synthesis (FTS) was carried out in a fixed-bed microreactor at 543 K and 1 atm, with H 2 /CO = 2v/v and space velocity, SV of 12 L/g.h for 5 hours. The K-promoted and Pt-promoted Co catalysts have different physicochemical properties and catalytic performances compared to that of the un-promoted Co catalyst. XPS analysis revealed that K and Pt promoters induced electronic modifications as exhibited by the shifts in the Co binding energies. Incorporation of 0.06 wt% K and 0.06 wt% Pt in Co/CNTs catalyst resulted in an increase in the CO conversion and C 5+ selectivity and a decrease in methane selectivity. Potassium was found to be a better promoter for Co/CNTs catalyst compared to platinum

Effects of K and Pt promoters on the performance of cobalt catalyst supported on CNTs

Energy Technology Data Exchange (ETDEWEB)

Zabidi, Noor Asmawati Mohd, E-mail: noorasmawati-mzabidi@petronas.com.my [Department of Fundamental and Applied Sciences, Universiti Teknologi PETRONAS, Bandar Seri Iskandar, 31750 Tronoh, Perak (Malaysia); Ali, Sardar, E-mail: alikhan-635@yahoo.com [Centralized Analytical Laboratory, Universiti Teknologi PETRONAS, Bandar Seri Iskandar, 31750 Tronoh, Perak (Malaysia); Subbarao, Duvvuri, E-mail: duvvuri-subbarao@petronas.com.my [Department of Chemical Engineering, Universiti Teknologi PETRONAS, Bandar Seri Iskandar, 31750 Tronoh, Perak (Malaysia)

2014-10-24

This paper presents a comparative study on the effects of incorporation of potassium (K) and platinum (Pt) as promoters on the physicochemical properties of cobalt catalyst. The catalyst was prepared by a wet impregnation method on a CNTs support. Samples were characterized using transmission electron microscopy (TEM), H{sub 2}-temperature-programmed reduction (TPR) and X-ray photoelectron spectroscopy (XPS) techniques. Fischer-Tropsch Synthesis (FTS) was carried out in a fixed-bed microreactor at 543 K and 1 atm, with H{sub 2}/CO = 2v/v and space velocity, SV of 12 L/g.h for 5 hours. The K-promoted and Pt-promoted Co catalysts have different physicochemical properties and catalytic performances compared to that of the un-promoted Co catalyst. XPS analysis revealed that K and Pt promoters induced electronic modifications as exhibited by the shifts in the Co binding energies. Incorporation of 0.06 wt% K and 0.06 wt% Pt in Co/CNTs catalyst resulted in an increase in the CO conversion and C{sub 5+} selectivity and a decrease in methane selectivity. Potassium was found to be a better promoter for Co/CNTs catalyst compared to platinum.

Numerical Investigation of Size and Structure Effect on Tensile Characteristics of Symmetric and Asymmetric CNTs

Directory of Open Access Journals (Sweden)

Mahnaz Zakeri

2016-06-01

Full Text Available In this research, the influence of structure on the tensile properties of single- walled carbon nanotubes (CNTs is evaluated using molecular mechanics technique and finite element method. The effects of diameter, length and chiral angle on elastic modulus and Poisson’s ratio of armchair, zigzag and chiral structures are investigated. To simulate the CNTs, a 3D FEM code is developed using the ANSYS commercial software. Considering the carbon-carbon covalent bonds as connecting load-carrying beam elements, and the atoms as joints of the elements, CNTs are simulated as space-frame structures. The atomic potentials are estimated using harmonic simple functions. The numerical results show that by increasing the diameter and length to a certain amount, the size effect on tensile behavior of modeled nanotubes is omitted. In fact, for nanotubes with diameter over 2 nm and length over 36.5 nm the chiral angle is the only effective factor on the tensile properties. Also, it is found that the structure has a little effect on the elasticity modulus, which is about 4%. However, Poisson’s ratio can be affected significantly with chiral angle. Asymmetric structures with angles θ

Sequence alignment visualization in HTML5 without Java.

Science.gov (United States)

Gille, Christoph; Birgit, Weyand; Gille, Andreas

2014-01-01

Java has been extensively used for the visualization of biological data in the web. However, the Java runtime environment is an additional layer of software with an own set of technical problems and security risks. HTML in its new version 5 provides features that for some tasks may render Java unnecessary. Alignment-To-HTML is the first HTML-based interactive visualization for annotated multiple sequence alignments. The server side script interpreter can perform all tasks like (i) sequence retrieval, (ii) alignment computation, (iii) rendering, (iv) identification of a homologous structural models and (v) communication with BioDAS-servers. The rendered alignment can be included in web pages and is displayed in all browsers on all platforms including touch screen tablets. The functionality of the user interface is similar to legacy Java applets and includes color schemes, highlighting of conserved and variable alignment positions, row reordering by drag and drop, interlinked 3D visualization and sequence groups. Novel features are (i) support for multiple overlapping residue annotations, such as chemical modifications, single nucleotide polymorphisms and mutations, (ii) mechanisms to quickly hide residue annotations, (iii) export to MS-Word and (iv) sequence icons. Alignment-To-HTML, the first interactive alignment visualization that runs in web browsers without additional software, confirms that to some extend HTML5 is already sufficient to display complex biological data. The low speed at which programs are executed in browsers is still the main obstacle. Nevertheless, we envision an increased use of HTML and JavaScript for interactive biological software. Under GPL at: http://www.bioinformatics.org/strap/toHTML/.

A Novel Approach of Using Ground CNTs as the Carbon Source to Fabricate Uniformly Distributed Nano-Sized TiCx/2009Al Composites.

Science.gov (United States)

Wang, Lei; Qiu, Feng; Ouyang, Licheng; Wang, Huiyuan; Zha, Min; Shu, Shili; Zhao, Qinglong; Jiang, Qichuan

2015-12-17

Nano-sized TiC x /2009Al composites (with 5, 7, and 9 vol% TiC x ) were fabricated via the combustion synthesis of the 2009Al-Ti-CNTs system combined with vacuum hot pressing followed by hot extrusion. In the present study, CNTs were used as the carbon source to synthesize nano-sized TiC x particles. An attempt was made to correlate the effect of ground CNTs by milling and the distribution of synthesized nano-sized TiC x particles in 2009Al as well as the tensile properties of nano-sized TiC x /2009Al composites. Microstructure analysis showed that when ground CNTs were used, the synthesized nano-sized TiC x particles dispersed more uniformly in the 2009Al matrix. Moreover, when 2 h-milled CNTs were used, the 5, 7, and 9 vol% nano-sized TiC x /2009Al composites had the highest tensile properties, especially, the 9 vol% nano-sized TiC x /2009Al composites. The results offered a new approach to improve the distribution of in situ nano-sized TiC x particles and tensile properties of composites.

Remote and direct plasma regions for low-temperature growth of carbon nanotubes on glass substrates for display applications

International Nuclear Information System (INIS)

Tabatabaei, M K; Ghafouri fard, H; Koohsorkhi, J; Khatami, S; Mohajerzadeh, S

2011-01-01

A novel method for growing carbon nanotubes (CNTs) on glass substrates is introduced in this study. A two-stage plasma was used to achieve low-temperature and vertically aligned CNTs. Ni deposited on indium tin oxide/glass substrate was used as the catalyst and hydrogen and acetylene were used as gas feeds. In this investigation a new technique was developed to grow vertically aligned CNTs at temperatures below 400 deg. C while CNT growth by plasma-enhanced chemical vapour deposition required high temperatures. Low-temperature growth of vertically aligned CNTs was suitable for the fabrication of micro-lens and self-oriented displays on glass substrates. Also, we have reported a new configuration for CNT-based display by means of controlling the refractive index of liquid crystal around the CNT by applying a proper voltage to the top and bottom array.

Effect of process temperature on morphology of CNTs grown in a vertically fluidized bed reactor with Fe{sub 2}O{sub 3}/Al{sub 2}O{sub 3} catalyst

Energy Technology Data Exchange (ETDEWEB)

Shukrullah, Shazia, E-mail: zshukrullah@gmail.com; Mohamed, Norani Muti, E-mail: noranimuti-mohamed@petronas.com.my; Shaharun, Maizatul Shima, E-mail: maizats@petronas.com.my [Department of Fundamental and Applied Sciences, Universiti Teknologi PETRONAS, 31750 Tronoh, Perak (Malaysia)

2015-07-22

Carbon nanotubes (CNTs) are one of the most researched materials due to their exceptional mechanical and electrical properties. Among the various techniques, catalytic chemical vapor deposition in a fluidized bed reactor is the most promising technique for bulk production of CNTs. To meet the demand of good quality along with the bulk production of CNTs, the effect of reaction temperature on the micro structures, morphology, diameter, quality and quantity of CNTs was investigated in these studies. CNTs were synthesized at process temperature ranging from 700-850°C by catalytic decomposition of C{sub 2}H{sub 4} on Fe{sub 2}O{sub 3}/Al{sub 2}O{sub 3} catalyst a vertical fluidized bed reactor. The microstructures of the grown CNTs at different reaction temperatures were investigated by using scanning electron microscope. The results of this study depicted a positive correlation between the average diameter of CNTs and reaction temperature. Narrow diameters (35∼40 nm) of CNTs with fewer defects were found at the low and mild temperatures, in particular 800°C. At this temperature, a dynamic equilibrium between the rate of C{sub 2}H{sub 4} decomposition and CNTs quantity was found due to maximum carbon diffusion over catalyst. The CNTs produced with Fe{sub 2}O{sub 3}/Al{sub 2}O{sub 3} catalyst wer e also exhibiting high quality with relatively small mean outer diameter and fewer surface defects.

A pM leveled photoelectrochemical sensor for microcystin-LR based on surface molecularly imprinted TiO2@CNTs nanostructure.

Science.gov (United States)

Liu, Meichuan; Ding, Xue; Yang, Qiwei; Wang, Yu; Zhao, Guohua; Yang, Nianjun

2017-06-05

A simple and highly sensitive photoelectrochemical (PEC) sensor towards Microcystin-LR (MC-LR), a kind of typical cyanobacterial toxin in water samples, was developed on a surface molecular imprinted TiO 2 coated multiwalled carbon nanotubes (MI-TiO 2 @CNTs) hybrid nanostructure. It was synthesized using a feasible two-step sol-gel method combining with in situ surface molecular imprinting technique (MIT). With a controllable core-shell tube casing structure, the resultant MI-TiO 2 @CNTs are enhanced greatly in visible-light driven response capacity. In comparison with the traditional TiO 2 (P25) and non-imprinted (NI-)TiO 2 @CNTs, the MI-TiO 2 @CNTs based PEC sensor showed a much higher photoelectric oxidation capacity towards MC-LR. Using this sensor, the determination of MC-LR was doable in a wide linear range from 1.0pM to 3.0nM with a high photocurrent response sensitivity. An outstanding selectivity towards MC-LR was further achieved with this sensor, proven by simultaneously monitoring 100-fold potential co-existing interferences. The superiority of the obtained MC-LR sensor in sensitivity and selectivity is mainly attributed to the high specific surface area and excellent photoelectric activity of TiO 2 @CNTs heterojunction structure, as well as the abundant active recognition sites on its functionalized molecular imprinting surface. A promising PEC analysis platform with high sensitivity and selectivity for MC-LR has thus been provided. Copyright © 2017 Elsevier B.V. All rights reserved.

Sensitive methanol sensor based on PMMA-G-CNTs nanocomposites deposited onto glassy carbon electrodes.

Science.gov (United States)

Rahman, Mohammed M; Hussein, Mahmoud A; Alamry, Khalid A; Al Shehry, Faten M; Asiri, Abdullah M

2016-04-01

A new series of polymethyl methacrylate-graphene-carbon nanotubes crossbred nanocomposites in the form of PMMA-G-CNTs has been synthesized using simple dissolution procedure in organic media. The desired nanocomposites have been prepared using different loading (2 ∼ 30%) from consequently mixed GNPs/CNTs ratio and confirmed by various characterization techniques utilized to corroborate the assembly of these new hybrid series including X-ray diffraction analysis, Fourier transform infrared spectroscopy and scanning electron microscopy. The PMMA-G-CNTs nanocomposites were deposited on flat glassy carbon electrodes (GCE) to result in a sensor that has a fast response toward methanol in the phosphate buffer phase. Features including high sensitivity, low-sample volume, reliability, reproducibility, ease of integration, long-term stability, and enhanced electrochemical responses are investigated. The calibration plot is linear (r(2)=0.9895) over the 1.0 nmol L(-1) to 10.0 mmol L(-1) methanol concentration ranges. The sensitivity and detection limit is 13.491 µA cm(-2) mmol L(-2) and 0.39 ± 0.1 nmol L(-1) (at a signal-to-noise-ratio, SNR of 3), respectively. With such excellent features of analytical parameters, the developed sensor provides a new strategy for determination of methanol in biomedical and environmental analytes with satisfactory results. Copyright © 2015 Elsevier B.V. All rights reserved.

Laparoscopic partial nephrectomy for endophytic hilar tumors

DEFF Research Database (Denmark)

Di Pierro, G B; Tartaglia, N; Aresu, L

2014-01-01

To analyze feasibility and outcomes of laparoscopic partial nephrectomy (LPN) for endophytic hilar tumors in low-intermediate (ASA I-II) risk patients.......To analyze feasibility and outcomes of laparoscopic partial nephrectomy (LPN) for endophytic hilar tumors in low-intermediate (ASA I-II) risk patients....

Magnetic Alignment of Pulsed Solenoids Using the Pulsed Wire Method

International Nuclear Information System (INIS)

Arbelaez, D.; Madur, A.; Lipton, T.M.; Waldron, W.L.; Kwan, J.W.

2011-01-01

A unique application of the pulsed-wire measurement method has been implemented for alignment of 2.5 T pulsed solenoid magnets. The magnetic axis measurement has been shown to have a resolution of better than 25 (micro)m. The accuracy of the technique allows for the identification of inherent field errors due to, for example, the winding layer transitions and the current leads. The alignment system is developed for the induction accelerator NDCX-II under construction at LBNL, an upgraded Neutralized Drift Compression experiment for research on warm dense matter and heavy ion fusion. Precise alignment is essential for NDCX-II, since the ion beam has a large energy spread associated with the rapid pulse compression such that misalignments lead to corkscrew deformation of the beam and reduced intensity at focus. The ability to align the magnetic axis of the pulsed solenoids to within 100 pm of the induction cell axis has been demonstrated.

The optimization of CNT-PVA nanocomposite for mild steel coating: Effect of CNTs concentration on the corrosion rate of mild steel

Science.gov (United States)

Maryam, M.; Ibrahim, N. M. A. A.; Eswar, K. A.; Guliling, M.; Suhaimi, M. H. F.; Khusaimi, Z.; Abdullah, S.; Rusop, M.

2018-05-01

Carbon Nanotubes (CNTs) are molecular-scale tubes of graphitic carbon which have outstanding mechanical and magnetic properties with extraordinary strength. It can be said that CNTs can be used in coating application to prevent corrosion and lower the rate of corrosion on steel. However, CNT alone cannot be used for coating purposes. Therefore, by combining it with polymer to produce a nanocomposite thin film, it can be used for nanocoating on mild steel substrate. Polyvinyl alcohol (PVA) was chosen due to its high strength and high modulus polymer fibers and has the possibilities of improving the physicochemical properties of carbon nanotubes. Carbon nanotubes and polyvinyl alcohol (CNT-PVA) nanocomposite were prepared by using sol-gel method and coated as thin film on mild steel substrate by using spin coating. Sol-gel is a convenient technique used for the production of nanocomposite aqueous solution. Five samples were prepared at the different concentration of CNTs-PVA to verify the corrosion rate application. The samples were then characterized by Field Emission Scanning Electron Microscopy (FESEM) and Atomic Force Microscopy (AFM) obtaining the structural properties, surface morphology and topography of samples. Raman spectroscopy was used to determine the microraman spectra of CNTs which showed the quality and purity of samples. Finally, corrosion test was done to measure the corrosion rate of samples at the different concentration of CNTs/PVA nanocomposite.

Enhanced field emission properties of vertically aligned double-walled carbon nanotube arrays

International Nuclear Information System (INIS)

Chen, Guohai; Shin, Dong Hoon; Lee, Cheol Jin; Iwasaki, Takayuki; Kawarada, Hiroshi

2008-01-01

Vertically aligned double-walled carbon nanotube (VA-DWCNT) arrays were synthesized by point-arc microwave plasma chemical vapor deposition on Cr/n-Si and SiO 2 /n-Si substrates. The outer tube diameters of VA-DWCNTs are in the range of 2.5-3.8 nm, and the average interlayer spacing is approximately 0.42 nm. The field emission properties of these VA-DWCNTs were studied. It was found that a VA-DWCNT array grown on a Cr/n-Si substrate had better field emission properties as compared with a VA-DWCNT array grown on a SiO 2 /n-Si substrate and randomly oriented DWCNTs, showing a turn-on field of about 0.85 V μm -1 at the emission current density of 0.1 μA cm -2 and a threshold field of 1.67 V μm -1 at the emission current density of 1.0 mA cm -2 . The better field emission performance of the VA-DWCNT array was mainly attributed to the vertical alignment of DWCNTs on the Cr/n-Si substrate and the low contact resistance between CNTs and the Cr/n-Si substrate

Synthesis and Investigation of Millimeter-Scale Vertically Aligned Boron Nitride Nanotube Arrays

Science.gov (United States)

Tay, Roland; Li, Hongling; Tsang, Siu Hon; Jing, Lin; Tan, Dunlin; Teo, Edwin Hang Tong

Boron nitride nanotubes (BNNTs) have shown potential in a wide range of applications due to their superior properties such as exceptionally high mechanical strength, excellent chemical and thermal stabilities. However, previously reported methods to date only produced BNNTs with limited length/density and insufficient yield at high temperatures. Here we present a facile and effective two-step synthesis route involving template-assisted chemical vapor deposition at a relatively low temperature of 900 degree C and subsequent annealing process to fabricate vertically aligned (VA) BN coated carbon nanotube (VA-BN/CNT) and VA-BNNT arrays. By using this method, we achieve the longest VA-BN/CNTs and VA-BNNTs to date with lengths of over millimeters (exceeding two orders of magnitude longer than the previously reported length of VA-BNNTs). In addition, the morphology, chemical composition and microstructure of the resulting products, as well as the mechanism of coating process are systematically investigated. This versatile BN coating technique and the synthesis of millimeter-scale BN/CNT and BNNT arrays pave a way for new applications especially where the aligned geometry of the NTs is essential such as for field-emission, interconnects and thermal management.

Forces, energetics, and dynamics of conjugated-carbon ring tethers adhered to CNTs: a computational investigation.

Science.gov (United States)

Filla, Nicholas; Ramasamy, Ramaraja; Wang, Xianqiao

2018-04-25

The strength and nature of the interactions between carbon nanotubes (CNTs) and molecular tethers plays a vital role in technology such as CNT-enzyme sensors. Tethers that attach noncovalently to CNTs are ideal for retaining the electrical properties of the CNTs since they do not degrade the CNT surface and effect its electrical conductivity. However, leaching due to weak CNT-tether attachment is very common when using noncovalent tethers, and this has limited their use in commercial products including biosensors. Thus, understanding the fundamental mechanics governing the strength of CNT-tether adhesion is crucial for the design of highly sensitive, viable sensors. Here, we computationally investigate the adhesion strength of CNT-tether complexes with 8 different tethering molecules designed to adhere noncovalently to the CNT surface. We study the effects of CNT diameter, CNT chirality, and the size/geometry of the tethering molecule on the adhesion energy and force. Our results show an asymptotic relationship between adhesion strength and CNT diameter. Calculations show that noncovalent tethers tested here can reach adhesion forces and energies that are up to 21% and 54% of the strength of the carbon-carbon single bond force and bond energy respectively. We anticipate our results will help guide CNT-enzyme sensor design to produce sensors with high sensitivity and minimal leaching.

Targeting property and toxicity of a novel ultrasound contrast agent microbubble carrying the targeting and drug-loaded complex FA-CNTs-PTX on MCF7 cells.

Science.gov (United States)

Zhang, Jie; Zhang, Yu; Liu, Junxi; Li, Guozhong; Wen, Zhaohui; Zhao, Yue; Zhang, Xiangyu; Liu, Fenghua

2017-10-01

The application of ultrasound contrast agents not only is confined to the enhancement of ultrasound imaging but also has started to be used as a drug system for diagnosis and treatment. In this paper, Span60 and PEG1500 were used as membrane materials, and a new targeting and drug-loading multifunctional ultrasound contrast agent microbubble enveloping the FA-CNTs-PTX complex was successfully prepared by acoustic cavitation. With the breast cancer cell line MCF7 as the research target, the effects of the microbubble with FA-CNTs-PTX on the proliferation and toxicity of MCF7 cells were studied using a CCK-8 and AO/EB double-staining method. The influences of the microbubbles with FA-CNTs-PTX on the cellular morphology and apoptosis period of the MCF7 cells were detected using an inverted fluorescence microscope. The apoptosis of MCF7 cells induced by the microbubbles with FA-CNTs-PTX was investigated with flow cytometry and an annexin and PI double staining fluorescence quantitative analysis. The results indicated that the ultrasound contrast agent microbubble with FA-CNTs-PTX remarkably inhibited the proliferation of MCF7 cells, which was mainly controlled by the drug loading rate and the nanometer size of the microbubbles. Moreover, the proliferative inhibition rate of the microbubbles with FA-CNTs-PTX was related to the cell apoptosis period of MCF7 cells. Its inhibition degree on the proliferation of MCF7 cells was higher than that of the hepatoma HepG2 cells. The apoptosis rate of MCF7 cells induced by the microbubbles with FA-CNTs-PTX was higher than that of normal human umbilical vein endothelial cells (HUVECs), and the microbubbles with FA-CNTs-PTX could target the MCF7 cells. Copyright © 2017 Elsevier B.V. All rights reserved.

BDNF and AMPA receptors in the cNTS modulate the hyperglycemic reflex after local carotid body NaCN stimulation.

Science.gov (United States)

Cuéllar, R; Montero, S; Luquín, S; García-Estrada, J; Melnikov, V; Virgen-Ortiz, A; Lemus, M; Pineda-Lemus, M; de Álvarez-Buylla, E

2017-07-01

The application of sodium cyanide (NaCN) to the carotid body receptors (CBR) (CBR stimulation) induces rapid blood hyperglycemia and an increase in brain glucose retention. The commissural nucleus tractus solitarius (cNTS) is an essential relay nucleus in this hyperglycemic reflex; it receives glutamatergic afferents (that also release brain derived neurotrophic factor, BDNF) from the nodose-petrosal ganglia that relays CBR information. Previous work showed that AMPA in NTS blocks hyperglycemia and brain glucose retention after CBR stimulation. In contrast, BDNF, which attenuates glutamatergic AMPA currents in NTS, enhances these glycemic responses. Here we investigated the combined effects of BDNF and AMPA (and their antagonists) in NTS on the glycemic responses to CBR stimulation. Microinjections of BDNF plus AMPA into the cNTS before CBR stimulation in anesthetized rats, induced blood hyperglycemia and an increase in brain arteriovenous (a-v) of blood glucose concentration difference, which we infer is due to increased brain glucose retention. By contrast, the microinjection of the TrkB antagonist K252a plus AMPA abolished the glycemic responses to CBR stimulation similar to what is observed after AMPA pretreatments. In BDNF plus AMPA microinjections preceding CBR stimulation, the number of c-fos immunoreactive cNTS neurons increased. In contrast, in the rats microinjected with K252a plus AMPA in NTS, before CBR stimulation, c-fos expression in cNTS decreased. The expression of AMPA receptors GluR2/3 did not change in any of the studied groups. These results indicate that BDNF in cNTS plays a key role in the modulation of the hyperglycemic reflex initiated by CBR stimulation. Copyright © 2017. Published by Elsevier B.V.

Preparation and characterization of CNTs/UHMWPE nanocomposites via a novel mixer under synergy of ultrasonic wave and extensional deformation.

Science.gov (United States)

Yin, Xiaochun; Li, Sai; He, Guangjian; Feng, Yanhong; Wen, Jingsong

2018-05-01

In this work, design and development of a new melt mixing method and corresponding mixer for polymer materials were reported. Effects of ultrasonic power and sonication time on the carbon nanotubes (CNTs) filled ultra high molecular weight polyethylene (UHMWPE) nanocomposites were experimentally studied. Transmission Electron Microscopy images showed that homogeneous dispersion of CNTs in intractable UHMWPE matrix is successfully realized due to the synergetic effect of ultrasonic wave and extensional deformation without any aid of other additives or solvents. Differential scanning calorimetry results revealed an increase in crystallinity and crystallization rate due to the finer dispersion of the CNTs in the matrix which act as nucleating point. Composites' complex viscosity and storage modulus decreased sharply at first and then leveled off with the increase of sonication time or the ultrasonic power. The thermal stability and the tensile strength of the CNTs/UHMWPE nanocomposites improved by using this novel mixing method. This is the first method that combined the ultrasonic wave and the extensional deformation in which the elongation rate, sonication time and ultrasonic power can be adjusted simultaneously during mixing. The novel mixer offers several advantages such as environment-friendly, high mixing efficiency, self-cleaning and wide adaptability to materials. Copyright © 2017 Elsevier B.V. All rights reserved.

Core-shell structured MnSiO3 supported with CNTs as a high capacity anode for lithium-ion batteries.

Science.gov (United States)

Feng, Jing; Li, Qin; Wang, Huijun; Zhang, Min; Yang, Xia; Yuan, Ruo; Chai, Yaqin

2018-04-17

Metal silicates are good candidates for use in lithium ion batteries (LIBs), however, their electrochemical performance is hindered by their poor electrical conductivity and volume expansion during Li+ insertion/desertion. In this work, one-dimensional core-shell structured MnSiO3 supported with carbon nanotubes (CNTs) (referred to as CNT@MnSiO3) with good conductivity and electrochemical performance has been successfully synthesized using a solvothermal process under moderate conditions. In contrast to traditional composites of CNTs and nanoparticles, the CNT@MnSiO3 composite in this work is made up of CNTs with a layer of MnSiO3 on the surface. The one-dimensional CNT@MnSiO3 nanotubes provide a useful channel for transferring Li+ ions during the discharge/charge process, which accelerates the Li+ diffusion speed. The CNTs inside the structure not only enhance the conductivity of the composite, but also prevent volume expansion. A high reversible capacity (920 mA h g-1 at 500 mA g-1 over 650 cycles) and good rate performance were obtained for CNT@MnSiO3, showing that this strategy of synthesizing coaxial CNT@MnSiO3 nanotubes offers a promising method for preparing other silicates for LIBs or other applications.

Controlling the branching ratio of photodissociation using aligned molecules

DEFF Research Database (Denmark)

Larsen, J.J.; Wendt-Larsen, I.; Stapelfeldt, H.

1999-01-01

Using a sample of iodine molecules, aligned by a strong, linearly polarized laser pulse, we control the branching ratio of the I+I and I+I* photodissociation channels by a factor of 26. The control relies on selective photoexcitation of two potential curves that each correlate adiabatically...

Investigation on I-V for Different Heating Temperatures of Nanocomposited MEH-PPV:CNTs Organic Solar Cells

Directory of Open Access Journals (Sweden)

M. S. P. Sarah

2012-01-01

Full Text Available This paper discussed the effect of different thermal evaporation treatments for nanocomposited MEH-PPV:CNTs thin films towards the performance of organic solar cells. The configuration of the organic solar cells is ITO/MEH-PPV:CNTs/Au. The heating temperature was varied from, as deposited, 50°C, 75°C, and 100°C. From the results, we observed that the efficiency increase slightly before decreasing back at 100°C. The highest efficiency was solar cells heated at 75°C with efficiency 0.001% which is supported by the I-V characteristics and also by the absorption spectra.

Preparation and characterization of AuNPs/CNTs-ErGO electrochemical sensors for highly sensitive detection of hydrazine.

Science.gov (United States)

Zhao, Zhenting; Sun, Yongjiao; Li, Pengwei; Zhang, Wendong; Lian, Kun; Hu, Jie; Chen, Yong

2016-09-01

A highly sensitive electrochemical sensor of hydrazine has been fabricated by Au nanoparticles (AuNPs) coating of carbon nanotubes-electrochemical reduced graphene oxide composite film (CNTs-ErGO) on glassy carbon electrode (GCE). Cyclic voltammetry and potential amperometry have been used to investigate the electrochemical properties of the fabricated sensors for hydrazine detection. The performances of the sensors were optimized by varying the CNTs to ErGO ratio and the quantity of Au nanoparticles. The results show that under optimal conditions, a sensitivity of 9.73μAμM(-1)cm(-2), a short response time of 3s, and a low detection limit of 0.065μM could be achieved with a linear concentration response range from 0.3μM to 319μM. The enhanced electrochemical performances could be attributed to the synergistic effect between AuNPs and CNTs-ErGO film and the outstanding catalytic effect of the Au nanoparticles. Finally, the sensor was successfully used to analyse the tap water, showing high potential for practical applications. Copyright © 2016 Elsevier B.V. All rights reserved.

Comparative Analysis of Mass Spectral Similarity Measures on Peak Alignment for Comprehensive Two-Dimensional Gas Chromatography Mass Spectrometry

Science.gov (United States)

2013-01-01

Peak alignment is a critical procedure in mass spectrometry-based biomarker discovery in metabolomics. One of peak alignment approaches to comprehensive two-dimensional gas chromatography mass spectrometry (GC×GC-MS) data is peak matching-based alignment. A key to the peak matching-based alignment is the calculation of mass spectral similarity scores. Various mass spectral similarity measures have been developed mainly for compound identification, but the effect of these spectral similarity measures on the performance of peak matching-based alignment still remains unknown. Therefore, we selected five mass spectral similarity measures, cosine correlation, Pearson's correlation, Spearman's correlation, partial correlation, and part correlation, and examined their effects on peak alignment using two sets of experimental GC×GC-MS data. The results show that the spectral similarity measure does not affect the alignment accuracy significantly in analysis of data from less complex samples, while the partial correlation performs much better than other spectral similarity measures when analyzing experimental data acquired from complex biological samples. PMID:24151524

ORF Alignment: NC_002977 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available (Methane ... hydroxylase) pdb|1FZI|F Chain F, Methane Monooxygenase ... Hydroxylase, Form I Press...roxylase, ... Form I Pressurized With Xenon Gas pdb|1FZH|F Chain F, ... Methane Monooxygenase Hydroxylase, Form Ii Pres... ... Hydroxylase, Form Ii Pressurized With Xenon Gas ... pdb|1FZ9|F Chain F

Development and application of carbon nanotubes assisted electromembrane extraction (CNTs/EME) for the determination of buprenorphine as a model of basic drugs from urine samples.

Science.gov (United States)

Hasheminasab, Kobra Sadat; Fakhari, Ali Reza

2013-03-12

In this work carbon nanotubes assisted electromembrane extraction (CNTs/EME) coupled with capillary electrophoresis (CE) and ultraviolet (UV) detection was developed for the determination of buprenorphine as a model of basic drugs from urine samples. Carbon nanotubes reinforced hollow fiber was used in this research. Here the CNTs serve as a sorbent and provide an additional pathway for solute transport. The presence of CNTs in the hollow fiber wall increased the effective surface area and the overall partition coefficient on the membrane; and lead to an enhancement in the analyte transport. For investigating the influence of the presence of CNTs in the SLM on the extraction efficiency, a comparative study was carried out between EME and CNTs/EME methods. Optimization of the variables affecting these methods was carried out in order to achieve the best extraction efficiency. Optimal extractions were accomplished with NPOE as the SLM, with 200V as the driving force, and with pH 2.0 in the donor and pH 1.0 in the acceptor solutions with the whole assembly agitated at 750rpm after 25min and 15min for EME and CNTs/EME, respectively. Under the optimized conditions, in comparison with the conventional EME method, CNTs/EME provided higher extraction efficiencies in shorter time. This method provided lower limit of detection (1ngmL(-1)), higher preconcentration factor (185) and higher recovery (92). Finally, the applicability of this method was evaluated by the extraction and determination of buprenorphine in patients' urine samples. Copyright © 2013 Elsevier B.V. All rights reserved.

The electrochemical selective reduction of NO using CoSe2@CNTs hybrid.

Science.gov (United States)

Liu, Hui; Xiang, Kaisong; Yang, Bentao; Xie, Xiaofeng; Wang, Dongli; Zhang, Cong; Liu, Zhilou; Yang, Shu; Liu, Cao; Zou, Jianping; Chai, Liyuan

2017-06-01

Converting the NO from gaseous pollutant into NH 4 + through electrocatalytical reduction using cost-effective materials holds great promise for pollutant purifying and resources recycling. In this work, we developed a highly selective and stable catalyst CoSe 2 nanoparticle hybridized with carbon nanotubes (CoSe 2 @CNTs). The CoSe 2 @CNTs hybrid catalysts performed an extraordinary high selectivity for NH 4 + formation in NO electroreduction with minimal N 2 O production and H 2 evolution. The specific spatial structure of CoSe 2 is conductive to the predominant formation of N-H bond between the N from adsorbed NO and H and inhibition of N-N formation from adjacent adsorbed NO. It was also the first time to convert the coordinated NO into NH 4 + using non-noble metal catalysis. Moreover, the original concept of employing CoSe 2 as eletrocatalyst for NO hydrogenation presented in this work can broaden horizons and provide new dimensions in the design of new highly efficient catalysts for NH 4 + synthesis in aqueous solution.

ORF Alignment: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_002655 gi|15803232 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

ORF Alignment: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_000913 gi|49176263 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

ORF Alignment: NC_002695 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_002695 gi|15832825 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

In-situ grown CNTs modified SiO2/C composites as anode with improved cycling stability and rate capability for lithium storage

Science.gov (United States)

Wang, Siqi; Zhao, Naiqin; Shi, Chunsheng; Liu, Enzuo; He, Chunnian; He, Fang; Ma, Liying

2018-03-01

Silica (SiO2) is regarded as one of the most promising anode materials for lithium ion batteries owing to its high theoretical specific capacity, relatively low operation potentials, abundance, environmental benignity and low cost. However, the low intrinsic electrical conductivity and large volume change of SiO2 during the discharge/charge cycles usually results in poor electrochemical performance. In this work, carbon nanotubes (CNTs) modified SiO2/C composites have been fabricated through an in-situ chemical vapor deposition method. The results show that the electrical conductivity of the SiO2/C/CNTs is visibly enhanced through a robust connection between the CNTs and SiO2/C particles. Compared with the pristine SiO2 and SiO2/C composites, the SiO2/C/CNTs composites display a high initial capacity of 1267.2 mA h g-1. Besides, an excellent cycling stability with the capacity of 315.7 mA h g-1 is achieved after 1000th cycles at a rate of 1 A g-1. The significantly improved electrochemical properties of the SiO2/C/CNTs composites are mainly attributed to the formation of three dimensional CNT networks in the SiO2/C substrate, which can not only shorten the Li-ion diffusion path but also relieve the volume change during the lithium-ion insertion/extraction processes.

Engineering of oriented carbon nanotubes in composite materials

Science.gov (United States)

Beigmoradi, Razieh; Mohebbi-Kalhori, Davod

2018-01-01

The orientation and arrangement engineering of carbon nanotubes (CNTs) in composite structures is considered a challenging issue. In this regard, two groups of in situ and ex situ techniques have been developed. In the first, the arrangement is achieved during CNT growth, while in the latter, the CNTs are initially grown in random orientation and the arrangement is then achieved during the device integration process. As the ex situ techniques are free from growth restrictions and more flexible in terms of controlling the alignment and sorting of the CNTs, they are considered by some as the preferred technique for engineering of oriented CNTs. This review focuses on recent progress in the improvement of the orientation and alignment of CNTs in composite materials. Moreover, the advantages and disadvantages of the processes are discussed as well as their future outlook. PMID:29515955

Glutamatergic Receptor Activation in the Commisural Nucleus Tractus Solitarii (cNTS) Mediates Brain Glucose Retention (BGR) Response to Anoxic Carotid Chemoreceptor (CChr) Stimulation in Rats.

Science.gov (United States)

Cuéllar, R; Montero, S; Luquín, S; García-Estrada, J; Dobrovinskaya, O; Melnikov, V; Lemus, M; de Álvarez-Buylla, E Roces

2015-01-01

Glutamate, released from central terminals of glossopharyngeal nerve, is a major excitatory neurotransmitter of commissural nucleus tractus solitarii (cNTS) afferent terminals, and brain derived neurotrophic factor (BDNF) has been shown to attenuate glutamatergic AMPA currents in NTS neurons. To test the hypothesis that AMPA contributes to glucose regulation in vivo modulating the hyperglycemic reflex with brain glucose retention (BGR), we microinjected AMPA and NBQX (AMPA antagonist) into the cNTS before carotid chemoreceptor stimulation in anesthetized normal Wistar rats, while hyperglycemic reflex an brain glucose retention (BGR) were analyzed. To investigate the underlying mechanisms, GluR2/3 receptor and c-Fos protein expressions in cNTS neurons were determined. We showed that AMPA in the cNTS before CChr stimulation inhibited BGR observed in aCSF group. In contrast, NBQX in similar conditions, did not modify the effects on glucose variables observed in aCSF control group. These experiments suggest that glutamatergic pathways, via AMPA receptors, in the cNTS may play a role in glucose homeostasis.

Analysis of Charge Transfer for in Situ Li Intercalated Carbon Nanotubes

KAUST Repository

Rana, Kuldeep

2012-05-24

Vertically aligned carbon nanotube (VA-CNT) arrays have been synthesized with lithium (Li) intercalation through an alcohol-catalyzed chemical vapor deposition technique by using a Li-containing catalyst. Scanning electron microscopy images display that synthesized carbon nanotubes (CNTs) are dense and vertically aligned. The effect of the Li-containing catalyst on VA-CNTs has been studied by using Raman spectroscopy, X-ray photoelectron spectroscopy (XPS), and electron energy loss spectroscopy (EELS). XPS results show the change in binding energy of Li 1s and C 1s peaks, which indicates that Li is inserted in VA-CNTs during growth. Analysis of Raman spectra reveals that the G-band profile of CNTs synthesized with the Li-containing catalyst is shifted, suggesting an electronic interaction between Li and neighboring C atoms of the CNTs. The EELS spectra of the C K edge and Li K edge from CNTs also confirmed that Li is inserted into CNTs during synthesis. We have performed ab inito calculations based on density functional theory for a further understanding of the structural and electronic properties of Li intercalated CNTs, especially addressing the controversial charge-transfer state between Li and C. © 2012 American Chemical Society.

Analysis of Charge Transfer for in Situ Li Intercalated Carbon Nanotubes

KAUST Repository

Rana, Kuldeep; Kucukayan-Dogu, Gokce; Sen, H. Sener; Boothroyd, Chris; Gulseren, Oguz; Bengu, Erman

2012-01-01

Vertically aligned carbon nanotube (VA-CNT) arrays have been synthesized with lithium (Li) intercalation through an alcohol-catalyzed chemical vapor deposition technique by using a Li-containing catalyst. Scanning electron microscopy images display that synthesized carbon nanotubes (CNTs) are dense and vertically aligned. The effect of the Li-containing catalyst on VA-CNTs has been studied by using Raman spectroscopy, X-ray photoelectron spectroscopy (XPS), and electron energy loss spectroscopy (EELS). XPS results show the change in binding energy of Li 1s and C 1s peaks, which indicates that Li is inserted in VA-CNTs during growth. Analysis of Raman spectra reveals that the G-band profile of CNTs synthesized with the Li-containing catalyst is shifted, suggesting an electronic interaction between Li and neighboring C atoms of the CNTs. The EELS spectra of the C K edge and Li K edge from CNTs also confirmed that Li is inserted into CNTs during synthesis. We have performed ab inito calculations based on density functional theory for a further understanding of the structural and electronic properties of Li intercalated CNTs, especially addressing the controversial charge-transfer state between Li and C. © 2012 American Chemical Society.

Experimental initial partial polymerization method for Fuji II placement evaluated for microleakage with/without Fuji Coat.

Science.gov (United States)

Chen, J W; Fletcher, B; Roggenkamp, C L

2013-01-01

This laboratory study evaluated an experimental 1-second initial partial polymerization (IPP) technique using Fuji II LC vs the manufacturer's standard placement (control), both with and without Fuji Coat, relative to microleakage. Class V restorative preparations were placed on the buccal and lingual aspects of 30 permanent, caries-free and restoration-free, third molar teeth. Fuji II LC restorations were placed either following manufacturer-specified guidelines or IPP for 1 second prior to contouring and full light curing. Half of the restorations were placed using the IPP experimental technique and half of the teeth were finished using Fuji Coat LC. Following thermocycling, specimens were sectioned and dye penetration was measured. SPSS 16 was used for statistical analysis (pCoat LC results in further diminished microleakage.

ORF Alignment: NC_002977 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available xylase) pdb|1FZI|D Chain D, Methane Monooxygenase ... Hydroxylase, Form I Pressurized With Xenon Gas ... ... pdb|1FZI|C Chain C, Methane Monooxygenase Hydroxylase, ... Form I Pressurized With Xenon G...as pdb|1FZH|D Chain D, ... Methane Monooxygenase Hydroxylase, Form Ii Press...urized ... With Xenon Gas pdb|1FZH|C Chain C, Methane Monooxygenase ... Hydroxylase, Form Ii Press

Prospective, Head-to-Head Study of Three Computerized Neurocognitive Assessment Tools (CNTs): Reliability and Validity for the Assessment of Sport-Related Concussion.

Science.gov (United States)

Nelson, Lindsay D; LaRoche, Ashley A; Pfaller, Adam Y; Lerner, E Brooke; Hammeke, Thomas A; Randolph, Christopher; Barr, William B; Guskiewicz, Kevin; McCrea, Michael A

2016-01-01

Limited data exist comparing the performance of computerized neurocognitive tests (CNTs) for assessing sport-related concussion. We evaluated the reliability and validity of three CNTs-ANAM, Axon Sports/Cogstate Sport, and ImPACT-in a common sample. High school and collegiate athletes completed two CNTs each at baseline. Concussed (n=165) and matched non-injured control (n=166) subjects repeated testing within 24 hr and at 8, 15, and 45 days post-injury. Roughly a quarter of each CNT's indices had stability coefficients (M=198 day interval) over .70. Group differences in performance were mostly moderate to large at 24 hr and small by day 8. The sensitivity of reliable change indices (RCIs) was best at 24 hr (67.8%, 60.3%, and 47.6% with one or more significant RCIs for ImPACT, Axon, and ANAM, respectively) but diminished to near the false positive rates thereafter. Across time, the CNTs' sensitivities were highest in those athletes who became asymptomatic within 1 day before neurocognitive testing but was similar to the tests' false positive rates when including athletes who became asymptomatic several days earlier. Test-retest reliability was similar among these three CNTs and below optimal standards for clinical use on many subtests. Analyses of group effect sizes, discrimination, and sensitivity and specificity suggested that the CNTs may add incrementally (beyond symptom scores) to the identification of clinical impairment within 24 hr of injury or within a short time period after symptom resolution but do not add significant value over symptom assessment later. The rapid clinical recovery course from concussion and modest stability probably jointly contribute to limited signal detection capabilities of neurocognitive tests outside a brief post-injury window. (JINS, 2016, 22, 24-37).

Controlling the Sn-C bonds content in SnO2@CNTs composite to form in situ pulverized structure for enhanced electrochemical kinetics.

Science.gov (United States)

Cheng, Yayi; Huang, Jianfeng; Qi, Hui; Cao, Liyun; Luo, Xiaomin; Li, Jiayin; Xu, Zhanwei; Yang, Jun

2017-12-07

The Sn-C bonding content between the SnO 2 and CNTs interface was controlled by the hydrothermal method and subsequent heat treatment. Electrochemical analysis found that the SnO 2 @CNTs with high Sn-C bonding content exhibited much higher capacity contribution from alloying and conversion reaction compared with the low content of Sn-C bonding even after 200 cycles. The high Sn-C bonding content enabled the SnO 2 nanoparticles to stabilize on the CNTs surface, realizing an in situ pulverization process of SnO 2 . The in situ pulverized structure was beneficial to maintain the close electrochemical contact of the working electrode during the long-term cycling and provide ultrafast transfer paths for lithium ions and electrons, which promoted the alloying and conversion reaction kinetics greatly. Therefore, the SnO 2 @CNTs composite with high Sn-C bonding content displayed highly reversible alloying and conversion reaction. It is believed that the composite could be used as a reference for design chemically bonded metal oxide/carbon composite anode materials in lithium-ion batteries.

Alignment of dust grains in ionized regions

Science.gov (United States)

Anderson, Nels; Watson, William D.

1993-01-01

The rate at which charged dust grains in a plasma are torqued by passing ions and electrons is calculated. When photo-emission of electrons is not important, attraction of ions by the grain monopole potential increases the rate at which the grains' spins are dealigned by nearly an order of magnitude. Consequently, the energy density of the magnetic field required to align grains in an H II region may be increased by about an order of magnitude. In contrast, electric dipole and quadrupole moments are unlikely to produce large dealignment rates for grains of modest length-to-width ratio. Nonetheless, for positively charged grains these higher-order moments likely prevent monopole repulsion of ions from reducing the dealignment rate far below that for neutral grains. The presence of positive grain charge therefore does not greatly facilitate grain alignment in an H II region.

Wurtzite/zinc-blende electronic-band alignment in basal-plane stacking faults in semi-polar GaN

Science.gov (United States)

Monavarian, Morteza; Hafiz, Shopan; Izyumskaya, Natalia; Das, Saikat; Özgür, Ümit; Morkoç, Hadis; Avrutin, Vitaliy

2016-02-01

Heteroepitaxial semipolar and nonpolar GaN layers often suffer from high densities of extended defects including basal plane stacking faults (BSFs). BSFs which are considered as inclusions of cubic zinc-blende phase in wurtzite matrix act as quantum wells strongly affecting device performance. Band alignment in BSFs has been discussed as type of band alignment at the wurtzite/zinc blende interface governs the response in differential transmission; fast decay after the pulse followed by slow recovery due to spatial splitting of electrons and heavy holes for type- II band alignment in contrast to decay with no recovery in case of type I band alignment. Based on the results, band alignment is demonstrated to be of type II in zinc-blende segments in wurtzite matrix as in BSFs.

Real-time alignment and calibration of the LHCb Detector in Run II

CERN Multimedia

Dujany, Giulio

2016-01-01

Stable, precise spatial alignment and PID calibration are necessary to achieve optimal detector performance. During Run2, LHCb has a new real-time detector alignment and calibration to allow equivalent performance in the online and offline reconstruction to be reached. This offers the opportunity to optimise the event selection by applying stronger constraints, and to use hadronic particle identification at the trigger level. The computing time constraints are met through the use of a new dedicated framework using the multi-core farm infrastructure for the trigger. The motivation for a real-time alignment and calibration of the LHCb detector is discussed from the operative and physics performance point of view. Specific challenges of this configuration are discussed, as well as the designed framework and its performance.

Real-time alignment and calibration of the LHCb Detector in Run II

CERN Multimedia

Dujany, Giulio

2015-01-01

Stable, precise spatial alignment and PID calibration are necessary to achieve optimal detector performance. During Run2, LHCb will have a new real-time detector alignment and calibration to allow equivalent performance in the online and offline reconstruction to be reached. This offers the opportunity to optimise the event selection by applying stronger constraints, and to use hadronic particle identification at the trigger level. The computing time constraints are met through the use of a new dedicated framework using the multi-core farm infrastructure for the trigger. The motivation for a real-time alignment and calibration of the LHCb detector is discussed from the operative and physics performance point of view. Specific challenges of this configuration are discussed, as well as the designed framework and its performance.

Production of carbonaceous materials with various lengths in small spheroidal fullerenes and long CNTs by tunable multi-walled carbon nanotube cutting

Energy Technology Data Exchange (ETDEWEB)

Kim, Seung Hoi; Shin, Ueon Sang [Dankook University, Cheonan (Korea, Republic of)

2016-10-15

Tunable cutting of multi-walled carbon nanotubes (CNTs) using high pressure homogenizer and/or HNO{sub 3}/H{sub 2}SO{sub 4} solution was accomplished, resulting in the production of short CNTs with minimum length of 35 nm. Field emission scanning electron microscopy (FE-SEM) and Zeta sizer analysis showed significant reduction of CNT length from this tunable cutting (e.g. from long and entangled pristine CNTs at about 20 μm to ≥1000 nm, ⁓400 nm, ⁓200 nm, and ⁓100 nm via high pressure jet-spraying cutting within 5 h, while chemical cutting process using greatly longer hours (48 h) showed a reduction only to about 1000 nm). When CNT sample of average 1000 nm length previously shortened by HNO{sub 3}/H{sub 2}SO{sub 4} was subjected to the high pressure jet-spraying cutting process, the reduction progressed faster (≤1 h), producing ≥35 nm. Fourier transform infrared spectra and thermogravimetric analysis (TGA) indicated restricted formation of hydrophilic functional groups such as carboxylic group and hydroxyl group in the high pressure jet-spraying cutting, whereas an intensive formation of hydrophilic functional groups on the surface of shortened CNT samples was found after chemical cutting. Such short CNT samples would fulfill the requirements for carbonaceous materials with various lengths in small spheroidal fullerenes and long CNTs. The short CNTs produced are promising for scientific and technological applications in many fields such as electronics, diagnostics, pharmaceuticals, biomedical engineering, and environmental or energy industries.

Cast Partial Denture versus Acrylic Partial Denture for Replacement of Missing Teeth in Partially Edentulous Patients

Directory of Open Access Journals (Sweden)

Pramita Suwal

2017-03-01

Full Text Available Aim: To compare the effects of cast partial denture with conventional all acrylic denture in respect to retention, stability, masticatory efficiency, comfort and periodontal health of abutments. Methods: 50 adult partially edentulous patient seeking for replacement of missing teeth having Kennedy class I and II arches with or without modification areas were selected for the study. Group-A was treated with cast partial denture and Group-B with acrylic partial denture. Data collected during follow-up visit of 3 months, 6 months, and 1 year by evaluating retention, stability, masticatory efficiency, comfort, periodontal health of abutment. Results: Chi-square test was applied to find out differences between the groups at 95% confidence interval where p = 0.05. One year comparison shows that cast partial denture maintained retention and stability better than acrylic partial denture (p< 0.05. The masticatory efficiency was significantly compromising from 3rd month to 1 year in all acrylic partial denture groups (p< 0.05. The comfort of patient with cast partial denture was maintained better during the observation period (p< 0.05. Periodontal health of abutment was gradually deteriorated in all acrylic denture group (p

Investigation on VOX/CNTS Nanocomposites Act as Electrode of Supercapacitors

Science.gov (United States)

Zhu, Quanyao; Li, Zhaolong; Zhang, Xiaoyan; Huang, Shengnan; Yu, Yue; Chen, Wen; Zakharova, Galina S.

2013-07-01

The VOx/CNTs nanocomposites were synthesized by the hydrothermal method. The structure and morphologies of the nanocomposites were characteristic by XRD, SEM and TEM. The electrochemical properties of the nanocomposites were explored by cyclic voltammetry, constant current charge/discharge testing and electrochemical impedance spectroscopy in 1M KNO3 aqueous solution. The results showed that the nanocomposites perform characteristics of electrical both double-layer capacitance and pseudocapacitance. The specific capacitances were 136.5F/g, when the current density was 0.15A/g.

CMS Alignement and Calibration workflows: lesson learned and future plans

CERN Document Server

AUTHOR|(CDS)2069172

2014-01-01

We review the online and offline workflows designed to align and calibrate the CMS detector. Starting from the gained experience during the first LHC run, we discuss the expected developments for Run II. In particular, we describe the envisioned different stages, from the alignment using cosmic rays data to the detector alignment and calibration using the first proton-proton collisions data ( O(100 pb-1) ) and a larger dataset ( O(1 fb-1) ) to reach the target precision. The automatisation of the workflow and the integration in the online and offline activity (dedicated triggers and datasets, data skims, workflows to compute the calibration and alignment constants) are discussed.

Fabrication and electromagnetic interference shielding performance of open-cell foam of a Cu–Ni alloy integrated with CNTs

Energy Technology Data Exchange (ETDEWEB)

Ji, Keju; Zhao, Huihui; Zhang, Jun; Chen, Jia; Dai, Zhendong, E-mail: zddai@nuaa.edu.cn

2014-08-30

Highlights: • Cu–Ni alloy open-cell foam integrated with CNTs was used for EMI shielding. • The composite was prepared by electroless, electro-, and electrophoretic deposition. • The main shielding mechanism was multiple reflections and absorptions of microwaves. • The composite had a porous structure, large surface area, and inherent permeability. - Abstract: A lightweight multi-layered electromagnetic interference (EMI) shielding material made of open-cell foam of a Cu–Ni alloy integrated with carbon nanotubes (CNTs) was prepared by electroless copper plating, then nickel electroplating, and finally electrophoretic deposition of CNTs. The foamed Cu–Ni–CNT composite comprises, from inside to outside, Cu, Ni, and CNT layers. Scanning electron microscopy, energy dispersive spectroscopy, and EMI tests were employed to characterize the morphology, composition, and EMI performance of the composite, respectively. The results indicated that the shielding effectiveness (SE) of the composite increased with increasing pore density (indicated as pores per inch (PPI)) and increasing thickness. A specimen with a PPI of 110 and a 1.5-mm thickness had a maximum SE of up to 54.6 dB, and a SE as high as 47.5 dB on average in the 8–12 GHz range. Integrating the inherent superiority of Cu, Ni, and CNTs, the porous structure of the composite can attenuate the incident electromagnetic microwaves by reflecting, scattering, and absorbing them between the metallic skeleton and the CNT layer. The multiple reflections and absorptions make it difficult for the microwaves to escape from the composite before being absorbed, thereby making the composite a potential shielding material.

Tracker Alignment Performance Plots after Commissioning

CERN Document Server

CMS Collaboration

2017-01-01

During the LHC shutdown in Winter 2016/17, the CMS pixel detector, the inner component of the CMS Tracker, was replaced by the Phase-1 upgrade detector. Among others improvements, the new pixel detector consists of four instead of three layers in the central barrel region (BPIX) and three instead of two disks in the endcap regions (FPIX). In this report, performance plots of pixel detector alignment results are presented, which were obtained with both cosmic-ray and pp collision data acquired at the beginning of the 2017 LHC operation. Alignment constants have been derived for each data-taking period to the level of single module positions in both the pixel and the strip detectors. The complete understanding of the alignment and biases was derived by using two algorithms, Millepede-II and HipPy. The results confirm each other.

Unraveling the growth of vertically aligned multi-walled carbon nanotubes by chemical vapor deposition

International Nuclear Information System (INIS)

Ramirez, A; Royo, C; Latorre, N; Mallada, R; Monzón, A; Tiggelaar, R M

2014-01-01

The interaction between the main operational variables during the growth of vertically aligned multiwalled carbon nanotubes (VA-MWCNTs) by catalytic chemical vapor deposition is studied. In this contribution, we report the influence of the carbon source (i.e. acetylene, ethylene and propylene), the reaction/activation temperature, the rate of heating, the reaction time, the metal loading, and the metallic nanoparticle size and distribution on the growth and alignment of carbon nanotubes. Fe/Al thin films deposited onto silicon samples by electron-beam evaporation are used as catalyst. A phenomenological growth mechanism is proposed to explain the interaction between these multiple factors. Three different outcomes of the synthesis process are found: i) formation of forests of non-aligned, randomly oriented multi-walled carbon nanotubes, ii) growth of vertically aligned tubes with a thin and homogeneous carbonaceous layer on the top, and iii) formation of vertically aligned carbon nanotubes. This carbonaceous layer (ii) has not been reported before. The main requirements to promote vertically aligned carbon nanotube growth are determined. (paper)

Metal-modified and vertically aligned carbon nanotube sensors array for landfill gas monitoring applications.

Science.gov (United States)

Penza, M; Rossi, R; Alvisi, M; Serra, E

2010-03-12

demonstrates high sensitivity by providing minimal sub-ppm level detection, e.g., download up to 100 ppb NO(2), at the sensor temperature of 150 degrees C. The gas sensitivity of the CNT sensor array depends on operating temperature, showing a lower optimal temperature of maximum sensitivity for the metal-decorated CNT sensors compared to unmodified CNT sensors. Results indicate that the recovery mechanisms in the CNT chemiresistors can be altered by a rapid heating pulse from room temperature to about 110 degrees C. A comparison of the NO(2) gas sensitivity for the chemiresistors based on disorderly networked CNTs and vertically aligned CNTs is also reported. Cross-sensitivity towards relative humidity of the CNT sensors array is investigated. Finally, the sensing properties of the metal-decorated and vertically aligned CNT sensor arrays are promising to monitor gas events in the LFG for practical applications with low power consumption and moderate sensor temperature.

The Alignment of the CMS Silicon Tracker

CERN Document Server

Lampen, Pekka Tapio

2013-01-01

The CMS all-silicon tracker consists of 16588 modules, embedded in a solenoidal magnet providing a field of B = 3.8 T. The targeted performance requires that the alignment determines the module positions with a precision of a few micrometers. Ultimate local precision is reached by the determination of sensor curvatures, challenging the algorithms to determine about 200k parameters simultaneously, as is feasible with the Millepede II program. The main remaining challenge are global distortions that systematically bias the track parameters and thus physics measurements. They are controlled by adding further information into the alignment workflow, e.g. the mass of decaying resonances or track data taken with B = 0 T. To make use of the latter and also to integrate the determination of the Lorentz angle into the alignment procedure, the alignment framework has been extended to treat position sensitive calibration parameters. This is relevant since due to the increased LHC luminosity in 2012, the Lorentz angle ex...

Partial Treatment Requests and Underlying Motives of Applicants for Gender Affirming Interventions.

Science.gov (United States)

Beek, Titia F; Kreukels, Baudewijntje P C; Cohen-Kettenis, Peggy T; Steensma, Thomas D

2015-11-01

Historically, only individuals with a cross-gender identity who wanted to receive a full treatment, were eligible for "complete sex reassignment" consisting of feminizing/masculinizing hormone treatment and several surgical interventions including genital surgery (full treatment). Currently, it is unclear what motives underlie a request for hormones only or surgery only or a combination of hormones and surgery (e.g., a mastectomy), but no genital surgery (partial treatment). The aims of this study were (i) to describe treatment requests of applicants at a specialized gender identity clinic in the Netherlands; and (ii) to explore the motives underlying a partial treatment request, including the role of (non-binary) gender identity. Information was collected on all 386 adults who applied for treatment at the Center of Expertise on Gender Dysphoria of the VU University Medical Center in Amsterdam, the Netherlands, in the year 2013. Treatment requests were available for 360 individuals: 233 natal men (64.7%) and 127 natal women (35.3%). Treatment requests were systematically collected during assessment. Individuals were classified as either desiring a full or partial treatment. The motives behind a partial treatment request were collected and categorized as well. The majority of applicants at our gender identity clinic requested full treatment. Among those who requested partial treatment, the most reported underlying motive was surgical risks/outcomes. Only a small number of applicants requested partial treatment to bring their body into alignment with their non-binary gender identity. It becomes clear that partial treatment is requested by a substantial number of applicants. This emphasizes the need for gender identity clinics to provide information about the medical possibilities and limitations, and careful introduction and evaluation of non-standard treatment options. © 2015 International Society for Sexual Medicine.

Alignment of E-Business with SMEs’ Strategies in Northeast of Mexico

OpenAIRE

Pedraza, Norma; Guerrero, Maribel; Lavín, Jesús

2011-01-01

The alignment of e-business with business strategy is a theme that has gained interest among managers and researchers in the area. In this sense, the objectives of the present study are: (i) to identify the existing perspective of the strategic alignment in the SMEs; (ii) to find out the perception that the SMEs’ managers have about the criteria that determine the maturity level of the e-business alignment with the business strategy; and (iii) to identify the existing relationship between the...

Monodisperse embedded nanoparticles derived from an atomic metal-dispersed precursor of layered double hydroxide for architectured carbon nanotube formation

DEFF Research Database (Denmark)

Tian, Gui-Li; Zhao, Meng-Qiang; Zhang, Bingsen

2014-01-01

. When the areal density was increased from 0.039 to 0.55, and to 2.1 x 10(15) m(-2), the Fe NPs embedded on the LDO flakes exhibited good catalytic performance for the growth of entangled carbon nanotubes (CNTs), aligned CNTs, and double helical CNTs, respectively. This work provides not only new...

Advanced oxidation (H₂O₂ and/or UV) of functionalized carbon nanotubes (CNT-OH and CNT-COOH) and its influence on the stabilization of CNTs in water and tannic acid solution.

Science.gov (United States)

Czech, Bożena; Oleszczuk, Patryk; Wiącek, Agnieszka

2015-05-01

The properties of carbon nanotubes (CNTs) functionalized with -OH and -COOH groups during simulated water treatment with H2O2 and/or UV were tested. There following properties of CNTs were investigated: specific surface area, elemental composition (CHN), dynamic light scattering, Raman spectroscopy, X-ray photoelectron spectroscopy and changes in the CNTs structure were observed using transmission electron microscopy. Treatment of CNTs with H2O2 and/or UV affected their properties. This effect, however, was different depending on the functionalization of CNTs and also on the factor used (UV and/or H2O2). H2O2 plays a key role as a factor modifying the surface of CNT-OHs, whereas the properties of CNT-COOHs were most affected by UV rays. A shortening of the nanotubes, exfoliation, the opening of their ends, and changes in the surface charge were observed as a result of the action of UV and/or H2O2. The changes in observed parameters may influence the stability of the aqueous suspensions of CNTs. Copyright © 2015 Elsevier Ltd. All rights reserved.

Alignment analysis of a vertical sodium pump

International Nuclear Information System (INIS)

Gupta, V.K.; Fair, C.E.

1981-01-01

With the objective of identifying important alignment features of pumps such as FFTF, HALLAM, EBR II, PNC, PHENIX, and CRBR, alignment of the vertical sodium pump for the Clinch River Breeder Reactor Plant (CRBRP) is investigated. The CRBRP pump includes a flexibly coupled pump shaft and motor shaft, two oil-film tilting-pad hydrodynamic radial bearings in the motor plus a vertical thrust bearing, and two sodium hydrostatic bearings straddling the double-suction centrifugal impeller in the pump. The assembled CRBRP prototype pump shows smooth predictable vibration behavior experienced during water test. An ealier swing check of the pump shaft about the motor shaft hub demonstrated that the pump is relatively insensitive to manufacturing and assembly tolerances, a consequence of close dimensional control and unique alignment features. (orig./GL)

ORF Alignment: NC_002950 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available gth = 151 ... Query: 3 ... PLVSIIMGSTSDLPIMEKAAKMLDEMQIPFEMLALSAHRTPAEVETFAHEARARGIKV...II 62 ... PLVSIIMGSTSDLPIMEKAAKMLDEMQIPFEMLALSAHRTPAEVETFAHEARARGIKVII Sbjct: 1 ... PLVSIIMGSTSDLPIMEKAAKMLDEMQIPFEM

Anatase-TiO{sub 2}/CNTs nanocomposite as a superior high-rate anode material for lithium-ion batteries

Energy Technology Data Exchange (ETDEWEB)

Liu, Jinlong [College of Chemistry and Chemical Engineering, Central South University, Changsha 410083 (China); State Key Laboratory of Powder Metallurgy, Central South University, Changsha 410083 (China); Feng, Haibo; Jiang, Jianbo [College of Chemistry and Chemical Engineering, Central South University, Changsha 410083 (China); Qian, Dong, E-mail: qiandong6@vip.sina.com [College of Chemistry and Chemical Engineering, Central South University, Changsha 410083 (China); State Key Laboratory of Powder Metallurgy, Central South University, Changsha 410083 (China); Li, Junhua; Peng, Sanjun [College of Chemistry and Chemical Engineering, Central South University, Changsha 410083 (China); Liu, Youcai, E-mail: liuyoucai@126.com [College of Chemistry and Chemical Engineering, Central South University, Changsha 410083 (China)

2014-08-01

Highlights: • Anatase-TiO{sub 2}/CNTs nanocomposite was prepared by a facile and scalable hydrolysis route. • The composite exhibits super-high rate capability and excellent cycling stability for LIBs. • The nanocomposite shows great potential as a superior anode material for LIBs. - Abstract: Anatase-TiO{sub 2}/carbon nanotubes (CNTs) with robust nanostructure is fabricated via a facile two-step synthesis by ammonia water assisted hydrolysis and subsequent calcination. The as-synthesized nanocomposite was characterized employing X-ray powder diffraction, Fourier transform infrared spectrophotometry, Raman spectrophotometry, thermal gravimetric analysis, transmission electron microscopy, high-resolution transmission electron microscopy and selected area electronic diffraction, and its electrochemical properties as an anode material for lithium-ion batteries (LIBs) were investigated by cyclic voltammetry, galvanostatic discharge/charge test and electrochemical impendence spectroscopy. The results show that the pure anatase TiO{sub 2} nanoparticles with diameters of about 10 nm are uniformly distributed on/among the CNTs conducting network. The as-synthesized nanocomposite exhibits remarkably improved performances in LIBs, especially super-high rate capability and excellent cycling stability. Specifically, a reversible capacity as high as 92 mA h g{sup −1} is achieved even at a current density of 10 A g{sup −1} (60 C). After 100 cycles at 0.1 A g{sup −1}, it shows good capacity retention of 185 mA h g{sup −1} with an outstanding coulombic efficiency up to 99%. Such superior Li{sup +} storage properties demonstrate the reinforced synergistic effects between the nano-sized TiO{sub 2} and the interweaved CNTs network, endowing the nanocomposite with great application potential in high-power LIBs.

CNTs-Modified Nb3O7F Hybrid Nanocrystal towards Faster Carrier Migration, Lower Bandgap and Higher Photocatalytic Activity.

Science.gov (United States)

Huang, Fei; Li, Zhen; Yan, Aihua; Zhao, Hui; Liang, Huagen; Gao, Qingyu; Qiang, Yinghuai

2017-01-06

Novel semiconductor photocatalysts have been the research focus and received much attention in recent years. The key issues for novel semiconductor photocatalysts are to effectively harvest solar energy and enhance the separation efficiency of the electron-hole pairs. In this work, novel Nb 3 O 7 F/CNTs hybrid nanocomposites with enhanced photocatalytic activity have been successfully synthesized by a facile hydrothermal plus etching technique. The important finding is that appropriate pH values lead to the formation of Nb 3 O 7 F nanocrystal directly. A general strategy to introdue interaction between Nb 3 O 7 F and CNTs markedly enhances the photocatalytic activity of Nb 3 O 7 F. Comparatively, Nb 3 O 7 F/CNTs nanocomposites exhibit higher photodegradation efficiency and faster photodegradation rate in the solution of methylene blue (MB) under visible-light irradiation. The higher photocatalytic activity may be attributed to more exposed active sites, higher carrier migration and narrower bandgap because of good synergistic effect. The results here may inspire more engineering, new design and facile fabrication of novel photocatalysts with highly photocatalytic activity.

Heat transfer enhancement in free convection flow of CNTs Maxwell nanofluids with four different types of molecular liquids.

Science.gov (United States)

Aman, Sidra; Khan, Ilyas; Ismail, Zulkhibri; Salleh, Mohd Zuki; Al-Mdallal, Qasem M

2017-05-26

This article investigates heat transfer enhancement in free convection flow of Maxwell nanofluids with carbon nanotubes (CNTs) over a vertically static plate with constant wall temperature. Two kinds of CNTs i.e. single walls carbon nanotubes (SWCNTs) and multiple walls carbon nanotubes (MWCNTs) are suspended in four different types of base liquids (Kerosene oil, Engine oil, water and ethylene glycol). Kerosene oil-based nanofluids are given a special consideration due to their higher thermal conductivities, unique properties and applications. The problem is modelled in terms of PDE's with initial and boundary conditions. Some relevant non-dimensional variables are inserted in order to transmute the governing problem into dimensionless form. The resulting problem is solved via Laplace transform technique and exact solutions for velocity, shear stress and temperature are acquired. These solutions are significantly controlled by the variations of parameters including the relaxation time, Prandtl number, Grashof number and nanoparticles volume fraction. Velocity and temperature increases with elevation in Grashof number while Shear stress minimizes with increasing Maxwell parameter. A comparison between SWCNTs and MWCNTs in each case is made. Moreover, a graph showing the comparison amongst four different types of nanofluids for both CNTs is also plotted.

Alignment of the CMS Silicon Strip Tracker during stand-alone Commissioning

CERN Document Server

Adam, W.; Dragicevic, M.; Friedl, M.; Fruhwirth, R.; Hansel, S.; Hrubec, J.; Krammer, M.; Oberegger, M.; Pernicka, M.; Schmid, S.; Stark, R.; Steininger, H.; Uhl, D.; Waltenberger, W.; Widl, E.; Van Mechelen, P.; Cardaci, M.; Beaumont, W.; de Langhe, E.; de Wolf, E.A.; Delmeire, E.; Hashemi, M.; Bouhali, O.; Charaf, O.; Clerbaux, B.; Dewulf, J.-P.; Elgammal, S.; Hammad, G.; de Lentdecker, G.; Marage, P.; Vander Velde, C.; Vanlaer, P.; Wickens, J.; Adler, V.; Devroede, O.; De Weirdt, S.; D'Hondt, J.; Goorens, R.; Heyninck, J.; Maes, J.; Mozer, Matthias Ulrich; Tavernier, S.; Van Lancker, L.; Van Mulders, P.; Villella, I.; Wastiels, C.; Bonnet, J.-L.; Bruno, G.; De Callatay, B.; Florins, B.; Giammanco, A.; Gregoire, G.; Keutgen, Th.; Kcira, D.; Lemaitre, V.; Michotte, D.; Militaru, O.; Piotrzkowski, K.; Quertermont, L.; Roberfroid, V.; Rouby, X.; Teyssier, D.; daubie, E.; Anttila, E.; Czellar, S.; Engstrom, P.; Harkonen, J.; Karimaki, V.; Kostesmaa, J.; Kuronen, A.; Lampen, T.; Linden, T.; Luukka, P.-R.; Maenaa, T.; Michal, S.; Tuominen, E.; Tuominiemi, J.; Ageron, M.; Baulieu, G.; Bonnevaux, A.; Boudoul, G.; Chabanat, E.; Chabert, E.; Chierici, R.; Contardo, D.; Della Negra, R.; Dupasquier, T.; Gelin, G.; Giraud, N.; Guillot, G.; Estre, N.; Haroutunian, R.; Lumb, N.; Perries, S.; Schirra, F.; Trocme, B.; Vanzetto, S.; Agram, J.-L.; Blaes, R.; Drouhin, F.; Ernenwein, J.-P.; Fontaine, J.-C.; Berst, J.-D.; Brom, J.-M.; Didierjean, F.; Goerlach, U.; Graehling, P.; Gross, L.; Hosselet, J.; Juillot, P.; Lounis, A.; Maazouzi, C.; Olivetto, C.; Strub, R.; Van Hove, P.; Anagnostou, G.; Brauer, R.; Esser, H.; Feld, L.; Karpinski, W.; Klein, K.; Kukulies, C.; Olzem, J.; Ostapchuk, A.; Pandoulas, D.; Pierschel, G.; Raupach, F.; Schael, S.; Schwering, G.; Sprenger, D.; Thomas, M.; Weber, M.; Wittmer, B.; Wlochal, M.; Beissel, F.; Bock, E.; Flugge, G.; Gillissen, C.; Hermanns, T.; Heydhausen, D.; Jahn, D.; Kaussen, G.; Linn, A.; Perchalla, L.; Poettgens, M.; Pooth, O.; Stahl, A.; Zoeller, M.H.; Buhmann, P.; Butz, E.; Flucke, G.; Hamdorf, R.; Hauk, J.; Klanner, R.; Pein, U.; Schleper, P.; Steinbruck, G.; Blum, P.; De Boer, W.; Dierlamm, A.; Dirkes, G.; Fahrer, M.; Frey, M.; Furgeri, A.; Hartmann, F.; Heier, S.; Hoffmann, K.-H.; Kaminski, J.; Ledermann, B.; Liamsuwan, T.; Muller, S.; Muller, Th.; Schilling, F.-P.; Simonis, H.-J.; Steck, P.; Zhukov, V.; Cariola, P.; De Robertis, G.; Ferorelli, R.; Fiore, L.; Preda, M.; Sala, G.; Silvestris, L.; Tempesta, P.; Zito, G.; Creanza, D.; De Filippis, N.; De Palma, M.; Giordano, D.; Maggi, G.; Manna, N.; My, S.; Selvaggi, G.; Albergo, S.; Chiorboli, M.; Costa, S.; Galanti, M.; Giudice, N.; Guardone, N.; Noto, F.; Potenza, R.; Saizu, M.A.; Sparti, V.; Sutera, C.; Tricomi, A.; Tuve, C.; Brianzi, M.; Civinini, C.; Maletta, F.; Manolescu, F.; Meschini, M.; Paoletti, S.; Sguazzoni, G.; Broccolo, B.; Ciulli, V.; D'Alessandro, R.; Focardi, E.; Frosali, S.; Genta, C.; Landi, G.; Lenzi, P.; Macchiolo, A.; Magini, N.; Parrini, G.; Scarlini, E.; Cerati, G.; Azzi, P.; Bacchetta, N.; Candelori, A.; Dorigo, T.; Kaminsky, A.; Karaevski, S.; Khomenkov, V.; Reznikov, S.; Tessaro, M.; Bisello, D.; De Mattia, M.; Giubilato, P.; Loreti, M.; Mattiazzo, S.; Nigro, M.; Paccagnella, A.; Pantano, D.; Pozzobon, N.; Tosi, M.; Bilei, G.M.; Checcucci, B.; Fano, L.; Servoli, L.; Ambroglini, F.; Babucci, E.; Benedetti, D.; Biasini, M.; Caponeri, B.; Covarelli, R.; Giorgi, M.; Lariccia, P.; Mantovani, G.; Marcantonini, M.; Postolache, V.; Santocchia, A.; Spiga, D.; Bagliesi, G.; Balestri, G.; Berretta, L.; Bianucci, S.; Boccali, T.; Bosi, F.; Bracci, F.; Castaldi, R.; Ceccanti, M.; Cecchi, R.; Cerri, C.; Cucoanes, A.S.; Dell'Orso, R.; Dobur, D.; Dutta, S.; Giassi, A.; Giusti, S.; Kartashov, D.; Kraan, A.; Lomtadze, T.; Lungu, G.A.; Magazzu, G.; Mammini, P.; Mariani, F.; Martinelli, G.; Moggi, A.; Palla, F.; Palmonari, F.; Petragnani, G.; Profeti, A.; Raffaelli, F.; Rizzi, D.; Sanguinetti, G.; Sarkar, S.; Sentenac, D.; Serban, A.T.; Slav, A.; Soldani, A.; Spagnolo, P.; Tenchini, R.; Tolaini, S.; Venturi, A.; Verdini, P.G.; Vos, M.; Zaccarelli, L.; Avanzini, C.; Basti, A.; Benucci, L.; Bocci, A.; Cazzola, U.; Fiori, F.; Linari, S.; Massa, M.; Messineo, A.; Segneri, G.; Tonelli, G.; Azzurri, P.; Bernardini, J.; Borrello, L.; Calzolari, F.; Foa, L.; Gennai, S.; Ligabue, F.; Petrucciani, G.; Rizzi, A.; Yang, Z.; Benotto, F.; Demaria, N.; Dumitrache, F.; Farano, R.; Borgia, M.A.; Castello, R.; Costa, M.; Migliore, E.; Romero, A.; Abbaneo, D.; Abbas, M.; Ahmed, I.; Akhtar, I.; Albert, E.; Bloch, C.; Breuker, H.; Butt, S.; Buchmuller, O.; Cattai, A.; Delaere, C.; Delattre, M.; Edera, L.M.; Engstrom, P.; Eppard, M.; Gateau, M.; Gill, K.; Giolo-Nicollerat, A.-S.; Grabit, R.; Honma, A.; Huhtinen, M.; Kloukinas, K.; Kortesmaa, J.; Kottelat, L.J.; Kuronen, A.; Leonardo, N.; Ljuslin, C.; Mannelli, M.; Masetti, L.; Marchioro, A.; Mersi, S.; Michal, S.; Mirabito, L.; Muffat-Joly, J.; Onnela, A.; Paillard, C.; Pal, I.; Pernot, J.F.; Petagna, P.; Petit, P.; Piccut, C.; Pioppi, M.; Postema, H.; Ranieri, R.; Ricci, D.; Rolandi, G.; Ronga, F.; Sigaud, C.; Syed, A.; Siegrist, P.; Tropea, P.; Troska, J.; Tsirou, A.; Vander Donckt, M.; Vasey, F.; Alagoz, E.; Amsler, Claude; Chiochia, V.; Regenfus, Christian; Robmann, P.; Rochet, J.; Rommerskirchen, T.; Schmidt, A.; Steiner, S.; Wilke, L.; Church, I.; Cole, J.; Coughlan, J.; Gay, A.; Taghavi, S.; Tomalin, I.; Bainbridge, R.; Cripps, N.; Fulcher, J.; Hall, G.; Noy, M.; Pesaresi, M.; Radicci, V.; Raymond, D.M.; Sharp, P.; Stoye, M.; Wingham, M.; Zorba, O.; Goitom, I.; Hobson, P.R.; Reid, I.; Teodorescu, L.; Hanson, G.; Jeng, G.-Y.; Liu, H.; Pasztor, G.; Satpathy, A.; Stringer, R.; Mangano, B.; Affolder, K.; Affolder, T.; Allen, A.; Barge, D.; Burke, S.; Callahan, D.; Campagnari, C.; Crook, A.; D'Alfonso, M.; Dietch, J.; Garberson, Jeffrey Ford; Hale, D.; Incandela, H.; Incandela, J.; Jaditz, S.; Kalavase, P.; Kreyer, S.; Kyre, S.; Lamb, J.; Mc Guinnessr, C.; Mills, C.; Nguyen, H.; Nikolic, M.; Lowette, S.; Rebassoo, F.; Ribnik, J.; Richman, J.; Rubinstein, N.; Sanhueza, S.; Shah, Y.; Simms, L.; Staszak, D.; Stoner, J.; Stuart, D.; Swain, S.; Vlimant, J.-R.; White, D.; Ulmer, K.A.; Wagner, S.R.; Bagby, L.; Bhat, P.C.; Burkett, K.; Cihangir, S.; Gutsche, O.; Jensen, H.; Johnson, M.; Luzhetskiy, N.; Mason, D.; Miao, T.; Moccia, S.; Noeding, C.; Ronzhin, A.; Skup, E.; Spalding, W.J.; Spiegel, L.; Tkaczyk, S.; Yumiceva, F.; Zatserklyaniy, A.; Zerev, E.; Anghel, I.; Bazterra, V.E.; Gerber, C.E.; Khalatian, S.; Shabalina, E.; Baringer, Philip S.; Bean, A.; Chen, J.; Hinchey, C.; Martin, C.; Moulik, T.; Robinson, R.; Gritsan, A.V.; Lae, C.K.; Tran, N.V.; Everaerts, P.; Hahn, K.A.; Harris, P.; Nahn, S.; Rudolph, M.; Sung, K.; Betchart, B.; Demina, R.; Gotra, Y.; Korjenevski, S.; Miner, D.; Orbaker, D.; Christofek, L.; Hooper, R.; Landsberg, G.; Nguyen, D.; Narain, M.; Speer, T.; Tsang, K.V.

2009-01-01

The results of the CMS tracker alignment analysis are presented using the data from cosmic tracks, optical survey information, and the laser alignment system at the Tracker Integration Facility at CERN. During several months of operation in the spring and summer of 2007, about five million cosmic track events were collected with a partially active CMS Tracker. This allowed us to perform first alignment of the active silicon modules with the cosmic tracks using three different statistical approaches; validate the survey and laser alignment system performance; and test the stability of Tracker structures under various stresses and temperatures ranging from +15C to -15C. Comparison with simulation shows that the achieved alignment precision in the barrel part of the tracker leads to residual distributions similar to those obtained with a random misalignment of 50 (80) microns in the outer (inner) part of the barrel.

Effect of distribution, interface property and density of hydrogel-embedded vertically aligned carbon nanotube arrays on the properties of a flexible solid state supercapacitor

Science.gov (United States)

Zhu, Qi; Yuan, Xietao; Zhu, Yihao; Ni, Jiangfeng; Zhang, Xiaohua; Yang, Zhaohui

2018-05-01

In this paper we fabricate a robust flexible solid-state supercapacitor (FSC) device by embedding a conductive poly(vinyl alcohol) hydrogel into aligned carbon nanotube (CNT) arrays. We carefully investigate the effect of distribution, interface properties and densification of CNTs in the gel matrix on the electrochemical properties of an FSC. The total electrochemical capacitance of the device is measured to be 227 mF cm‑3 with a maximum energy density of 0.02 mWh cm‑3, which is dramatically enhanced compared with a similar device composed of non-parallel CNTs. Additionally, controllable in situ electrochemical oxidation greatly improved the compatibility between the hydrophobic CNTs and the hydrophilic hydrogel, which decreased the resistance of the device and introduced extra pseudocapacitance. After such oxidation treatment the energy storage ability further doubled to 430 mF cm‑3 with a maximum energy density of 0.04 mWh cm‑3 . The FSCs based on densified CNT arrays exhibited a much higher volumetric capacitance of 1140 mF cm‑3 and a larger energy density of 0.1 mWh cm‑3, with a large power density of 14 mW cm‑3. All devices show excellent stability of capacitance after at least 10 000 charge–discharge cycles with a loss of less than 2%. These easy-to-assemble hybrid arrays thus potentially provide a new method for manufacturing wearable devices and implantable medical devices.

Solid source growth of Si oxide nanowires promoted by carbon nanotubes

Energy Technology Data Exchange (ETDEWEB)

Lu, Congxiang [CINTRA CNRS/NTU/THALES, Nanyang Technological University, Singapore 637553 (Singapore); Novitas, Nanoelectronics Centre of Excellence, School of Electrical and Electronic Engineering, Nanyang Technological University, Singapore 639798 (Singapore); Liu, Wen-wen; Wang, Xingli [Novitas, Nanoelectronics Centre of Excellence, School of Electrical and Electronic Engineering, Nanyang Technological University, Singapore 639798 (Singapore); Li, Xiaocheng [Laboratory of clean energy chemistry and materials, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, No. 18 Tianshui Middle Road, Lanzhou 730000 (China); Tan, Chong Wei [CINTRA CNRS/NTU/THALES, Nanyang Technological University, Singapore 637553 (Singapore); Novitas, Nanoelectronics Centre of Excellence, School of Electrical and Electronic Engineering, Nanyang Technological University, Singapore 639798 (Singapore); Tay, Beng Kang, E-mail: ebktay@ntu.edu.sg [CINTRA CNRS/NTU/THALES, Nanyang Technological University, Singapore 637553 (Singapore); Novitas, Nanoelectronics Centre of Excellence, School of Electrical and Electronic Engineering, Nanyang Technological University, Singapore 639798 (Singapore); Coquet, Philippe [CINTRA CNRS/NTU/THALES, Nanyang Technological University, Singapore 637553 (Singapore)

2014-09-30

Highlights: • An array of well aligned and uniform CNTs is successfully fabricated by PECVD. • SiONW growth utilizes Si substrate as the source, ruling out the usage of silane. • With CNT array on the substrate, SiONW growth is improved significantly. • CNTs help dispersion of the catalysts and diffusion of the Si atoms. - Abstract: We report a method to promote solid source growth of Si oxide nanowires (SiONWs) by using an array of vertically aligned carbon nanotubes (CNTs). It starts with the fabrication of CNT array by plasma enhanced chemical vapor deposition (PECVD) on Si wafers, followed by growth of SiONWs. Herein, CNTs serve as a scaffold, which helps the dispersion of catalysts for SiONWs and also provides space for hydrogen which boosts the diffusion of Si atoms and hence formation of SiONWs. As the result, a three dimensional (3D) hybrid network of densely packed SiONWs and CNTs can be produced rapidly.

CNTs grown on nanoporous carbon from zeolitic imidazolate frameworks for supercapacitors.

Science.gov (United States)

Kim, Jeonghun; Young, Christine; Lee, Jaewoo; Park, Min-Sik; Shahabuddin, Mohammed; Yamauchi, Yusuke; Kim, Jung Ho

2016-10-27

Carbon nanotubes (CNT) grown on nanoporous carbon (NPC), which yields coexisting amorphous and graphitic nanoarchitectures, have been prepared on a large scale from zeolitic imidazolate framework (ZIF) by introducing bimetallic ions (Co 2+ and Zn 2+ ). Interestingly, the hybrid Co/Zn-ZIF-derived NPC showed rich graphitic CNTs on the surface. This NPC was utilized for a coin-type supercapacitor cell with an aqueous electrolyte, which showed enhanced retention at high current density and good stability over 10 000 cycles.

ORF Alignment: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... chromosome II ... Length = 113 ... Query: 3 ... SRKRKSELEHYIDKLTDPPEKQRKMAEFYNSLRMFYKRRWNATLKLPHVQGVEV...NLYRLY 62 ... SRKRKSELEHYIDKLTDPPEKQRKMAEFYNSLRMFYKRRWNATLKLPHVQGVEVNLYRLY Sbjct: 1 ... SRKRKSELEHYIDKLTDPPEKQRKMAEFYNSLRMFYKRRWNATLKLPHVQGVEVNLYRLY 60 ...

Facile fabrication of CNTs@C@MoSe2@Se hybrids with amorphous structure for high performance anode in lithium-ion batteries.

Science.gov (United States)

Jin, Rencheng; Cui, Yuming; Wang, Qingyao; Li, Guihua

2017-12-15

Amorphous MoSe 2 and Se anchored on amorphous carbon coated multiwalled carbon nanotubes (CNTs@C@MoSe 2 @Se) have been synthesized by a facile solvothermal strategy. The one dimensional CNTs@C@MoSe 2 @Se can effectively buffer the volume variation, prohibit the aggregation and facilitate electron and ion transport throughout the electrode. Furthermore, the combination of MoSe 2 and Se also provides buffer spaces for the volumetric change during cycling. Thus, the obtained CNTs@C@MoSe 2 @Se hybrids display the enhanced cycle stability and excellent high rate capacity. The reversible capacity of 1010mAhg -1 can be achieved after 100 cycles at the current density of 0.1Ag -1 . Even after 500 cycles, a reversible capacity of 508mAhg -1 is still retained at 5Ag -1 . Copyright © 2017 Elsevier Inc. All rights reserved.

Benzoate Acid-Dependent Lattice Dimension of Co-MOFs and MOF-Derived CoS2@CNTs with Tunable Pore Diameters for Supercapacitors.

Science.gov (United States)

Zou, Kang-Yu; Liu, Yi-Chen; Jiang, Yi-Fan; Yu, Cheng-Yan; Yue, Man-Li; Li, Zuo-Xi

2017-06-05

Herein three novel cobalt metal-organic frameworks (Co-MOFs) with similar ingredients, [Co(bib)(o-bdc)] ∞ (1), [Co 2 (bib) 2 (m-bdc) 2 ] ∞ (2), and {[Co(bib)(p-bdc)(H 2 O)](H 2 O) 0.5 } ∞ (3), have been synthesized from the reaction of cobalt nitrate with 1,4-bis(imidazol-1-yl)benzene (bib) and structure-related aromatic acids (1,2-benzenedicarboxylic acid = o-bdc, 1,3-benzenedicarboxylic acid = m-bdc, and 1,4-benzenedicarboxylic acid = p-bdc) by the solvothermal method. It is aimed to perform systematic research on the relationship among the conformation of benzoate acid, lattice dimension of Co-MOF, and pore diameter of MOF-derived carbon composite. Through the precursor strategy, Co-MOFs 1-3 have been utilized to synthesize porous cobalt@carbon nanotube composites (Co@CNTs). After the in situ gas-sulfurization, secondary composites CoS 2 @CNTs were successfully obtained, which kept similar morphologies of corresponding Co@CNTs without destroying previous highly dispersed structures. Co-MOFs and two series of composites (Co@CNTs and CoS 2 @CNTs) have been well characterized. Topology and Brunauer-Emmett-Teller analyses elucidate that the bdc 2- ion could control the pore diameters of MOF-derived carbon composites by adjusting the lattice dimension of Co-MOFs. The systematic studies on electrochemical properties demonstrate that (p)-CoS 2 @CNT possesses hierarchical morphology, moderate specific surface area, proper pore diameter distribution, and high graphitization, which lead to remarkable specific capacitances (839 F g -1 at 5 mV s -1 and 825 F g -1 at 0.5 A g -1 ) in 2 M potassium hydroxide solution. In addition, the (p)-CoS 2 @CNT electrode exhibits good electrochemical stability and still retains 82.9% of initial specific capacitance at the current density of 1 A g -1 after 5000 cycles.

Alignment and operability analysis of a vertical sodium pump

International Nuclear Information System (INIS)

Gupta, V.K.; Fair, C.E.

1981-01-01

With the objective of identifying important alignment features of pumps such as FFTF, HALLAM, EBR II, PNC, PHENIX, and CRBR, alignment of the vertical sodium pump for the Clinch River Breeder Reactor Plant (CRBRP) is investigated. The CRBRP pump includes a flexibly coupled pump shaft and motor shaft, two oil-film tilting-pad hydrodynamic radial bearings in the motor plus a vertical thrust bearing, and two sodium hydrostatic bearings straddling the double-suction centrifugal impeller in the pump

Growth and characterization of horizontally suspended CNTs across TiN electrode gaps

Energy Technology Data Exchange (ETDEWEB)

Santini, Claudia A; Cott, Daire J; Romo-Negreira, Ainhoa; Gendt, Stefan De; Groeseneken, Guido; Vereecken, Philippe M [IMEC, Kapeldreef 75, B-3001 Leuven (Belgium); Capraro, Bernard D [Intel Ireland Limited, Collinstown Industrial Park, Leixlip, County Kildare (Ireland); Sanseverino, Stefano Riva, E-mail: claudia.santini@fys.kuleuven.be, E-mail: vereeck@imec.be [Department of Electrical, Electronics and Telecommunication Engineering, University of Palermo (Italy)

2010-06-18

A technique is proposed to grow horizontal carbon nanotubes (CNTs) bridging metal electrodes and to assess their electrical properties. A test structure was utilized that allows for selective electrochemical sidewall catalyst placement. The selectivity of the technique is based on the connection of the desired metal electrodes to the silicon substrate where the potential for electrochemical deposition was applied. Control over the Ni catalyst size (15-30 nm) and density (up to 3 x 10{sup 11} particles cm{sup -2}) is demonstrated. Horizontal CNTs with controlled diameter and density were obtained by CVD growth perpendicular to the sidewalls of patterned TiN electrode structures. Electrode gaps with spacings from 200 nm up to 5 {mu}m could be bridged by both direct CNT-electrode contact and CNT-CNT entanglement. The TiN-CNT-TiN and TiN-CNT-CNT-TiN bridges were electrically characterized without any further post-growth contacting. Resistance values as low as 40 {Omega} were measured for the smallest gap spacing and depended mainly on the number and configuration of the CNT bridges. The proposed method could be implemented for CNT-based horizontal interconnections and be a route to make different nanoelectronic devices such as chemical and electromechanical sensors.

Growth and characterization of horizontally suspended CNTs across TiN electrode gaps

International Nuclear Information System (INIS)

Santini, Claudia A; Cott, Daire J; Romo-Negreira, Ainhoa; Gendt, Stefan De; Groeseneken, Guido; Vereecken, Philippe M; Capraro, Bernard D; Sanseverino, Stefano Riva

2010-01-01

A technique is proposed to grow horizontal carbon nanotubes (CNTs) bridging metal electrodes and to assess their electrical properties. A test structure was utilized that allows for selective electrochemical sidewall catalyst placement. The selectivity of the technique is based on the connection of the desired metal electrodes to the silicon substrate where the potential for electrochemical deposition was applied. Control over the Ni catalyst size (15-30 nm) and density (up to 3 x 10 11 particles cm -2 ) is demonstrated. Horizontal CNTs with controlled diameter and density were obtained by CVD growth perpendicular to the sidewalls of patterned TiN electrode structures. Electrode gaps with spacings from 200 nm up to 5 μm could be bridged by both direct CNT-electrode contact and CNT-CNT entanglement. The TiN-CNT-TiN and TiN-CNT-CNT-TiN bridges were electrically characterized without any further post-growth contacting. Resistance values as low as 40 Ω were measured for the smallest gap spacing and depended mainly on the number and configuration of the CNT bridges. The proposed method could be implemented for CNT-based horizontal interconnections and be a route to make different nanoelectronic devices such as chemical and electromechanical sensors.

Carbon nanotube array actuators

International Nuclear Information System (INIS)

Geier, S; Mahrholz, T; Wierach, P; Sinapius, M

2013-01-01

Experimental investigations of highly vertically aligned carbon nanotubes (CNTs), also known as CNT-arrays, are the main focus of this paper. The free strain as result of an active material behavior is analyzed via a novel experimental setup. Previous test experiences of papers made of randomly oriented CNTs, also called Bucky-papers, reveal comparably low free strain. The anisotropy of aligned CNTs promises better performance. Via synthesis techniques like chemical vapor deposition (CVD) or plasma enhanced CVD (PECVD), highly aligned arrays of multi-walled carbon nanotubes (MWCNTs) are synthesized. Two different types of CNT-arrays are analyzed, morphologically first, and optically tested for their active characteristics afterwards. One type of the analyzed arrays features tube lengths of 750–2000 μm with a large variety of diameters between 20 and 50 nm and a wave-like CNT-shape. The second type features a maximum, almost uniform, length of 12 μm and a constant diameter of 50 nm. Different CNT-lengths and array types are tested due to their active behavior. As result of the presented tests, it is reported that the quality of orientation is the most decisive property for excellent active behavior. Due to their alignment, CNT-arrays feature the opportunity to clarify the actuation mechanism of architectures made of CNTs. (paper)

Fabrication and flow characterization of vertically aligned carbon-nanotube/polymer membranes

Science.gov (United States)

Castellano, Richard; Meshot, Eric; Fornasiero, Francesco; Shan, Jerry

2017-11-01

Membranes with well-controlled nanopores are of interest for applications as diverse as chemical separations, water purification, and ``green'' power generation. In particular, membranes incorporating carbon nanotubes (CNTs) as through-pores have been shown to pass fluids at rates orders-of-magnitude faster than predicted by continuum theory. However, cost-effective and scalable solutions for fabricating such membranes are still an area of research. We describe a solution-based fabrication technique for creating polymer composite membranes from bulk nanotubes using electric-field alignment and electrophoretic concentration. We then focus on flow characterization of membranes with single-wall nanotube (SWNT) pores. We demonstrate membrane quality by size-exclusion testing and showing that the flowrate of different gasses scales as the square root of molecular weight. The gas flowrates and moisture-vapor-transmission rates are compared with theoretical predictions and with composite membranes -fabricated from CVD-grown SWNT arrays. Funded by DTRA Grant BA12PHM123.

Catalytic decomposition of gaseous 1,2-dichlorobenzene over CuOx/TiO₂ and CuOx/TiO₂-CNTs catalysts: Mechanism and PCDD/Fs formation.

Science.gov (United States)

Wang, Qiu-lin; Huang, Qun-xing; Wu, Hui-fan; Lu, Sheng-yong; Wu, Hai-long; Li, Xiao-dong; Yan, Jian-hua

2016-02-01

Gaseous 1,2-dichlorobenzene (1,2-DCBz) was catalytically decomposed in a fixed-bed catalytic reactor using composite copper-based titanium oxide (CuOx/TiO2) catalysts with different copper ratios. Carbon nanotubes (CNTs) were introduced to produce novel CuOx/TiO2-CNTs catalysts by the sol-gel method. The catalytic performances of CuOx/TiO2 and CuOx/TiO2-CNTs on 1,2-DCBz oxidative destruction under different temperatures (150-350 °C) were experimentally examined and the correlation between catalyst structure and catalytic activity was characterized and the role of oxygen in catalytic reaction was discussed. Polychlorinated dibenzo-p-dioxins and dibenzofurans (PCDD/Fs) generation during 1,2-DCBz catalytic oxidation by CuOx/TiO2-CNTs composite catalyst was also examined. Results indicate that the 1,2-DCBz destruction/removal efficiencies of CuOx (4 wt%)/TiO2 catalyst at 150 °C and 350 °C with a GHSV of 3400 h(-1) are 59% and 94% respectively and low-temperature (150 °C) catalytic activity of CuOx/TiO2 on 1,2-DCBz oxidation can be improved from 59 to 77% when CNTs are introduced. Furthermore, oxygen either in catalyst or from reaction atmosphere is indispensible in reaction. The former is offered to activate and oxidize the 1,2-DCBz adsorbed on catalyst, thus can be generally consumed during reaction and the oxygen content in catalyst is observed lost from 39.9 to 35.0 wt% after reacting under inert atmosphere; the latter may replenish the vacancy in catalyst created by the consumed oxygen thus extends the catalyst life and raises the destruction/removal efficiency. The introduction of CNTs also increases the Cu(2+)/Cu(+) ratio, chemisorbed oxygen concentration and surface lattice oxygen binding energy which are closely related with catalytic activity. PCDD/Fs is confirmed to be formed when 1,2-DCBz catalytically oxidized by CuOx/TiO2-CNTs composite catalyst with sufficient oxygen (21%), proper temperature (350 °C) and high concentration of 1,2-DCBz feed (120 ppm

ORF Alignment: NC_003197 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available lucose-specific, factor II - Salmonella typhimurium ... Length = 77 ... Query: 401 MAPALVAAFGGKENITNLDAC...ITRLRVSVADVAKVDXXXXXXXXXXXXXXXXXXXXXIFG 460 ... MAPALVAAFGGKENITNLDACITRLR...VSVADVAKVD ... IFG Sbjct: 1 ... MAPALVAAFGGKENITNLDACITRLRVSVADVAKVDQAGLKKLGAAGVVVAGSGVQAIFG 60 ...

ORF Alignment: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available lucose-specific, factor II - Salmonella typhimurium ... Length = 77 ... Query: 401 MAPALVAAFGGKENITNLDAC...ITRLRVSVADVAKVDXXXXXXXXXXXXXXXXXXXXXIFG 460 ... MAPALVAAFGGKENITNLDACITRLR...VSVADVAKVD ... IFG Sbjct: 1 ... MAPALVAAFGGKENITNLDACITRLRVSVADVAKVDQAGLKKLGAAGVVVAGSGVQAIFG 60 ...

Piezoresistive Sensor with High Elasticity Based on 3D Hybrid Network of Sponge@CNTs@Ag NPs.

Science.gov (United States)

Zhang, Hui; Liu, Nishuang; Shi, Yuling; Liu, Weijie; Yue, Yang; Wang, Siliang; Ma, Yanan; Wen, Li; Li, Luying; Long, Fei; Zou, Zhengguang; Gao, Yihua

2016-08-31

Pressure sensors with high elasticity are in great demand for the realization of intelligent sensing, but there is a need to develope a simple, inexpensive, and scalable method for the manufacture of the sensors. Here, we reported an efficient, simple, facile, and repeatable "dipping and coating" process to manufacture a piezoresistive sensor with high elasticity, based on homogeneous 3D hybrid network of carbon nanotubes@silver nanoparticles (CNTs@Ag NPs) anchored on a skeleton sponge. Highly elastic, sensitive, and wearable sensors are obtained using the porous structure of sponge and the synergy effect of CNTs/Ag NPs. Our sensor was also tested for over 2000 compression-release cycles, exhibiting excellent elasticity and cycling stability. Sensors with high performance and a simple fabrication process are promising devices for commercial production in various electronic devices, for example, sport performance monitoring and man-machine interfaces.

Smart Construction of Integrated CNTs/Li4Ti5O12 Core/Shell Arrays with Superior High-Rate Performance for Application in Lithium-Ion Batteries.

Science.gov (United States)

Yao, Zhujun; Xia, Xinhui; Zhou, Cheng-Ao; Zhong, Yu; Wang, Yadong; Deng, Shengjue; Wang, Weiqi; Wang, Xiuli; Tu, Jiangping

2018-03-01

Exploring advanced high-rate anodes is of great importance for the development of next-generation high-power lithium-ion batteries (LIBs). Here, novel carbon nanotubes (CNTs)/Li 4 Ti 5 O 12 (LTO) core/shell arrays on carbon cloth (CC) as integrated high-quality anode are constructed via a facile combined chemical vapor deposition-atomic layer deposition (ALD) method. ALD-synthesized LTO is strongly anchored on the CNTs' skeleton forming core/shell structures with diameters of 70-80 nm the combined advantages including highly conductive network, large surface area, and strong adhesion are obtained in the CC-LTO@CNTs core/shell arrays. The electrochemical performance of the CC-CNTs/LTO electrode is completely studied as the anode of LIBs and it shows noticeable high-rate capability (a capacity of 169 mA h g -1 at 1 C and 112 mA h g -1 at 20 C), as well as a stable cycle life with a capacity retention of 86% after 5000 cycles at 10 C, which is much better than the CC-LTO counterpart. Meanwhile, excellent cycling stability is also demonstrated for the full cell with LiFePO 4 cathode and CC-CNTs/LTO anode (87% capacity retention after 1500 cycles at 10 C). These positive features suggest their promising application in high-power energy storage areas.

Smart Construction of Integrated CNTs/Li4Ti5O12 Core/Shell Arrays with Superior High‐Rate Performance for Application in Lithium‐Ion Batteries

Science.gov (United States)

Yao, Zhujun; Zhou, Cheng‐ao; Zhong, Yu; Wang, Yadong; Deng, Shengjue; Wang, Weiqi; Wang, Xiuli

2018-01-01

Abstract Exploring advanced high‐rate anodes is of great importance for the development of next‐generation high‐power lithium‐ion batteries (LIBs). Here, novel carbon nanotubes (CNTs)/Li4Ti5O12 (LTO) core/shell arrays on carbon cloth (CC) as integrated high‐quality anode are constructed via a facile combined chemical vapor deposition–atomic layer deposition (ALD) method. ALD‐synthesized LTO is strongly anchored on the CNTs' skeleton forming core/shell structures with diameters of 70–80 nm the combined advantages including highly conductive network, large surface area, and strong adhesion are obtained in the CC‐LTO@CNTs core/shell arrays. The electrochemical performance of the CC‐CNTs/LTO electrode is completely studied as the anode of LIBs and it shows noticeable high‐rate capability (a capacity of 169 mA h g−1 at 1 C and 112 mA h g−1 at 20 C), as well as a stable cycle life with a capacity retention of 86% after 5000 cycles at 10 C, which is much better than the CC‐LTO counterpart. Meanwhile, excellent cycling stability is also demonstrated for the full cell with LiFePO4 cathode and CC‐CNTs/LTO anode (87% capacity retention after 1500 cycles at 10 C). These positive features suggest their promising application in high‐power energy storage areas. PMID:29593977

Fabrication of Single, Vertically Aligned Carbon Nanotubes in 3D Nanoscale Architectures

Science.gov (United States)

Kaul, Anupama B.; Megerian, Krikor G.; Von Allmen, Paul A.; Baron, Richard L.

2010-01-01

Plasma-enhanced chemical vapor deposition (PECVD) and high-throughput manufacturing techniques for integrating single, aligned carbon nanotubes (CNTs) into novel 3D nanoscale architectures have been developed. First, the PECVD growth technique ensures excellent alignment of the tubes, since the tubes align in the direction of the electric field in the plasma as they are growing. Second, the tubes generated with this technique are all metallic, so their chirality is predetermined, which is important for electronic applications. Third, a wafer-scale manufacturing process was developed that is high-throughput and low-cost, and yet enables the integration of just single, aligned tubes with nanoscale 3D architectures with unprecedented placement accuracy and does not rely on e-beam lithography. Such techniques should lend themselves to the integration of PECVD grown tubes for applications ranging from interconnects, nanoelectromechanical systems (NEMS), sensors, bioprobes, or other 3D electronic devices. Chemically amplified polyhydroxystyrene-resin-based deep UV resists were used in conjunction with excimer laser-based (lambda = 248 nm) step-and-repeat lithography to form Ni catalyst dots = 300 nm in diameter that nucleated single, vertically aligned tubes with high yield using dc PECVD growth. This is the first time such chemically amplified resists have been used, resulting in the nucleation of single, vertically aligned tubes. In addition, novel 3D nanoscale architectures have been created using topdown techniques that integrate single, vertically aligned tubes. These were enabled by implementing techniques that use deep-UV chemically amplified resists for small-feature-size resolution; optical lithography units that allow unprecedented control over layer-to-layer registration; and ICP (inductively coupled plasma) etching techniques that result in near-vertical, high-aspect-ratio, 3D nanoscale architectures, in conjunction with the use of materials that are

CMS Tracker Alignment Performance Results Start-Up 2017

CERN Document Server

CMS Collaboration

2017-01-01

During the LHC shutdown in Winter 2016/17, the CMS pixel detector, the inner component of the CMS Tracker, was replaced by the Phase-1 upgrade detector. Among others improvements, the new pixel detector consists of four instead of three layers in the central barrel region (BPIX) and three instead of two disks in the endcap regions (FPIX). In this report, performance plots of the first pixel-detector alignment results are presented, which were obtained with cosmic-ray data taken prior to the start of the 2017 LHC pp operation. Alignment constants have been derived using the data collected initially at 0T and later at 3.8T magnetic field to the level of single module positions in the pixel detector, while keeping the alignment parameters of the strip detector fixed at the values determined in the end of 2016. The complete understanding of the alignment and biases was derived by using two algorithms, Millepede-II and HipPy. The results confirm each other.

Fabrication of aligned carbon nanotubes on Cu catalyst by dc plasma-enhanced catalytic decomposition

Energy Technology Data Exchange (ETDEWEB)

Zhang Zhejuan [Department of Physics, Engineering Research Center for Nanophotonics and Advanced Instrument, East China Normal University, North Zhongshan Road 3663, 200062 Shanghai (China); Shakerzadeh, Maziar; Tay, Beng Kang; Li Xiaocheng; Tan Chongwei [School of Electrical and Electronic Engineering, Nanyang Technological University, Nanyang Avenue 50, 639798 Singapore (Singapore); Lin Lifeng; Guo Pingsheng; Feng Tao [Department of Physics, Engineering Research Center for Nanophotonics and Advanced Instrument, East China Normal University, North Zhongshan Road 3663, 200062 Shanghai (China); Sun Zhuo, E-mail: zsun@phy.ecnu.edu.cn [Department of Physics, Engineering Research Center for Nanophotonics and Advanced Instrument, East China Normal University, North Zhongshan Road 3663, 200062 Shanghai (China)

2009-04-01

Aligned multi-walled carbon nanotubes (ACNTs) are deposited using copper (Cu) catalyst on Chromium (Cr)-coated substrate by plasma-enhanced chemical vapor deposition at temperature of 700 deg. C. Acetylene gas has been used as the carbon source while ammonia is used for diluting and etching. The thicknesses of Cu films on Cr-coated Si (100) substrates are controlled by deposition time of magnetron sputtering. The growth behaviors and quality of ACNTs are investigated by scanning electron microscopy (SEM) and transmission electron microscopy. The different performance of ACNTs on various Cu films is explained by referring to the graphitic order as detected by Raman spectroscopy. The results indicate that the ACNTs are formed in tip-growth model where Cu is used as a novel catalyst, and the thickness of Cu films is responsible to the diameter and quality of synthesized CNTs.

Development and Characterization of Carbon Nanotubes (CNTs) and Silicon Carbide (SiC) Reinforced Al-based Nanocomposites

Science.gov (United States)

Gujba, Kachalla Abdullahi

Composites are engineered materials developed from constituent materials; matrix and reinforcements, to attain synergistic behavior at the micro and macroscopic level which are different from the individual materials. The high specific strength, low weight, excellent chemical resistance and fatigue endurance makes these composites superior than other materials despite anisotropic behaviors. Metal matrix composites (MMCs) have excellent physical and mechanical properties and alumium (Al) alloy composites have gained considerable interest and are used in multiple industries including: aerospace, structural and automotive. The aim of this research work is to develop an advanced Al-based nanocomposites reinforced with Carbon nanotubes (CNTs) and silicon carbide particulates (SiCp) nanophases using mechanical alloying and advanced consolidation procedure (Non-conventional) i.e. Spark Plasma Sintering (SPS) using two types of aluminum alloys (Al-7Si-0.3mg and Al-12Si-0.3Mg). Different concentrations of SiCp and CNTs were added and ball milled for different milling periods under controlled atmosphere to study the effect of milling time and the distribution of the second phases. Characterization techniques were used to investigate the morphology of the as received monolithic and milled powder using Field Emission Scanning Electron Microscope (FESEM), Energy Dispersive Spectroscopy (EDS), X-Ray Mapping, X-Ray Diffraction (XRD) and Particle Size Analyses (PSA). The results revealed that the addition of high concentrations of SiCp and CNTs in both alloys aided in refining the structure of the resulting powder further as the reinforcement particles acted like a grinding agent. Good distribution of reinforcing particles was observed from SEM and no compositional fluctuations were observed from the EDS. Some degree of agglomerations was observed despite the ethyl alcohol sonication effect of the CNTs before ball milling. From the XRD; continuous reduction in crystallite size and

Treatment management between orthodontists and general practitioners performing clear aligner therapy.

Science.gov (United States)

Best, Alexandra D; Shroff, Bhavna; Carrico, Caroline K; Lindauer, Steven J

2017-05-01

To investigate differences in case selection, treatment management, and aligner treatment expertise between orthodontists and general practitioners. A parallel pair of original surveys with three sections (case selection, treatment management, and demographics) was sent to orthodontists (N = 1000) and general dentists (N = 1000) who were providers of aligner treatment. Orthodontists had treated significantly more patients with aligners, had treated more patients with aligners in the previous 12 months, and had received more aligner training than general dentists (P aligner case confidence between orthodontists and general dentists for several malocclusions. General dentists were more confident than orthodontists in treating deep bite, severe crowding, and Class II malocclusions with aligners (P ≤ .0001). Significant differences were also found for all treatment management techniques except interproximal reduction. There was a significant difference in case selection, treatment management, and aligner expertise between orthodontists and general dentists, although the differences in case selection were small. Overall, it was shown that orthodontists and general dentists elected to treat a variety of moderate to severe malocclusions with aligners but with different utilization of recommended auxiliaries, perhaps demonstrating a difference in treatment goals.

Preparation of the Pt/CNTs Catalyst and Its Application to the Fabrication of Hydrogenated Soybean Oil Containing a Low Content of Trans Fatty Acids Using the Solid Polymer Electrolyte Reactor.

Science.gov (United States)

Zheng, Huanyu; Ding, Yangyue; Xu, Hui; Zhang, Lin; Cui, Yueting; Han, Jianchun; Zhu, Xiuqing; Yu, Dianyu; Jiang, Lianzhou; Liu, Lilai

2018-08-01

Pt/CNTs were synthesized with an ethylene glycol reduction method, and the effects of carboxyl functionalization, ultrasonic power and the concentration of chloroplatinic acid on the catalytic activity of Pt/CNTs were investigated. The optimal performance of the Pt/CNTs catalyst was obtained when the ultrasonic power was 300 W and the concentration of chloroplatinic acid was 40 mg/mL. The durability and stability of the Pt/CNTs catalyst were considerably better compared to Pt/C, as shown by cyclic voltammetry measurement results. The trans fatty acids content of the obtained hydrogenated soybean oil (IV: 108.4 gl2/100 g oil) using Pt/CNTs as the cathode catalyst in a solid polymer electrolyte reactor was only 1.49%. The IV of hydrogenated soybean oil obtained using CNTs as carrier with Pt loading 0.1 mg/cm2 (IV: 108.4 gl2/100 g oil) was lower than carbon with a Pt loading of 0.8 mg/cm2 (IV: 109.9 gl2/100 g oil). Thus, to achive the same IV, the usage of Pt was much less when carbon nanotubes were selected as catalyst carrier compared to traditional carbon carrier. The changes of fatty acid components and the hydrogenated selectivity of octadecenoic acid were also discussed.

Reduction of deviation angle during occlusion therapy: in partially accommodative esotropia with moderate amblyopia.

Science.gov (United States)

Chun, Bo Young; Kwon, Soon Jae; Chae, Sun Hwa; Kwon, Jung Yoon

2007-09-01

To evaluate changes in ocular alignment in partially accommodative esotropic children age ranged from 3 to 8 years during occlusion therapy for amblyopia. Angle measurements of twenty-two partially accommodative esotropic patients with moderate amblyopia were evaluated before and at 2 years after occlusion therapy. Mean deviation angle with glasses at the start of occlusion treatment was 19.45+/-5.97 PD and decreased to 12.14+/-12.96 PD at 2 years after occlusion therapy (pocclusion therapy, 9 (41%) cases were indications of surgery for residual deviation but if we had planned surgery before occlusion treatment, 18 (82%) of patients would have had surgery. There was a statistical relationship between increase of visual acuity ratio and decrease of deviation angle (r=-0.479, p=0.024). There was a significant reduction of deviation angle of partially accommodative esotropic patients at 2 years after occlusion therapy. Our results suggest that occlusion therapy has an influence on ocular alignment in partially accommodative esotropic patients with amblyopia.

Multiscale mechanics of the lateral pressure effect on enhancing the load transfer between polymer coated CNTs.

Science.gov (United States)

Yazdandoost, Fatemeh; Mirzaeifar, Reza; Qin, Zhao; Buehler, Markus J

2017-05-04

While individual carbon nanotubes (CNTs) are known as one of the strongest fibers ever known, even the strongest fabricated macroscale CNT yarns and fibers are still significantly weaker than individual nanotubes. The loss in mechanical properties is mainly because the deformation mechanism of CNT fibers is highly governed by the weak shear strength corresponding to sliding of nanotubes on each other. Adding polymer coating to the bundles, and twisting the CNT yarns to enhance the intertube interactions are both efficient methods to improve the mechanical properties of macroscale yarns. Here, we perform molecular dynamics (MD) simulations to unravel the unknown deformation mechanism in the intertube polymer chains and also local deformations of the CNTs at the atomistic scale. Our results show that the lateral pressure can have both beneficial and adverse effects on shear strength of polymer coated CNTs, depending on the local deformations at the atomistic scale. In this paper we also introduce a bottom-up bridging strategy between a full atomistic model and a coarse-grained (CG) model. Our trained CG model is capable of incorporating the atomistic scale local deformations of each CNT to the larger scale collect behavior of bundles, which enables the model to accurately predict the effect of lateral pressure on larger CNT bundles and yarns. The developed multiscale CG model is implemented to study the effect of lateral pressure on the shear strength of straight polymer coated CNT yarns, and also the effect of twisting on the pull-out force of bundles in spun CNT yarns.

Mechanical coupling limits the density and quality of self-organized carbon nanotube growth

Science.gov (United States)

Bedewy, Mostafa; Hart, A. John

2013-03-01

Aligned carbon nanotube (CNT) structures are promising for many applications; however, as-grown CNT "forests" synthesized by chemical vapor deposition (CVD) are typically low-density and mostly comprise tortuous defective CNTs. Here, we present evidence that the density and alignment of self-organized CNT growth is limited by mechanical coupling among CNTs in contact, in combination with their diameter-dependent growth rates. This study is enabled by comprehensive X-ray characterization of the spatially and temporally-varying internal morphology of CNT forests. Based on this data, we model the time evolution and diameter-dependent scaling of the ensuing mechanical forces on catalyst nanoparticles during CNT growth, which arise from the mismatch between the collective lengthening rate of the forest and the diameter-dependent growth rates of individual CNTs. In addition to enabling self-organization of CNTs into forests, time-varying forces between CNTs in contact dictate the hierarchical tortuous morphology of CNT forests, and may be sufficient to influence the structural quality of CNTs. These forces reach a maximum that is coincident with the maximum density observed in our growth process, and are proportional to CNT diameter. Therefore, we propose that improved manufacturing strategies for self-organized CNTs should consider both chemical and mechanical effects. This may be especially necessary to achieve high density CNT forests with low defect density, such as for improved thermal interfaces and high-permeability membranes.Aligned carbon nanotube (CNT) structures are promising for many applications; however, as-grown CNT "forests" synthesized by chemical vapor deposition (CVD) are typically low-density and mostly comprise tortuous defective CNTs. Here, we present evidence that the density and alignment of self-organized CNT growth is limited by mechanical coupling among CNTs in contact, in combination with their diameter-dependent growth rates. This study is

CMS Tracker Alignment Performance Results 2016

CERN Document Server

CMS Collaboration

2017-01-01

The tracking system of the CMS detector provides excellent resolution for charged particle tracks and an efficient way of tagging jets. In order to reconstruct good quality tracks, the position and orientation of each silicon pixel and strip module needs to be determined with a precision of several micrometers. The presented alignment results are derived following a global (Millepede-II) and a local (HipPy) fit approach. The performance of the CMS tracker alignment in 2016 using cosmic-ray data and the complete set of proton-proton collision data recorded at 3.8 T magnetic field has been studied. The data-driven validation of the results are shown. The time-dependent movement of the pixel detector's large-scale structure is demonstrated.

Looking for New Naturally Aligned Higgs Doublets at the LHC

CERN Document Server

Pilaftsis, Apostolos

2015-10-30

Since the current LHC Higgs data suggest the couplings of the observed 125 GeV Higgs boson to be close to the Standard Model (SM) expectations, any extended Higgs sector must lead to the so-called SM alignment limit, where one of the Higgs bosons behaves exactly like that of the SM. In the context of the Two Higgs Doublet Model (2HDM), this alignment is often associated with either decoupling of the heavy Higgs sector or accidental cancellations in the 2HDM potential. We present a novel symmetry justification for 'natural' alignment without necessarily decoupling or fine-tuning. We show that there exist only three different symmetry realizations of the natural alignment scenario in 2HDM. We analyze new collider signals for the heavy Higgs sector in the natural alignment limit, which dominantly lead to third-generation quarks in the final state and can serve as a useful observational tool during the Run-II phase of the LHC.

Immunotoxicity of nanoparticles: a computational study suggests that CNTs and C60 fullerenes might be recognized as pathogens by Toll-like receptors

Science.gov (United States)

Turabekova, M.; Rasulev, B.; Theodore, M.; Jackman, J.; Leszczynska, D.; Leszczynski, J.

2014-03-01

Over the last decade, a great deal of attention has been devoted to study the inflammatory response upon exposure to multi/single-walled carbon nanotubes (CNTs) and different fullerene derivatives. In particular, carbon nanoparticles are reported to provoke substantial inflammation in alveolar and bronchial epithelial cells, epidermal keratinocytes, cultured monocyte-macrophage cells, etc. We suggest a hypothetical model providing the potential mechanistic explanation for immune and inflammatory responses observed upon exposure to carbon nanoparticles. Specifically, we performed a theoretical study to analyze CNT and C60 fullerene interactions with the available X-ray structures of Toll-like receptors (TLRs) homo- and hetero-dimer extracellular domains. This assumption was based on the fact that similar to the known TLR ligands both CNTs and fullerenes induce, in cells, the secretion of certain inflammatory protein mediators, such as interleukins and chemokines. These proteins are observed within inflammation downstream processes resulted from the ligand molecule dependent inhibition or activation of TLR-induced signal transduction. Our computational studies have shown that the internal hydrophobic pockets of some TLRs might be capable of binding small-sized carbon nanostructures (5,5 armchair SWCNTs containing 11 carbon atom layers and C60 fullerene). High binding scores and minor structural alterations induced in TLR ectodomains upon binding C60 and CNTs further supported our hypothesis. Additionally, the proposed hypothesis is strengthened by the indirect experimental findings indicating that CNTs and fullerenes induce an excessive expression of specific cytokines and chemokines (i.e. IL-8 and MCP1).Over the last decade, a great deal of attention has been devoted to study the inflammatory response upon exposure to multi/single-walled carbon nanotubes (CNTs) and different fullerene derivatives. In particular, carbon nanoparticles are reported to provoke

Tevatron alignment issues 2003-2004

International Nuclear Information System (INIS)

Volk, J.T.; Annala, J.; Elementi, L.; Gelfand, N.; Gollwitzer, K.E.; Greenwood, J.; Martens, M.; Moore, C.; Nobrega, A.; Russell, A.D.; Shiltsev, V.; Stefanski, R.; Sager, T.; Syphers, M.J.; Wojcik, G.

2005-01-01

It was observed during the early part of Run II that dipole corrector currents in the Tevatron were changing over time. Measurement of the roll for dipoles and quadrupoles confirmed that there was a slow and systematic movement of the magnets from their ideal position. A simple system using a digital protractor and laptop computer was developed to allow roll measurements of all dipoles and quadrupoles. These measurements showed that many magnets in the Tevatron had rolled more than 1 milliradian. To aid in magnet alignment a new survey network was built in the Tevatron tunnel. This network is based on the use of free centering laser tracker. During the measurement of the network coordinates for all dipole, quadrupole and corrector magnets were obtained. This paper discusses roll measurement techniques and data, the old and new Tevatron alignment network

Adding the combination of CNTs and MoS{sub 2} into halogen-free flame retarding TPEE with enhanced the anti-dripping behavior and char forming properties

Energy Technology Data Exchange (ETDEWEB)

Zhong, Yuhua; Li, Maolin; Zhang, Luchong; Zhang, Xuewei; Zhu, Songwei; Wu, Wei, E-mail: wuwei@ecust.edu.cn

2015-08-10

Highlights: • Introduction the combination of the CNTs and MoS{sub 2} into P–N flame retarding TPEE. • Binary synergists for P–N flame retardants in TPEE. • Increase of char yield and form the stable carbonaceous char. - Abstract: In this paper, the nanocomposites thermoplastic polyester-ether elastomer (TPEE) with phosphorus–nitrogen (P–N) flame retardants, carbon nanotubes (CNTs) and molybdenum disulfide (MoS{sub 2}) was prepared by melt blending. TPEE containing P–N flame retardant, CNTs and MoS{sub 2} achieved UL94 V-0 rating due to the better barrier effect of the special structure. The structure was supported by the result of rheological properties. The thermal stability was studied by thermal gravimetric analysis (TGA) and char residue characterization was investigated by SEM–EDX measurements. The results demonstrated that the combination of CNTs and MoS{sub 2} results in the increase of char yield and the formation of the thermally stable char which can effectively prevent in the dripping behavior during the burning process.

Novel methods in track-based alignment to correct for time-dependent distortions of the ATLAS Inner Detector

CERN Document Server

Estrada Pastor, Oscar; The ATLAS collaboration

2017-01-01

ATLAS is a multipurpose experiment at the LHC proton-proton collider. Its physics goals require high resolution, unbiased measurement of all charged particle kinematic parameters. These critically depend on the layout and performance of the tracking system and the quality of its offline alignment. For the LHC Run II, the system has been upgraded with the installation of a new pixel layer, the Insertable B-layer (IBL). Offline track alignment of the ATLAS tracking system has to deal with about 700,000 degrees of freedom (DoF) defining its geometrical parameters, representing a considerable numerical challenge in terms of both CPU time and precision. An outline of the track based alignment approach and its implementation within the ATLAS software will be presented. Special attention will be paid to describe the techniques allowing to pinpoint and eliminate track parameters biases due to alignment. During Run-II, ATLAS Inner Detector Alignment framework has been adapted and upgraded to correct very short time sc...

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000909 gi|15669839 >1ii8A 3 194 4 202 2e-10 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

ORF Alignment: NC_002945 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002945 gi|31791180 >1ii8A 1 187 1 168 2e-14 ... ref|NP_853673.1| DNA REPLICATION A...D92865.1| ... DNA REPLICATION AND REPAIR PROTEIN RECF (SINGLE-STRAND ... DNA BINDING PROTEIN)

Fabrication of Al5083 surface composites reinforced by CNTs and cerium oxide nano particles via friction stir processing

Energy Technology Data Exchange (ETDEWEB)

Hosseini, S.A. [Department of Materials Science and Engineering, Faculty of Engineering, Shahid Chamran University of Ahvaz (Iran, Islamic Republic of); Ranjbar, Khalil, E-mail: k_ranjbar@scu.ac.ir [Department of Materials Science and Engineering, Faculty of Engineering, Shahid Chamran University of Ahvaz (Iran, Islamic Republic of); Dehmolaei, R. [Department of Materials Science and Engineering, Faculty of Engineering, Shahid Chamran University of Ahvaz (Iran, Islamic Republic of); Amirani, A.R. [12th Ghaem Street, Bld. Hashemzadeh, Shahrak Golestan, Tehran (Iran, Islamic Republic of)

2015-02-15

Highlights: • Using friction stir processing, an effect of CNTs and CeO{sub 2} reinforcements on mechanical and corrosion properties of Al5083 alloy is reported. • The strength of Al5083 was increased by 42%, its matrix grain size reduced five times, and hardness was doubled by the incorporation of CNTs-CeO{sub 2} mixture in the volume ratio of 75-25 respectively. • Unlike the CNTs, incorporation of nanosized CeO{sub 2} particles resulted in remarkable increase in pitting resistance of the alloy. - Abstract: In the present investigation, friction stir processing (FSP) was utilized to incorporate Multi Walled Carbon Nano Tubes (MWCNT) and nanosized cerium oxide particles into the matrix of Al5083 alloy to form surface reinforced composites. The effect of these nanosized reinforcements either separately or in the combined form, on microstructural modification, mechanical properties and corrosion resistance of FSPed Al5083 surface composites was studied. A threaded cylindrical hardened steel tool was used with the rotation speeds of 600 and 800 rpm and travel speeds of 35 and 45 mm/min and a tilt angle of 5°. Mechanical properties and corrosion resistance of FSPed samples were evaluated and compared with the base alloy. The maximum tensile strength and hardness value were achieved for the hybrid composite containing a mixture of CNTs and cerium oxide in the volume ratio of 75-25, respectively, whereas a significant increase in pitting resistance of the base alloy was obtained when cerium oxide alone was incorporated. The corrosion behavior of the samples was investigated by potentiodynamic polarization tests and assessed in term of pitting potential and passivation range. Microstructural analysis carried out by using optical and electron microscopes showed that reinforcements are well dispersed inside the nugget zone (NZ), and remarkable grain refinement is gained. The study was aimed to fabricate surface composites with improved mechanical properties and

Synthesis of Vertically-Aligned Carbon Nanotubes from Langmuir-Blodgett Films Deposited Fe Nanoparticles on Al2O3/Al/SiO2/Si Substrate.

Science.gov (United States)

Takagiwa, Shota; Kanasugi, Osamu; Nakamura, Kentaro; Kushida, Masahito

2016-04-01

In order to apply vertically-aligned carbon nanotubes (VA-CNTs) to a new Pt supporting material of polymer electrolyte fuel cell (PEFC), number density and outer diameter of CNTs must be controlled independently. So, we employed Langmuir-Blodgett (LB) technique for depositing CNT growth catalysts. A Fe nanoparticle (NP) was used as a CNT growth catalyst. In this study, we tried to thicken VA-CNT carpet height and inhibit thermal aggregation of Fe NPs by using Al2O3/Al/SiO2/Si substrate. Fe NP LB films were deposited on three typed of substrates, SiO2/Si, as-deposited Al2O3/Al/SiO2/Si and annealed Al2O3/Al/SiO2/Si at 923 K in Ar atmosphere of 16 Pa. It is known that Al2O3/Al catalyzes hydrocarbon reforming, inhibits thermal aggregation of CNT growth catalysts and reduces CNT growth catalysts. It was found that annealed Al2O3/Al/SiO2/Si exerted three effects more strongly than as-deposited Al2O3/Al/SiO2/Si. VA-CNTs were synthesized from Fe NPs-C16 LB films by thermal chemical vapor deposition (CVD) method. As a result, at the distance between two nearest CNTs 28 nm or less, VA-CNT carpet height on annealed Al2O3/Al/SiO2/Si was about twice and ten times thicker than that on SiO2/Si and that on as-deposited Al2O3/Al/SiO2/Si, respectively. Moreover, distribution of CNT outer diameter on annealed Al2O3/Al/SiO2/Si was inhibited compared to that on SiO2/Si. These results suggest that since thermal aggregation of Fe NPs is inhibited, catalyst activity increases and distribution of Fe NP size is inhibited.

ORF Alignment: NT_033779 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available m A [Drosophila melanogaster] gb|AAF53342.1| ... CG7885-PA, isoform A [Drosophila melanogaster] ... gb|AAF44826.1| symb...ol=RpII33; synonym=BG:DS00941.10; ... cDNA=method:''sim4'', score:''1000.0''

Advanced oxidation (H2O2 and/or UV) of functionalized carbon nanotubes (CNT-OH and CNT-COOH) and its influence on the stabilization of CNTs in water and tannic acid solution

International Nuclear Information System (INIS)

Czech, Bożena; Oleszczuk, Patryk; Wiącek, Agnieszka

2015-01-01

The properties of carbon nanotubes (CNTs) functionalized with –OH and –COOH groups during simulated water treatment with H 2 O 2 and/or UV were tested. There following properties of CNTs were investigated: specific surface area, elemental composition (CHN), dynamic light scattering, Raman spectroscopy, X-ray photoelectron spectroscopy and changes in the CNTs structure were observed using transmission electron microscopy. Treatment of CNTs with H 2 O 2 and/or UV affected their properties. This effect, however, was different depending on the functionalization of CNTs and also on the factor used (UV and/or H 2 O 2 ). H 2 O 2 plays a key role as a factor modifying the surface of CNT-OHs, whereas the properties of CNT-COOHs were most affected by UV rays. A shortening of the nanotubes, exfoliation, the opening of their ends, and changes in the surface charge were observed as a result of the action of UV and/or H 2 O 2 . The changes in observed parameters may influence the stability of the aqueous suspensions of CNTs. - Highlights: • Treatment of CNT–OH and CNT–COOH with H 2 O 2 and/or UV affected their properties. • This effect was different depending on the functionalization of CNTs and factor used. • H 2 O 2 was a factor modifying CNT-OHs surface, whereas UV affected most CNT-COOHs. • The shorten, exfoliated, open tubes with changed surface charge were observed. • All these changes influenced the stability of the aqueous suspensions of CNTs. - The research identified how advanced wastewater treatment methods (UV and/or H 2 O 2 ) affected carbon nanomaterials properties, their mobility (ability to aggregate) and then toxicity

Comparative evaluation of toric intraocular lens alignment and visual quality with image-guided surgery and conventional three-step manual marking.

Science.gov (United States)