WorldWideScience

Sample records for parkway section 8b

  1. Foothills Parkway Section 8B Final Environmental Report, Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    Blasing, T.J.; Cada, G.F.; Carer, M.; Chin, S.M.; Dickerman, J.A.; Etnier, D.A.; Gibson, R.; Harvey, M.; Hatcher, B.; Lietzske, D.; Mann, L.K.; Mulholland, P.J.; Petrich, C.H.; Pounds, L.; Ranney, J.; Reed, R.M.; Ryan, P.F.; Schweitzer, M.; Smith, D.; Thomason, P.; Wade, M.C.

    1999-07-01

    In 1994, Oak Ridge National Laboratory (ORNL) was tasked by the National Park Service (NPS) to prepare an Environmental Report (ER) for Section 8B of the Foothills Parkway in the Great Smoky Mountains National Park (GSMNP). Section 8B represents 27.7 km (14.2 miles) of a total of 115 km (72 miles) of the planned Foothills Parkway and would connect the Cosby community on the east to the incorporated town of Pittman Center to the west.

  2. Foothills Parkway Section 8B Final Environmental Report, Volume 2, Appendices A-C

    Energy Technology Data Exchange (ETDEWEB)

    Blasing, T.J.; Cada, G.F.; Carer, M.; Chin, S.M.; Dickerman, J.A.; Etnier, D.A.; Gibson, R.; Harvey, M.; Hatcher, B.; Lietzske, D.; Mann, L.K.; Mulholland, P.J.; Petrich, C.H.; Pounds, L.; Ranney, J.; Reed, R.M.; Ryan, P.F.; Schweitzer, M.; Smith, D.; Thomason, P.; Wade, M.C.

    1999-07-01

    In 1994, Oak Ridge National Laboratory (ORNL) was tasked by the National Park Service (NPS) to prepare an Environmental Report (ER) for Section 8B of the Foothills Parkway in the Great Smoky Mountains National Park (GSMNP). Section 8B represents 27.7 km (14.2 miles) of a total of 115 km (72 miles) of the planned Foothills Parkway and would connect the Cosby community on the east to the incorporated town of Pittman Center to the west. The major deliverables for the project are listed. From August 1995 through October 1996, NW, GSMNP, and ORNL staff interacted with Federal Highway Administration staff to develop a conceptual design plan for Section 8B with the intent of protecting critical resources identified during the ER process to the extent possible. In addition, ORNL arranged for bioengineering experts to discuss techniques that might be employed on Section 8B with NPS, GSMNP, and ORNL staff during September 1996. For the purposes of this EN there are two basic alternatives under consideration: (1) a build alternative and (2) a no-build alternative. Within the build alternative are a number of options including constructing Section 8B with no interchanges, constricting Section 8B with an interchange at SR 416 or U.S. 321, constructing Section 8B with a spur road on Webb Mountain, and considering operation of Section 8B both before and after the operation of Section 8C. The no-build alternative is considered the no-action alternative and is not to construct Section 8B. This volume of the ER, which consists of Appendices A, B, and C, assesses the potential geologic impacts of the proposed Section 8B construction, presents the results of the Section 8B soil survey, and describes the water quality studies and analyses performed for the ER. The following summary sections provide information for geology, soils, and water quality.

  3. Foothills Parkway Section 8B Final Environmental Report, Volume 6, Appendix N

    Energy Technology Data Exchange (ETDEWEB)

    Blasing, T.J.; Cada, G.F.; Carer, M.; Chin, S.M.; Dickerman, J.A.; Etnier, D.A.; Gibson, R.; Harvey, M.; Hatcher, B.; Lietzske, D.; Mann, L.K.; Mulholland, P.J.; Petrich, C.H.; Pounds, L.; Ranney, J.; Reed, R.M.; Ryan, P.F.; Schweitzer, M.; Smith, D.; Thomason, P.; Wade, M.C.

    1999-07-01

    In 1994, Oak Ridge National Laboratory (ORNL) was tasked by the National Park Service (NPS) to prepare an Environmental Report (ER) for Section 8B of the Foothills Parkway in the Great Smoky Mountains National Park (GSMNP). Section 8B represents 27.7 km (14.2 miles) of a total of 115 km (72 miles) of the planned Foothills Parkway and would connect the Cosby community on the east to the incorporated town of Pittman Center to the west. The major deliverables for the project are listed. From August 1995 through October 1996, NPS, GSMNP, and ORNL staff interacted with Federal Highway Administration staff to develop a conceptual design plan for Section 8B with the intent of protecting critical resources identified during the ER process to the extent possible. In addition, ORNL arranged for bioengineering experts to discuss techniques that might be employed on Section 8B with NPS, GSMNP, and ORNL staff during September 1996. For the purposes of this ER, there are two basic alternatives under consideration: (1) a build alternative and (2) a no-build alternative. Within the build alternative are a number of options including constructing Section 8B with no interchanges, constructing Section 8B with an interchange at SR 416 or U.S. 321, constructing Section 8B with a spur road on Webb Mountain, and considering operation of Section 8B both before and after the operation of Section 8C. The no-build alternative is considered the no-action alternative and is not to construct Section 8B. This volume of the ER documents the results of the architectural, historical, and cultural resources assessment for the entire Section 8B ROW that was completed in May 1995 to document the architectural, historical, and cultural resources located within the project area. The assessment included evaluation of the potential for cultural (i.e., rural historic) landscapes in the area of the ROW. The assessment showed that one National Register-listed property is located 0.3 mile south of the ROW

  4. Foothills Parkway Section 8B Final Environmental Report, Volume 3, Appendix D

    Energy Technology Data Exchange (ETDEWEB)

    Blasing, T.J.; Cada, G.F.; Carer, M.; Chin, S.M.; Dickerman, J.A.; Etnier, D.A.; Gibson, R.; Harvey, M.; Hatcher, B.; Lietzske, D.; Mann, L.K.; Mulholland, P.J.; Petrich, C.H.; Pounds, L.; Ranney, J.; Reed, R.M.; Ryan, P.F.; Schweitzer, M.; Smith, D.; Thomason, P.; Wade, M.C.

    1999-07-01

    In 1994, Oak Ridge National Laboratory (ORNL) was tasked by the National Park Service (NPS) to prepare an Environmental Report (ER) for Section 8B of the Foothills Parkway in the Great Smoky Mountains National Park (GSMNP). Section 8B represents 27.7 km (14.2 miles) of a total of 115 km (72 miles) of the planned Foothills Parkway and would connect the Cosby community on the east to the incorporated town of Pittman Center to the west. The major deliverables for the project are listed. From August 1995 through October 1996, NPS, GSMNP, and ORNL staff interacted with Federal Highway Administration staff to develop a conceptual design plan for Section 8B with the intent of protecting critical resources identified during the ER process to the extent possible. In addition, ORNL arranged for bioengineering experts to discuss techniques that might be employed on Section 8B with NPS, GSMNP, and ORNL staff during September 1996. For the purposes of this ER, there are two basic alternatives under consideration: (1) a build alternative and (2) a no-build alternative. Within the build alternative are a number of options including constructing Section 8B with no interchanges, constructing Section 8B with an interchange at SR416 or U.S. 321, constructing Section 8B with a spur road on Webb Mountain, and considering operation of Section 8B both before and after the operation of Section 8C. The no-build alternative is considered the no-action alternative and is not to construct Section 8B. This volume of the ER inventories the fishes and benthic macroinvertebrates inhabiting the aquatic ecosystems potentially affected by the proposed construction of Section 8B. Stream biological surveys were completed at 31 stream sites during the Fall of 1994. The sampling strategy for both invertebrates and fish was to survey the different taxa from all available habitats. For benthic invertebrates, a standardized qualitative manual collection technique was employed for all 31 stations. For fish

  5. Foothills Parkway Section 8B Final Environmental Report, Volume 4, Appendices E-I

    Energy Technology Data Exchange (ETDEWEB)

    Blasing, T.J.; Cada, G.F.; Carer, M.; Chin, S.M.; Dickerman, J.A.; Etnier, D.A.; Gibson, R.; Harvey, M.; Hatcher, B.; Lietzske, D.; Mann, L.K.; Mulholland, P.J.; Petrich, C.H.; Pounds, L.; Ranney, J.; Reed, R.M.; Ryan, P.F.; Schweitzer, M.; Smith, D.; Thomason, P.; Wade, M.C.

    1999-07-01

    In 1994, Oak Ridge National Laboratory (ORNL) was tasked by the National Park Service (NPS) to prepare an Environmental Report (ER) for Section 8B of the Foothills Parkway in the Great Smoky Mountains National Park (GSMNP). Section 8B represents 27.7 km (14.2 miles) of a total of 115 km (72 miles) of the planned Foothills Parkway and would connect the Cosby community on the east to the incorporated town of Pittman Center to the west. The major deliverables for the project are listed. From August 1995 through October 1996, NPS, GSMNP, and ORNL staff interacted with Federal Highway Administration staff to develop a conceptual design plan for Section 8B with the intent of protecting critical, resources identified during the ER process to the extent possible. In addition, ORNL arranged for bioengineering experts to discuss techniques that might be employed on Section 8B with NPS, GSMNP, and ORNL staff during September 1996. For the purposes of this ER, there are two basic alternatives under consideration: (1) a build alternative and (2) a no-build alternative. Within the build alternative are a number of options including constructing Section 8B with no interchanges, constructing Section 8B with an interchange at SR 416 or U.S. 321, constructing Section 8B with a spur road on Webb Mountain, and considering operation of Section 8B both before and after the operation of Section 8C. The no-build alternative is considered the no-action alternative and is not to construct Section 8B. This volume of the ER consists of Appendices E through I (all ecological survey reports), which are summarized individually in the sections that follow. The following conclusions result from the completion of these surveys and the ER impact analysis: (1) Forest clearing should be limited as much as possible; (2) Disturbed areas should be replanted with native trees; (3) Drainages should be bridged rather than leveled with cut and fill; (4) For areas of steep slopes and potential erosion

  6. A comment on the 7Be(p,γ)8B cross section and the solar neutrino problem

    International Nuclear Information System (INIS)

    Barker, F.C.; Spear, R.H.

    1986-02-01

    Evidence is presented which indicates that the accepted value for the cross section of the 7 Be(p,γ) 8 B reaction at stellar energies is probably too large. It is suggested that the accepted value of the 7 Li(d,p) 8 Li cross section, which has been used for normalization purposes, is too large; that the accepted value for the ratio of the 7 Be(p,γ) 8 B and 7 Li(d,p) 8 Li cross sections is too large; and that the energy dependence used to extrapolate to stellar energies from the higher energies at which measurements have been made is inaccurate. The consequent reduction of the 7 Be(p,γ) 8 B cross section by about 30% would not be sufficient to resolve the solar neutrino problem but would significantly lessen the discrepancy between observation and calculation

  7. Measurement of the $^{7}$Be$(p,\\gamma)^{8}$B Cross-Section with an Implanted Target

    CERN Document Server

    2002-01-01

    % IS366\\\\ \\\\ The $^7$Be(p,$\\gamma)^8$B capture reaction is of major importance to the physics of the sun and the issues of the ``solar neutrino puzzle'' and neutrino masses. We report here on a new determination of the absolute cross section of this reaction, using a novel method which overcomes some of the major experimental uncertainties of previous measurements. We utilize an implanted $^7$Be target and a uniformly scanned particle beam larger than the target spot, eliminating issues of target homogeneity and backscattering loss of $^8$B reaction products. The target was produced using a beam of 1.8 10$^{10}$/s $^7$Be nuclei extracted at ISOLDE(CERN) from a graphite target bombarded by 1 GeV protons in a two-step resonant laser ionization source. The $^7$Be nuclei were directly implanted into a copper substrate to obtain a target of 2 mm diameter with a total of 3.10$^{15}$ atoms. The measurement of the $^8$B production cross section was carried out at the Van de Graaff laboratory of the Weizmann Institute...

  8. Precision measurement of the $^{7}$Be(p, $\\gamma$)$\\,^{8}$B cross section with an implanted $^{7}$Be target

    CERN Document Server

    Baby, L.T.; Goldring, G.; Hass, M.; Weissman, L.; Fedoseyev, V.N.; Koester, U.; Nir-El, Y.; Haquin, G.; Gaggeler, H.W.; Weinreich, R.

    2003-01-01

    The $^{7}$Be(p, $\\gamma$) $\\,^{8}$B reaction plays a central role in the evaluation of solar neutrino fluxes. We report on a new precision measurement of the cross section of this reaction, following our previous experiment with an implanted $^{7}$Be target, a raster- scanned beam, and the elimination of the backscattering loss. The new measurement incorporates a more abundant $^{7}$Be target and a number of improvements in design and procedure. The point at E$_{lab}$ = 991 keV was measured several times under varying experimental conditions, yielding a value of S$_{17}$(E$_{c.m.}$ = 850 keV) = 24.0 $\\pm$ 0.5 eV b. Measurements were carried out at lower energies as well. Because of the precise knowledge of the implanted $^{7}$Be density profile, it was possible to reconstitute both the off- and on-resonance parts of the cross section and to obtain from the entire set of measurements an extrapolated value of S$_{17}$(0)=21.2 $\\pm$ 0.7 eV b.

  9. Measurement of the efficient cross section of the reaction 7Be(p, γ)8B at low energies and implications in the problem of solar neutrinos

    International Nuclear Information System (INIS)

    Hammache, Fairouz

    1999-01-01

    The 8 B produced inside the sun through the reaction 7 Be(p,γ) 8 B is the main, and even unique, source of high energy neutrinos detected in most solar neutrino detection experiments, except with Gallex and Sage. These experiments have all measured a neutrinos flux lower than the one predicted by solar models. Several explanations have been proposed to explain this deficit, but all require a precise knowledge of the efficient cross-section of the reaction 7 Be(p,γ) 8 B, because the neutrinos flux of 8 B is directly proportional to this reaction. The direct measurement of this cross section for the solar energy is impossible because of its low value (about 1 femto-barn). In order to get round this problem, the cross sections are measured at higher energy and extrapolated to the solar energy using a theoretical energy dependence. The 6 previous experimental determinations of the efficient cross section were shared in two distinct groups with differences of about 30% which leads to an uncertainty of the same order on the high energy neutrinos flux. The re-measurement of the cross section of this reaction with a better precision is thus of prime importance. A direct measurement of the cross section in the energy range comprised between 0.35 and 1.4 MeV (cm) has been performed first. These experiments have permitted the precise measurement of each parameter involved in the determination of the cross section. Then, measurements of the cross section have been carried out with the PAPAP accelerator at 185.8, 134.7 and 111.7 keV, the lowest mass center energy never reached before. The results are in excellent agreement with those obtained at higher energies. The value obtained by extrapolation of these data for the astrophysical factor S 17 (0) is 19.21.3 EV-B, which leads to a significant reduction of the uncertainty on the high energy neutrinos flux of 8 B. (J.S.)

  10. Measurement of the efficient cross section of the reaction {sup 7}Be(p, {gamma}){sup 8}B at low energies and implications in the problem of solar neutrinos; Mesures de la section efficace de la reaction {sup 7}Be(p,{gamma}){sup 8}B a basses energies et implications dans le probleme des neutrinos solaires

    Energy Technology Data Exchange (ETDEWEB)

    Hammache, Fairouz

    1999-07-01

    The {sup 8}B produced inside the sun through the reaction {sup 7}Be(p,{gamma}){sup 8}B is the main, and even unique, source of high energy neutrinos detected in most solar neutrino detection experiments, except with Gallex and Sage. These experiments have all measured a neutrinos flux lower than the one predicted by solar models. Several explanations have been proposed to explain this deficit, but all require a precise knowledge of the efficient cross-section of the reaction {sup 7}Be(p,{gamma}){sup 8}B, because the neutrinos flux of {sup 8}B is directly proportional to this reaction. The direct measurement of this cross section for the solar energy is impossible because of its low value (about 1 femto-barn). In order to get round this problem, the cross sections are measured at higher energy and extrapolated to the solar energy using a theoretical energy dependence. The 6 previous experimental determinations of the efficient cross section were shared in two distinct groups with differences of about 30% which leads to an uncertainty of the same order on the high energy neutrinos flux. The re-measurement of the cross section of this reaction with a better precision is thus of prime importance. A direct measurement of the cross section in the energy range comprised between 0.35 and 1.4 MeV (cm) has been performed first. These experiments have permitted the precise measurement of each parameter involved in the determination of the cross section. Then, measurements of the cross section have been carried out with the PAPAP accelerator at 185.8, 134.7 and 111.7 keV, the lowest mass center energy never reached before. The results are in excellent agreement with those obtained at higher energies. The value obtained by extrapolation of these data for the astrophysical factor S{sub 17}(0) is 19.21.3 EV-B, which leads to a significant reduction of the uncertainty on the high energy neutrinos flux of {sup 8}B. (J.S.)

  11. 15 CFR 8b.4 - Discrimination prohibited.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Discrimination prohibited. 8b.4 Section 8b.4 Commerce and Foreign Trade Office of the Secretary of Commerce PROHIBITION OF DISCRIMINATION... Provisions § 8b.4 Discrimination prohibited. (a) General. No qualified handicapped individual shall, on the...

  12. 15 CFR 8b.11 - Discrimination prohibited.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Discrimination prohibited. 8b.11 Section 8b.11 Commerce and Foreign Trade Office of the Secretary of Commerce PROHIBITION OF DISCRIMINATION... Practices § 8b.11 Discrimination prohibited. (a) General. (1) No qualified handicapped individual shall, on...

  13. 15 CFR 8b.16 - Discrimination prohibited.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Discrimination prohibited. 8b.16 Section 8b.16 Commerce and Foreign Trade Office of the Secretary of Commerce PROHIBITION OF DISCRIMINATION... Accessibility § 8b.16 Discrimination prohibited. No qualified handicapped individual shall, because a recipient...

  14. 15 CFR 8b.1 - Purpose.

    Science.gov (United States)

    2010-01-01

    ... of handicap in any program or activity receiving Federal financial assistance. The purpose of this... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Purpose. 8b.1 Section 8b.1 Commerce... HANDICAPPED IN FEDERALLY ASSISTED PROGRAMS OPERATED BY THE DEPARTMENT OF COMMERCE General Provisions § 8b.1...

  15. Formation and decay cross sections of {sup 66}As{sup ⁎} formed in an exotic proton-halo {sup 8}B induced reaction

    Energy Technology Data Exchange (ETDEWEB)

    Kaur, Gurvinder; Jain, Deepika; Kumar, Raj; Sharma, Manoj K., E-mail: msharma@thapar.edu

    2013-10-23

    In reference to experimental data on the fusion of a proton-halo {sup 8}B projectile with a {sup 58}Ni target, a systematic decay study of {sup 66}As{sup ⁎} is carried out in the framework of the dynamical cluster-decay model (DCM). The calculations suggest that the fusion excitation function of {sup 66}As{sup ⁎} consists of light particles (LPs) as the most dominant contributors, followed by intermediate mass fragments (IMFs) and fission fragments. A description of deformation effects is also provided by considering spherical and deformed choice of fragmentation up to quadrupole (β{sub 2i}) and hexadecapole (β{sub 2i}–β{sub 4i}) deformation. The DCM-based excitation functions agree well with the observed experimental cross sections for all three choices of fragmentation. The ℓ-summed Wong model is also employed to analyze the fusion cross section, which seems to work well, except for the minimum energy that lies below the barrier. Evidently, at below-barrier energy, the Wong model requires further barrier modification, which in the DCM, is accounted by its inbuilt property of barrier modification. Predictions of cross sections at higher extrapolated energies have also been done using both the DCM and ℓ-summed Wong model.

  16. Rock slope stability analysis along the North Carolina section of the Blue Ridge Parkway: Using a geographic information system (GIS) to integrate site data and digital geologic maps

    Science.gov (United States)

    Latham, R.S.; Wooten, R.M.; Cattanach, B.L.; Merschat, C.E.; Bozdog, G.N.

    2009-01-01

    In 2008, the North Carolina Geological Survey (NCGS) completed a five-year geologic and geohazards inventory of the 406-km long North Carolina segment of the Blue Ridge Parkway (BRP). The ArcGIS??? format deliverables for rock slopes include a slope movement and slope movement deposit database and maps and site-specific rock slope stability assessments at 158 locations. Database entries for known and potential rock slope failures include: location data, failure modes and dimensions, activity dates and levels, structural and lithologic data, the occurrence of sulfide minerals and acid-producing potential test results. Rock slope stability assessments include photographs of the rock cuts and show locations and orientations of rock data, seepage zones, and kinematic stability analyses. Assigned preliminary geologic hazard ratings of low, moderate and high indicate the generalized relative probability of rock fall and/or rock slide activity at a given location. Statistics compiled based on the database indicate some general patterns within the data. This information provides the National Park Service with tools that can aid in emergency preparedness, and in budgeting mitigation, maintenance and repair measures. Copyright 2009 ARMA, American Rock Mechanics Association.

  17. 15 CFR 8b.18 - New construction.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false New construction. 8b.18 Section 8b.18... construction. (a) Design and construction. Each facility or part of a facility constructed by, on behalf of, or... construction was commenced after the effective date of this part. (b) Alteration. Each facility or part of a...

  18. 17 CFR 270.8b-2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... such document is filed with such exchange. (j) Share. The term “share” means a share of stock in a... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definitions. 270.8b-2 Section 270.8b-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND...

  19. The Coulomb dissociation of 8B and the 8B solar neutrino flux

    International Nuclear Information System (INIS)

    Gai, M.

    1994-01-01

    The Coulomb Dissociation of 8 B was measured using 46.5 MeV/u 8 B radioactive beams from the RIKEN-RIPS Radioactive Beam Facility, in an attempt to measure the 7 Be(p,γ) 8 B reaction at low energy, of relevance to estimating the 8 B solar neutrino flux. The experimental setup is discussed and the results are consistent with the lower value of S 17 measured by Filippone et al and Vaughn et al

  20. 15 CFR 8b.22 - Academic adjustments.

    Science.gov (United States)

    2010-01-01

    ... actions. Recipients need not provide attendants, individually prescribed devices, readers for personal use... Secondary Education § 8b.22 Academic adjustments. (a) Academic requirements. A recipient to which this..., against a qualified handicapped applicant or student. Academic requirements that the recipient can...

  1. 76 FR 35909 - Temporary Concession Contract for Blue Ridge Parkway

    Science.gov (United States)

    2011-06-20

    ... accommodations, food and beverage, retail sales, boat rentals, and other services at Crabtree Falls, Price Lake... DEPARTMENT OF THE INTERIOR National Park Service [NPS-WASO-CONC-0511-7182; 2410-OYC] Temporary Concession Contract for Blue Ridge Parkway AGENCY: National Park Service, Interior. ACTION: Notice of...

  2. Nuclear effects in {sup 8}B dissociation

    Energy Technology Data Exchange (ETDEWEB)

    Kido, Toshihiko [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1998-07-01

    The break-up reaction of the nucleus on proton drip-line is investigated. A time-dependent Schroedinger equation for the relative motion between a weakly bound proton and core nucleus is numerically solved by treating the Coulomb+nuclear fields of a target as an external field. The theory is applied to the break-up reaction {sup 8}B + {sup 208}Pb {yields} {sup 7}Be + p + {sup 208}Pb. (author)

  3. The photodissociation of 8B and the solar neutrino problem

    International Nuclear Information System (INIS)

    Bertulani, C.A.

    1995-01-01

    The extraction of the photodissociation cross sections of 8 B from Coulomb dissociation experiments is investigated. A careful study is done on the contributions of the E1, E2 and M1 multipolarities to the breakup. A comparison with the data of a recent experiment is performed. It is shown that the extraction of the radiative capture cross sections 7 Be(p, γ) 8 B which are relevant for the solar neutrino problem is not affected appreciably by Coulomb reacceleration. A non-perturbative model is used for the purpose. Emphasis is put on the perspectives for future experiments which are planned at the University of Notre Dame, RIKEN (Japan), and GSI (Germany). An analysis of the total yields of ''photon-point'' processes in inelastic electron scattering is also done. (orig.)

  4. Contributions to the understanding of the 8B proton halo question

    International Nuclear Information System (INIS)

    Negoita, F.; Borcea, C.; Carstoiu, F.; Lewitowicz, M.; Saint-Laurent, M.G.; Anne, R.; Bazin, D.; Borrel, V.; Corre, J.M.; Roussel-Chomaz, P.; and others.

    1996-01-01

    The reaction cross section for 8 B and 7 Be and the break-up cross section for 8 B on silicon have been measured. Secondary 8 B and 7 Be beams were obtained by use of the LISE spectrometer at GANIL. The separate contributions of diffraction dissociation and absorption to the breakup have been determined for the first time. The parallel momentum distribution of 7 Be resulting from the break-up of 8 B has also been determined. The data are compared to theoretical calculations. (author)

  5. Contributions to the understanding of the {sup 8}B proton halo question

    Energy Technology Data Exchange (ETDEWEB)

    Negoita, F.; Borcea, C.; Carstoiu, F. [Institute of Atomic Physics, Bucharest (Romania); Lewitowicz, M.; Saint-Laurent, M.G.; Anne, R.; Bazin, D.; Borrel, V.; Corre, J.M.; Roussel-Chomaz, P. [Grand Accelerateur National d`Ions Lourds (GANIL), 14 - Caen (France); and others

    1996-12-31

    The reaction cross section for {sup 8}B and {sup 7}Be and the break-up cross section for {sup 8}B on silicon have been measured. Secondary {sup 8}B and {sup 7}Be beams were obtained by use of the LISE spectrometer at GANIL. The separate contributions of diffraction dissociation and absorption to the breakup have been determined for the first time. The parallel momentum distribution of {sup 7}Be resulting from the break-up of {sup 8}B has also been determined. The data are compared to theoretical calculations. (author). 27 refs. Submitted to Physical Review, C (US).

  6. 17 CFR 274.13 - Form N-8B-3, registration statement of unincorporated management investment companies currently...

    Science.gov (United States)

    2010-04-01

    ... statement of unincorporated management investment companies currently issuing periodic payment plan...-8B-3, registration statement of unincorporated management investment companies currently issuing..., pursuant to section 8(b) of the Investment Company Act of 1940, by unincorporated management investment...

  7. Geology along the Blue Ridge Parkway in Virginia

    Science.gov (United States)

    Carter, Mark W.; Southworth, C. Scott; Tollo, Richard P.; Merschat, Arthur J.; Wagner, Sara; Lazor, Ava; Aleinikoff, John N.

    2017-01-01

    Detailed geologic mapping and new SHRIMP (sensitive high-resolution ion microprobe) U-Pb zircon, Ar/Ar, Lu-Hf, 14C, luminescence (optically stimulated), thermochronology (fission-track), and palynology reveal the complex Mesoproterozoic to Quaternary geology along the ~350 km length of the Blue Ridge Parkway in Virginia. Traversing the boundary of the central and southern Appalachians, rocks along the parkway showcase the transition from the para-autochthonous Blue Ridge anticlinorium of northern and central Virginia to the allochthonous eastern Blue Ridge in southern Virginia. From mile post (MP) 0 near Waynesboro, Virginia, to ~MP 124 at Roanoke, the parkway crosses the unconformable to faulted boundary between Mesoproterozoic basement in the core of the Blue Ridge anticlinorium and Neoproterozoic to Cambrian metasedimentary and metavolcanic cover rocks on the western limb of the structure. Mesoproterozoic basement rocks comprise two groups based on SHRIMP U-Pb zircon geochronology: Group I rocks (1.2-1.14 Ga) are strongly foliated orthogneisses, and Group II rocks (1.08-1.00 Ga) are granitoids that mostly lack obvious Mesoproterozoic deformational features.Neoproterozoic to Cambrian cover rocks on the west limb of the anticlinorium include the Swift Run and Catoctin Formations, and constituent formations of the Chilhowee Group. These rocks unconformably overlie basement, or abut basement along steep reverse faults. Rocks of the Chilhowee Group are juxtaposed against Cambrian rocks of the Valley and Ridge province along southeast- and northwest-dipping, high-angle reverse faults. South of the James River (MP 64), Chilhowee Group and basement rocks occupy the hanging wall of the nearly flat-lying Blue Ridge thrust fault and associated splays.South of the Red Valley high-strain zone (MP 144.5), the parkway crosses into the wholly allochthonous eastern Blue Ridge, comprising metasedimentary and meta-igneous rocks assigned to the Wills Ridge, Ashe, and Alligator

  8. Near and sub-barrier reactions of 8B

    Directory of Open Access Journals (Sweden)

    Kolata J. J.

    2017-01-01

    Full Text Available Four classes of measurements that are important for achieving a complete understanding of the reactions of exotic nuclei are identified and classified according to their degree of difficulty. Previously reported data for near- and sub-barrier fusion of 8B+58Ni are critically reviewed. The influence of breakup protons on the evaporation proton measurements for this system is shown to be small at all energies except for the lowest one measured, and corrections are made for this process. Model dependencies in the deduced fusion cross sections are assessed using three different evaporation codes. Data sets for targets of 58Ni and 28Si are shown to be consistent with each other, and with fusion enhancement up to energies that are greater than the Coulomb barrier Vb (Ec.m. ≲ Vb + 1.5×ћω. An important difference with the behavior of neutron-halo systems is thereby confirmed. Possible fusion suppression beyond this energy is suggested by the 28Si data. A proposal to measure the 8B+40Ar fusion cross section using an active-target time projection chamber is discussed.

  9. 78 FR 32442 - Record of Decision for the General Management Plan, Blue Ridge Parkway, Virginia and North Carolina

    Science.gov (United States)

    2013-05-30

    ... constraints with the traditional parkway concept developed from 1935 to 1955. As a result, the selected action... economy, while enhancing parkway visitor services. The selected action will provide a comprehensive...

  10. 8B + 208Pb Elastic Scattering at Coulomb Barrier Energies

    Science.gov (United States)

    La Commara, M.; Mazzocco, M.; Boiano, A.; Boiano, C.; Manea, C.; Parascandolo, C.; Pierroutsakou, D.; Signorini, C.; Strano, E.; Torresi, D.; Yamaguchi, H.; Kahl, D.; Di Meo, P.; Grebosz, J.; Imai, N.; Hirayama, Y.; Ishiyama, H.; Iwasa, N.; Jeong, S. C.; Jia, H. M.; Kim, Y. H.; Kimura, S.; Kubono, S.; Lin, C. J.; Miyatake, H.; Mukai, M.; Nakao, T.; Nicoletto, M.; Sakaguchi, Y.; Sánchez-Benítez, A. M.; Soramel, F.; Teranishi, T.; Wakabayashi, Y.; Watanabe, Y. X.; Yang, L.; Yang, Y. Y.

    2018-02-01

    The scattering process of weakly-bound nuclei at Coulomb barrier energies provides deep insights on the reaction dynamics induced by exotic nuclei. Within this framework, we measured for the first time the scattering process of the short-lived Radioactive Ion Beam (RIB) 8B (Sp = 0.1375 MeV) from a 208Pb target at 50 MeV beam energy. The 8B RIB was produced by means of the in-flight facility CRIB (RIKEN, Japan) with an average intensity on target of 10 kHz and a purity about 25%. Elastically scattering ions were detected in the angular range θc.m. = 10°-160° by means of the detector array EXPADES. A preliminary optical model analysis indicates a total reaction cross section of about 1 b, a value, once reduced, 2-3 times larger than those obtained for the reactions induced by the stable weakly-bound projectiles 6,7Li on a 208Pb target in the energy range around the Coulomb barrier.

  11. Garden State Parkway Corridor : ITS early deployment planning study : strategic deployment plan

    Science.gov (United States)

    1997-12-01

    This Strategic Deployment Plan describes ways of improving travel within the Garden : State Parkway Corridor using intelligent transportation systems (ITS) and without : constructing additional roadway lanes. Travel improvements will be possible with...

  12. Seismic evaluation and ranking of embankments for bridges on and over the parkways in Western Kentucky.

    Science.gov (United States)

    2008-06-01

    This study represents one of the Seismic Evaluation of Bridges on and over the Parkways in Western Kentucky investigative series. The effort is focused on the seismic vulnerability of bridge embankments against slope instability and liquefaction pote...

  13. Coulomb dissociation of 8B at 254 MeV/u

    International Nuclear Information System (INIS)

    Surowka, G.; Iwasa, N.; Boue, F.

    1999-01-01

    As an alternative method to determine the cross section of 7 Be (p, γ) 8 B, the Coulomb dissociation reaction 8 B → 7 Be + p at E inc = 254 MeV/u was measured. Our preliminary results show the dominant role of the dipole excitation in the Coulomb break-up process. The extracted astrophysical S 17 factor is consistent with the lower-value results both of the direct-capture studies, and the RIKEN Coulomb-dissociation experiment at ∼ 50 MeV/u. (author)

  14. Excellent channels of evaporation in the fusion of 8 B with 58 Ni

    International Nuclear Information System (INIS)

    Martinez Q, E.; Aguilera, E.F.; Garcia M, H.; Lizcano, D.

    2004-01-01

    Inside the systematic studies of nuclear reactions with radioactive beams carried out by our group, using the installation TWINSOL of the University of Notre Dame, it was carried out an experiment where the fusion of the system 8 B + 58 Ni was measured to investigate the effects of the proton halo of the radioactive nuclei 8 B to the interactionate with a target of 58 Ni. The protons were detected taken place in the reaction and values were determined for the fusion cross section. (Author)

  15. 7Be(p, γ)8B and the high-energy solar neutrino flux

    International Nuclear Information System (INIS)

    Csoto, A.

    1997-01-01

    Despite thirty years of extensive experimental and theoretical work, the predicted solar neutrino flux is still in sharp disagreement with measurements. The solar neutrino measurements strongly suggest that the problem cannot be solved within the standard electroweak and astrophysical theories. Thus, the solar neutrino problem constitutes the strongest evidence for physics beyond the Standard Model. Whatever the solution of the solar neutrino problem turns out to be, it is of paramount importance that the input parameters of the underlying electroweak and solar theories rest upon solid ground. The most uncertain nuclear input parameter in standard solar models is the low-energy 7 Be(p, γ) 8 B radiative capture cross section. This reaction produces 8 B in the Sun, whose β + decay is the main source of the high-energy solar neutrinos. Here, the importance of the 7 Be(p, γ) 8 B reaction in predicting the high energy solar neutrino flux is discussed. The author presents a microscopic eight-body model and a potential model for the calculation of the 7 Be(p, γ) 8 B cross section

  16. Preliminary seismic evaluation and ranking of bridges on and over the parkways in Western Kentucky.

    Science.gov (United States)

    2008-06-01

    Five parkways in Western Kentucky are located in the region that is greatly influenced by the New Madrid and Wabash Valley Seismic Zones. This report executes a preliminary screening process, known also as the Seismic Rating System, for bridges on an...

  17. Halo structure of 8B determined from intermediate energy proton elastic scattering in inverse kinematics

    Science.gov (United States)

    Korolev, G. A.; Dobrovolsky, A. V.; Inglessi, A. G.; Alkhazov, G. D.; Egelhof, P.; Estradé, A.; Dillmann, I.; Farinon, F.; Geissel, H.; Ilieva, S.; Ke, Y.; Khanzadeev, A. V.; Kiselev, O. A.; Kurcewicz, J.; Le, X. C.; Litvinov, Yu. A.; Petrov, G. E.; Prochazka, A.; Scheidenberger, C.; Sergeev, L. O.; Simon, H.; Takechi, M.; Tang, S.; Volkov, V.; Vorobyov, A. A.; Weick, H.; Yatsoura, V. I.

    2018-05-01

    The absolute differential cross section for small-angle proton elastic scattering on the proton-rich 8B nucleus has been measured in inverse kinematics for the first time. The experiment was performed using a secondary radioactive beam with an energy of 0.7 GeV/u at GSI, Darmstadt. The active target, namely hydrogen-filled time projection ionization chamber IKAR, was used to measure the energy, angle and vertex point of the recoil protons. The scattering angle of the projectiles was simultaneously determined by the tracking detectors. The measured differential cross section is analyzed on the basis of the Glauber multiple scattering theory using phenomenological nuclear-density distributions with two free parameters. The radial density distribution deduced for 8B exhibits a halo structure with the root-mean-square (rms) matter radius Rm = 2.58 (6) fm and the rms halo radius Rh = 4.24 (25) fm. The results on 8B are compared to those on the mirror nucleus 8Li investigated earlier by the same method. A comparison is also made with previous experimental results and theoretical predictions for both nuclei.

  18. Probing the exotic structure of {sup 8}B by its elastic scattering and breakup reaction on nuclear targets

    Energy Technology Data Exchange (ETDEWEB)

    Lukyanov, V.K.; Zemlyanaya, E.V.; Lukyanov, K.V. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Kadrev, D.N.; Antonov, A.N.; Gaidarov, M.K. [Bulgarian Academy of Sciences, Institute for Nuclear Research and Nuclear Energy, Sofia (Bulgaria); Spasova, K. [Bulgarian Academy of Sciences, Institute for Nuclear Research and Nuclear Energy, Sofia (Bulgaria); University ' ' Ep. K. Preslavski' ' , Shumen (Bulgaria)

    2017-02-15

    The structure of the exotic {sup 8}B nucleus is studied by means of elastic scattering, as well as its breakup on nuclear targets. We present microscopic calculations of the optical potentials (OPs) and cross sections of elastic scattering of {sup 8}B on {sup 12}C, {sup 58}Ni, and {sup 208}Pb targets at energies 20 < E < 170 MeV. The density distributions of {sup 8}B obtained within the variational Monte Carlo (VMC) model and the three-cluster model (3CM) are used to construct the potentials. The real part of the hybrid OP is calculated using the folding model with the direct and exchange terms included, while the imaginary part is obtained on the base of the high-energy approximation (HEA) and also taken to be equal to the microscopic real part of the OP. In this model the only free parameters are the depths of the real and imaginary parts of OP obtained by fitting the elastic scattering experimental data. A dependence of their values on the model density of {sup 8} B is found. In addition, the cluster model, in which {sup 8}B consists of a p-halo and the {sup 7} Be core, is applied to calculate the breakup cross sections of the {sup 8}B nucleus on {sup 9}Be, {sup 12}C, and {sup 197}Au targets, as well as momentum distributions of {sup 7}Be fragments, and a comparison with the existing experimental data is made. (orig.)

  19. Effects of breakup couplings on 8B + 58 Ni elastic scattering

    International Nuclear Information System (INIS)

    Lubian, J.; Correa, T.; Gomes, P.R.S.; Canto, L.F.; Aguilera, E.F.; Gomez-Camacho, A.; Quiroz, E.M.

    2009-01-01

    Full text: Nuclear reactions involving weakly bound nuclei have been extensively investigated over the last years. Because of the low breakup threshold, collisions of weakly bound systems have large breakup cross sections. Nuclear reactions induced by 8 B projectiles have attracted particular interest, because the Coulomb dissociation of this nucleus leads to important information for understanding solar neutrino emission. Because the breakup process involves unbound states of the projectile's fragments is necessary to approximate the continuum by a finite number of channels. This is achieved by continuum discretized coupled channel (CDCC) method. Recently, new data have become available for the 8 B + 58 Ni system. Aguilera et al measured elastic angular distributions at several collisions energies, in the barrier region. In the present work, we perform a theoretical study of the effect of the breakup channel on the elastic angular distributions for the 8 B + 58 Ni system, using the CDCC method. The result of our calculations were in excellent agreement with the experimental results. We have also investigated the effects of inelastic excitations and of continuum-continuum couplings on the angular distributions. We found that inelastic excitations do not have an appreciable influence while continuum- continuum couplings are of utmost importance. We have shown that the multipole expansion of the coupling interaction is dominated by monopole, dipole, and quadrupole terms. Higher multipoles can be neglected. (author)

  20. Excellent channels of evaporation in the fusion of {sup 8} B with {sup 58} Ni; Canales relevantes de evaporacion en la fusion de {sup 8} B con {sup 58} Ni

    Energy Technology Data Exchange (ETDEWEB)

    Martinez Q, E.; Aguilera, E.F.; Garcia M, H.; Lizcano, D. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    2004-07-01

    Inside the systematic studies of nuclear reactions with radioactive beams carried out by our group, using the installation TWINSOL of the University of Notre Dame, it was carried out an experiment where the fusion of the system {sup 8} B + {sup 58} Ni was measured to investigate the effects of the proton halo of the radioactive nuclei {sup 8} B to the interactionate with a target of {sup 58} Ni. The protons were detected taken place in the reaction and values were determined for the fusion cross section. (Author)

  1. Mutations in COQ8B (ADCK4) found in patients with steroid-resistant nephrotic syndrome alter COQ8B function

    OpenAIRE

    Fonseca, Luis Vazquez; Doimo, Mara; Calderan, Cristina; Desbats, Maria Andrea; Acosta, Manuel J.; Cerqua, Cristina; Cassina, Matteo; Ashraf, Shazia; Hildebrandt, Friedhelm; Sartori, Geppo; Navas, Placido; Trevisson, Eva; Salviati, Leonardo

    2018-01-01

    Abstract Mutations in COQ8B cause steroid‐resistant nephrotic syndrome with variable neurological involvement. In yeast, COQ8 encodes a protein required for coenzyme Q (CoQ) biosynthesis, whose precise role is not clear. Humans harbor two paralog genes: COQ8A and COQ8B (previously termed ADCK3 and ADCK4). We have found that COQ8B is a mitochondrial matrix protein peripherally associated with the inner membrane. COQ8B can complement a ΔCOQ8 yeast strain when its mitochondrial targeting sequenc...

  2. Diffraction scattering of 7Be and 8B on 12C taking into account the coulomb interaction

    International Nuclear Information System (INIS)

    Davydovskyy, V.V.; Evlanov, M.V.; Tartakovsky, V.K.

    2004-01-01

    The differential cross sections for scattering of 7 Be and 8 B nuclei on 12 C nuclei are calculated in the framework of general theory of diffraction interactions of nuclei consisting of two charged weakly-bound clusters. Available experimental data are analyzed. (author)

  3. Radiative capture reaction {sup 7}Be(p,{gamma}){sup 8}B in the continuum shell model

    Energy Technology Data Exchange (ETDEWEB)

    Bennaceur, K; Ploszajczak, M [Grand Accelerateur National d` Ions Lourds (GANIL), Caen (France); Nowacki, F [Grand Accelerateur National d` Ions Lourds (GANIL), Caen (France); [Lab. de Physique Theorique Strasbourg, Strasbourg (France); Okolowicz, J [Grand Accelerateur National d` Ions Lourds (GANIL), Caen (France); [Inst. of Nuclear Physics, Krakow (Poland)

    1998-06-01

    We present here the first application of realistic shell model (SM) including coupling between many-particle (quasi-)bound states and the continuum of one-particle scattering states to the calculation of the total capture cross section and the astrophysical factor in the reaction {sup 7}Be(p,{gamma}){sup 8}B. (orig.)

  4. Mutations in COQ8B (ADCK4) found in patients with steroid‐resistant nephrotic syndrome alter COQ8B function

    Science.gov (United States)

    Vazquez Fonseca, Luis; Doimo, Mara; Calderan, Cristina; Desbats, Maria Andrea; Acosta, Manuel J.; Cerqua, Cristina; Cassina, Matteo; Ashraf, Shazia; Hildebrandt, Friedhelm; Sartori, Geppo; Navas, Placido; Trevisson, Eva

    2017-01-01

    Abstract Mutations in COQ8B cause steroid‐resistant nephrotic syndrome with variable neurological involvement. In yeast, COQ8 encodes a protein required for coenzyme Q (CoQ) biosynthesis, whose precise role is not clear. Humans harbor two paralog genes: COQ8A and COQ8B (previously termed ADCK3 and ADCK4). We have found that COQ8B is a mitochondrial matrix protein peripherally associated with the inner membrane. COQ8B can complement a ΔCOQ8 yeast strain when its mitochondrial targeting sequence (MTS) is replaced by a yeast MTS. This model was employed to validate COQ8B mutations, and to establish genotype–phenotype correlations. All mutations affected respiratory growth, but there was no correlation between mutation type and the severity of the phenotype. In fact, contrary to the case of COQ2, where residual CoQ biosynthesis correlates with clinical severity, patients harboring hypomorphic COQ8B alleles did not display a different phenotype compared with those with null mutations. These data also suggest that the system is redundant, and that other proteins (probably COQ8A) may partially compensate for the absence of COQ8B. Finally, a COQ8B polymorphism, present in 50% of the European population (NM_024876.3:c.521A > G, p.His174Arg), affects stability of the protein and could represent a risk factor for secondary CoQ deficiencies or for other complex traits. PMID:29194833

  5. Data of evolutionary structure change: 1CG8B-2QU0A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 0 A 2QU0A ence>DLHAHKLRVDP...0 A 2QU0A ence>YFPHF--DLSHG...1CG8B-2QU0A 1CG8 2QU0 B A VKLSEDQEHYIKGVWKDV--DHKQITAKALERVFVVYPW...> 1CG8 B 1CG8B ence>VWKDV--DHKQI...ine> ILE CA 383 2QU0 A 2QU

  6. Fast growth associated with aberrant vasculature and hypoxia in fibroblast growth factor 8b (FGF8b) over-expressing PC-3 prostate tumour xenografts

    International Nuclear Information System (INIS)

    Tuomela, Johanna; Solin, Olof; Minn, Heikki; Härkönen, Pirkko L; Grönroos, Tove J; Valta, Maija P; Sandholm, Jouko; Schrey, Aleksi; Seppänen, Jani; Marjamäki, Päivi; Forsback, Sarita; Kinnunen, Ilpo

    2010-01-01

    Prostate tumours are commonly poorly oxygenated which is associated with tumour progression and development of resistance to chemotherapeutic drugs and radiotherapy. Fibroblast growth factor 8b (FGF8b) is a mitogenic and angiogenic factor, which is expressed at an increased level in human prostate tumours and is associated with a poor prognosis. We studied the effect of FGF8b on tumour oxygenation and growth parameters in xenografts in comparison with vascular endothelial growth factor (VEGF)-expressing xenografts, representing another fast growing and angiogenic tumour model. Subcutaneous tumours of PC-3 cells transfected with FGF8b, VEGF or empty (mock) vectors were produced and studied for vascularity, cell proliferation, glucose metabolism and oxygenation. Tumours were evaluated by immunohistochemistry (IHC), flow cytometry, use of radiolabelled markers of energy metabolism ([ 18 F]FDG) and hypoxia ([ 18 F]EF5), and intratumoral polarographic measurements of pO 2 . Both FGF8b and VEGF tumours grew rapidly in nude mice and showed highly vascularised morphology. Perfusion studies, pO 2 measurements, [ 18 F]EF5 and [ 18 F]FDG uptake as well as IHC staining for glucose transport protein (GLUT1) and hypoxia inducible factor (HIF) 1 showed that VEGF xenografts were well-perfused and oxygenised, as expected, whereas FGF8b tumours were as hypoxic as mock tumours. These results suggest that FGF8b-induced tumour capillaries are defective. Nevertheless, the growth rate of hypoxic FGF8b tumours was highly increased, as that of well-oxygenised VEGF tumours, when compared with hypoxic mock tumour controls. FGF8b is able to induce fast growth in strongly hypoxic tumour microenvironment whereas VEGF-stimulated growth advantage is associated with improved perfusion and oxygenation of prostate tumour xenografts

  7. Mutations in COQ8B (ADCK4) found in patients with steroid-resistant nephrotic syndrome alter COQ8B function.

    Science.gov (United States)

    Vazquez Fonseca, Luis; Doimo, Mara; Calderan, Cristina; Desbats, Maria Andrea; Acosta, Manuel J; Cerqua, Cristina; Cassina, Matteo; Ashraf, Shazia; Hildebrandt, Friedhelm; Sartori, Geppo; Navas, Placido; Trevisson, Eva; Salviati, Leonardo

    2018-03-01

    Mutations in COQ8B cause steroid-resistant nephrotic syndrome with variable neurological involvement. In yeast, COQ8 encodes a protein required for coenzyme Q (CoQ) biosynthesis, whose precise role is not clear. Humans harbor two paralog genes: COQ8A and COQ8B (previously termed ADCK3 and ADCK4). We have found that COQ8B is a mitochondrial matrix protein peripherally associated with the inner membrane. COQ8B can complement a ΔCOQ8 yeast strain when its mitochondrial targeting sequence (MTS) is replaced by a yeast MTS. This model was employed to validate COQ8B mutations, and to establish genotype-phenotype correlations. All mutations affected respiratory growth, but there was no correlation between mutation type and the severity of the phenotype. In fact, contrary to the case of COQ2, where residual CoQ biosynthesis correlates with clinical severity, patients harboring hypomorphic COQ8B alleles did not display a different phenotype compared with those with null mutations. These data also suggest that the system is redundant, and that other proteins (probably COQ8A) may partially compensate for the absence of COQ8B. Finally, a COQ8B polymorphism, present in 50% of the European population (NM_024876.3:c.521A > G, p.His174Arg), affects stability of the protein and could represent a risk factor for secondary CoQ deficiencies or for other complex traits. © 2017 The Authors. Human Mutation published by Wiley Periodicals, Inc.

  8. Modulation of thalamocortical oscillations by TRIP8b, an auxiliary subunit for HCN channels

    NARCIS (Netherlands)

    Zobeiri, M.; Chaudhary, R.; Datunashvili, M.; Heuermann, R.J.; Lüttjohann, A.; Narayanan, V.; Balfanz, S.; Meuth, P.; Chetkovich, D.M.; Pape, H.C.; Baumann, A.; Luijtelaar, E.L.J.M. van; Budde, T.

    2018-01-01

    Hyperpolarization-activated cyclic nucleotide-gated cation (HCN) channels have important functions in controlling neuronal excitability and generating rhythmic oscillatory activity. The role of tetratricopeptide repeat-containing Rab8b-interacting protein (TRIP8b) in regulation of

  9. Intestinal bile salt absorption in Atp8b1 deficient mice

    NARCIS (Netherlands)

    Groen, Annemiek; Kunne, Cindy; Paulusma, Coen C.; Kramer, Werner; Agellon, Luis B.; Bull, Laura N.; Elferink, Ronald P. J. Oude

    2007-01-01

    BACKGROUND/AIMS: Mutations in the ATP8B1 gene can cause Progressive Familial Intrahepatic Cholestasis type 1. We have previously reported that Atp8b1(G308V/G308V) mice, a model for PFIC1, have slightly, but significantly, higher baseline serum bile salt (BS) concentrations compared to wt mice. Upon

  10. The Rab7 effector PLEKHM1 binds Arl8b to promote cargo traffic to lysosomes.

    Science.gov (United States)

    Marwaha, Rituraj; Arya, Subhash B; Jagga, Divya; Kaur, Harmeet; Tuli, Amit; Sharma, Mahak

    2017-04-03

    Endocytic, autophagic, and phagocytic vesicles move on microtubule tracks to fuse with lysosomes. Small GTPases, such as Rab7 and Arl8b, recruit their downstream effectors to mediate this transport and fusion. However, the potential cross talk between these two GTPases is unclear. Here, we show that the Rab7 effector PLEKHM1 simultaneously binds Rab7 and Arl8b, bringing about clustering and fusion of late endosomes and lysosomes. We show that the N-terminal RUN domain of PLEKHM1 is necessary and sufficient for interaction with Arl8b and its subsequent localization to lysosomes. Notably, we also demonstrate that Arl8b mediates recruitment of HOPS complex to PLEKHM1-positive vesicle contact sites. Consequently, Arl8b binding to PLEKHM1 is required for its function in delivery and, therefore, degradation of endocytic and autophagic cargo in lysosomes. Finally, we also show that PLEKHM1 competes with SKIP for Arl8b binding, which dictates lysosome positioning. These findings suggest that Arl8b, along with its effectors, orchestrates lysosomal transport and fusion. © 2017 Marwaha et al.

  11. The small GTPase Arl8b regulates assembly of the mammalian HOPS complex on lysosomes

    Science.gov (United States)

    Khatter, Divya; Raina, Vivek B.; Dwivedi, Devashish; Sindhwani, Aastha; Bahl, Surbhi; Sharma, Mahak

    2015-01-01

    The homotypic fusion and protein sorting (HOPS) complex is a multi-subunit complex conserved from yeast to mammals that regulates late endosome and lysosome fusion. However, little is known about how the HOPS complex is recruited to lysosomes in mammalian cells. Here, we report that the small GTPase Arl8b, but not Rab7 (also known as RAB7A), is essential for membrane localization of the human (h)Vps41 subunit of the HOPS complex. Assembly of the core HOPS subunits to Arl8b- and hVps41-positive lysosomes is guided by their subunit–subunit interactions. RNA interference (RNAi)-mediated depletion of hVps41 resulted in the impaired degradation of EGFR that was rescued upon expression of wild-type but not an Arl8b-binding-defective mutant of hVps41, suggesting that Arl8b-dependent lysosomal localization of hVps41 is required for its endocytic function. Furthermore, we have also identified that the Arl8b effector SKIP (also known as PLEKHM2) interacts with and recruits HOPS subunits to Arl8b and kinesin-positive peripheral lysosomes. Accordingly, RNAi-mediated depletion of SKIP impaired lysosomal trafficking and degradation of EGFR. These findings reveal that Arl8b regulates the association of the human HOPS complex with lysosomal membranes, which is crucial for the function of this tethering complex in endocytic degradation. PMID:25908847

  12. The small GTPase Arl8b regulates assembly of the mammalian HOPS complex on lysosomes.

    Science.gov (United States)

    Khatter, Divya; Raina, Vivek B; Dwivedi, Devashish; Sindhwani, Aastha; Bahl, Surbhi; Sharma, Mahak

    2015-05-01

    The homotypic fusion and protein sorting (HOPS) complex is a multi-subunit complex conserved from yeast to mammals that regulates late endosome and lysosome fusion. However, little is known about how the HOPS complex is recruited to lysosomes in mammalian cells. Here, we report that the small GTPase Arl8b, but not Rab7 (also known as RAB7A), is essential for membrane localization of the human (h)Vps41 subunit of the HOPS complex. Assembly of the core HOPS subunits to Arl8b- and hVps41-positive lysosomes is guided by their subunit-subunit interactions. RNA interference (RNAi)-mediated depletion of hVps41 resulted in the impaired degradation of EGFR that was rescued upon expression of wild-type but not an Arl8b-binding-defective mutant of hVps41, suggesting that Arl8b-dependent lysosomal localization of hVps41 is required for its endocytic function. Furthermore, we have also identified that the Arl8b effector SKIP (also known as PLEKHM2) interacts with and recruits HOPS subunits to Arl8b and kinesin-positive peripheral lysosomes. Accordingly, RNAi-mediated depletion of SKIP impaired lysosomal trafficking and degradation of EGFR. These findings reveal that Arl8b regulates the association of the human HOPS complex with lysosomal membranes, which is crucial for the function of this tethering complex in endocytic degradation. © 2015. Published by The Company of Biologists Ltd.

  13. Data of evolutionary structure change: 1CG8B-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG8B-2ZLWD 1CG8 2ZLW B D VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTT.../seq1> VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDK... GLY CA 249 2ZLW D 2ZLWD...2ZLW D 2ZLWD ELHCDKLHVDP

  14. Data of evolutionary structure change: 1VL8B-2UVDE [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1VL8B-2UVDE 1VL8 2UVD B E VFDLRGRVALVTGGSRGLGFGIAQGLAEAGCSVVVASRN...seq1> --MLKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGNEQKANEVVDEIKKL-GSDAIAVRADVANA...D E 2UVDE VNYAGNEQKAN E 2UVDE EIKKL-GSDAI 2 2UVD E 2UVDE

  15. Data of evolutionary structure change: 1EP8B-1FAAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1EP8B-1FAAA 1EP8 1FAA B A -------------GGSVIVIDSKAAWDAQLAKGKEEHKP...IVVAFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVD-AVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAAA LELALGT.../pdbChain> 1FAAA KLDCNQENKTL EEE HHH 1 1FAA A 1FAAA

  16. Determination of S17 from the 7Be(d,n)8B reaction

    International Nuclear Information System (INIS)

    Ogata, Kazuyuki; Kamimura, Masayasu; Yahiro, Masanobu; Iseri, Yasunori

    2003-01-01

    The astrophysical factor S 17 for 7 Be(p,γ) 8 B reaction is reliably extracted from the transfer reaction 7 Be(d,n) 8 B at E=7.5 MeV with the asymptotic normalization coefficient method. The transfer reaction is accurately analyzed with CDCC based on a three-body model. This analysis is free from uncertainties of the optical potentials having been crucial in the previous DWBA analyses

  17. Coulomb dissociation of {sup 8}B at 254 A MeV

    Energy Technology Data Exchange (ETDEWEB)

    Suemmerer, K; Boue, F; Baumann, T; Geissel, H; Hellstroem, M; Koczon, P; Schwab, E; Schwab, W; Senger, P; Surowiecz, A [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany); Iwasa, N; Ozawa, A [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany); [RIKEN Institute of Physical and Chemical Research, Saitama (Japan); Surowka, G [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany); [Jagiellonian Univ., Krakow (Poland). Inst. of Physics; Blank, B; Czajkowski, S; Marchand, C; Pravikoff, M S [Centre d` Etudes Nucleaires de Bordeaux-Gradignan, 33 (France); Foerster, A; Lauer, F; Oeschler, H; Speer, J; Sturm, C; Uhlig, F; Wagner, A [Technische Univ. Darmstadt (Germany); Gai, M [Connecticut Univ., Storrs, CT (United States). Dept. of Physics; Grosse, E [Inst. fuer Kern- und Hadronenphysik, Forschungszentrum Rossendorf, Dresden (Germany); Kohlmeyer, B [Philipps Univ., Marburg (Germany). Fachbereich Physik; Kulessa, R; Walus, W [Jagiellonian Univ., Krakow (Poland). Inst. of Physics; Motobayashi, T [Rikkyo Univ., Tokyo (Japan). Dept. of Physics; Teranishi, T [RIKEN Institute of Physical and Chemical Research, Saitama (Japan)

    1998-06-01

    As an alternative method for determining the astrophysical S-factor for the {sup 7}Be(p,{gamma}){sup 8}B reaction we have measured the Coulomb dissociation of {sup 8}B at 254 A MeV. From our preliminary results, we obtain good agreement with both the accepted direct-reaction measurements and the low-energy Coulomb dissociation study of Iwasa et al. performed at about 50 A MeV. (orig.)

  18. Modulation of thalamocortical oscillations by TRIP8b, an auxiliary subunit for HCN channels.

    Science.gov (United States)

    Zobeiri, Mehrnoush; Chaudhary, Rahul; Datunashvili, Maia; Heuermann, Robert J; Lüttjohann, Annika; Narayanan, Venu; Balfanz, Sabine; Meuth, Patrick; Chetkovich, Dane M; Pape, Hans-Christian; Baumann, Arnd; van Luijtelaar, Gilles; Budde, Thomas

    2018-04-01

    Hyperpolarization-activated cyclic nucleotide-gated cation (HCN) channels have important functions in controlling neuronal excitability and generating rhythmic oscillatory activity. The role of tetratricopeptide repeat-containing Rab8b-interacting protein (TRIP8b) in regulation of hyperpolarization-activated inward current, I h , in the thalamocortical system and its functional relevance for the physiological thalamocortical oscillations were investigated. A significant decrease in I h current density, in both thalamocortical relay (TC) and cortical pyramidal neurons was found in TRIP8b-deficient mice (TRIP8b -/- ). In addition basal cAMP levels in the brain were found to be decreased while the availability of the fast transient A-type K + current, I A , in TC neurons was increased. These changes were associated with alterations in intrinsic properties and firing patterns of TC neurons, as well as intrathalamic and thalamocortical network oscillations, revealing a significant increase in slow oscillations in the delta frequency range (0.5-4 Hz) during episodes of active-wakefulness. In addition, absence of TRIP8b suppresses the normal desynchronization response of the EEG during the switch from slow-wave sleep to wakefulness. It is concluded that TRIP8b is necessary for the modulation of physiological thalamocortical oscillations due to its direct effect on HCN channel expression in thalamus and cortex and that mechanisms related to reduced cAMP signaling may contribute to the present findings.

  19. MD421: Electron cloud studies on 25 ns beam variants (BCMS, 8b+4e)

    CERN Document Server

    Iadarola, Giovanni; Belli, Eleonora; Carver, Lee Robert; Dijkstal, Philipp; Li, Kevin Shing Bruce; Mether, Lotta; Romano, Annalisa; Rumolo, Giovanni; CERN. Geneva. ATS Department

    2017-01-01

    This note describes a Machine Development session performed with the main goal of studying the e-cloud mitigation that can be obtained by injecting mixed trains of 8b+4e beam type and trains having the standard 25 ns structure. Additionally, in the course of the MD, the pure 8b+4e beam was also checked to be stable when injected with low chromaticity and octupole current settings. Subsequently, the operational BCMS 25 ns beam was also injected with the 8b+4e settings and found to be unstable. The operational settings for injection were re-found by gradually increasing the chromaticity and octupole knobs until all the bunches of the injected beam could remain stable after injection.

  20. Reaction mechanisms in collisions induced by $^{8}$B beam close to the barrier

    CERN Multimedia

    The aim of the proposed experiment is to investigate the reaction dynamics of proton-halo induced collisions at energies around the Coulomb barrier where coupling to continuum effects are expected to be important. We propose to measure the $^{8}$B + $^{64}$Zn elastic scattering angular distribution together with the measurement, for the first time, of p - $^{7}$Be coincidences coming from transfer and/or break-up of $^{8}$B. The latter will allow a better understanding of the relative contribution of elastic $\\textit{vs}$ non-elastic break-up in reactions induced by extremely weakly-bound nuclei. We believe that with the availability of the post accelerated $^{8}$B beam at REX-ISOLDE we will be able to collect for the first time high quality data for the study of such an important topic.

  1. Analysis of Human TAAR8 and Murine Taar8b Mediated Signaling Pathways and Expression Profile

    Directory of Open Access Journals (Sweden)

    Jessica Mühlhaus

    2014-11-01

    Full Text Available The thyroid hormone derivative 3-iodothyronamine (3-T1AM exerts metabolic effects in vivo that contradict known effects of thyroid hormones. 3-T1AM acts as a trace amine-associated receptor 1 (TAAR1 agonist and activates Gs signaling in vitro. Interestingly, 3-T1AM-meditated in vivo effects persist in Taar1 knockout-mice indicating that further targets of 3-T1AM might exist. Here, we investigated another member of the TAAR family, the only scarcely studied mouse and human trace-amine-associated receptor 8 (Taar8b, TAAR8. By RT-qPCR and locked-nucleic-acid (LNA in situ hybridization, Taar8b expression in different mouse tissues was analyzed. Functionally, we characterized TAAR8 and Taar8b with regard to cell surface expression and signaling via different G-protein-mediated pathways. Cell surface expression was verified by ELISA, and cAMP accumulation was quantified by AlphaScreen for detection of Gs and/or Gi/o signaling. Activation of G-proteins Gq/11 and G12/13 was analyzed by reporter gene assays. Expression analyses revealed at most marginal Taar8b expression and no gender differences for almost all analyzed tissues. In heart, LNA-in situ hybridization demonstrated the absence of Taar8b expression. We could not identify 3-T1AM as a ligand for TAAR8 and Taar8b, but both receptors were characterized by a basal Gi/o signaling activity, a so far unknown signaling pathway for TAARs.

  2. 17 CFR 270.8b-16 - Amendments to registration statement.

    Science.gov (United States)

    2010-04-01

    ... company's investment objectives or policies (described in Item 8.2 of Form N-2) that have not been... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.8b-16 Amendments to registration statement. (a) Every registered management investment company which is required to file a semi-annual report...

  3. Cxcl8b and Cxcr2 Regulate Neutrophil Migration through Bloodstream in Zebrafish

    Directory of Open Access Journals (Sweden)

    Constanza Zuñiga-Traslaviña

    2017-01-01

    Full Text Available Neutrophils play an essential role during an inflammatory response, which is dependent on their rapid recruitment from the bone marrow to the vasculature. However, there is no information about the molecular signals that regulate neutrophil entry to circulation during an inflammatory process in humans. This is mainly due to the lack of a suitable model of study that contains similar set of molecules and that allows in vivo analyses. In this study, we used the zebrafish to assess the role of Cxcl8a, Cxcl8b, and Cxcr2 in neutrophil migration to blood circulation after injury. Using Tg(BACmpx:GFPi114 transgenic embryos and two damage models (severe and mild, we developed in vivo lack of function assays. We found that the transcription levels of cxcl8a, cxcl8b, and cxcr2 were upregulated in the severe damage model. In contrast, only cxcr2 and cxcl8a mRNA levels were increased during mild damage. After knocking down Cxcl8a, neutrophil quantity decreased at the injury site, while Cxcl8b decreased neutrophils in circulation. When inhibiting Cxcr2, we observed a decrease in neutrophil entry to the bloodstream. In conclusion, we identified different functions for both Cxcl8 paralogues, being the Cxcl8b/Cxcr2 axis that regulates neutrophil entry to the bloodstream, while Cxcl8a/Cxcr2 regulates the migration to the affected area.

  4. Loss of Cyp8b1 Improves Glucose Homeostasis by Increasing GLP-1

    NARCIS (Netherlands)

    Kaur, Achint; Patankar, Jay V.; de Haan, Willeke; Ruddle, Piers; Wijesekara, Nadeeja; Groen, Albert K.; Verchere, C. Bruce; Singaraja, Roshni R.; Hayden, Michael R.

    Besides their role in facilitating lipid absorption, bile acids are increasingly being recognized as signaling molecules that activate cell-signaling receptors. Targeted disruption of the sterol 12-hydroxylase gene (Cyp8b1) results in complete absence of cholic acid (CA) and its derivatives. Here we

  5. Data of evolutionary structure change: 1AJ8B-1IOMA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AJ8B-1IOMA 1AJ8 1IOM B A LAKGLEDVYIDQTNICYIDGKEGKLYYRGYSVEELAELS...>GLY CA 362 ASP CA 307 LYS CA 257 1IOM... A 1IOMA EKLARLVAEKHGHS ARG CA 182 1IOM A 1IOM... 2.0784668922424316 2 1IOM

  6. Data of evolutionary structure change: 1CG8B-1OUTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available DHKQI >HHHH -- HHHH> ATOM 1228 C...ryIDChain>1OUTA FWGKISGKADVV ucture>HHHHHGGGHHHH...1CG8B GKHQE-IGVDT >HHHHH- G... >HHHH > ATOM 631 CA ASP A 86 48...ure>G - re> ATOM 329 CA PHE A 43 34.744

  7. Data of evolutionary structure change: 1BT8B-1EN5B [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available e>KGLKK----GTTLQ >H ---- > ATOM ...bChain>B 1BT8B KNMAPKGSAPERPT cture>H ...DChain> LVLKG--DKLAV >EEEE -- EEEE...ence>LVWDPLGKRINT >EEEE EEEEe> AT...re> ATOM 2237 CA LYS B 80 12.251 15.102 18.409 1.00 11.94 C

  8. Discovery and Rossiter-McLauglin effect of exoplanet kepler-8b

    DEFF Research Database (Denmark)

    Jenkins...[], Jon M.; Borucki, W.J.; Koch, D. G.

    2010-01-01

    We report on the discovery and the Rossiter-McLaughlin (R-M) effect of Kepler-8b, a transiting planet identified by the NASA Kepler Mission. Kepler photometry and Keck-HIRES radial velocities yield the radius and mass of the planet around this F8IV subgiant host star. The planet has a radius R P...

  9. ATP8B1 requires an accessory protein for endoplasmic reticulum exit and plasma membrane lipid flippase activity

    NARCIS (Netherlands)

    Paulusma, Coen C.; Folmer, Dineke E.; Ho-Mok, Kam S.; de Waart, D. Rudi; Hilarius, Petra M.; Verhoeven, Arthur J.; Oude Elferink, Ronald P. J.

    2008-01-01

    Mutations in ATP8B1 cause progressive familial intrahepatic cholestasis type 1 and benign recurrent intrahepatic cholestasis type 1. Previously, we have shown in mice that Atp8b1 deficiency leads to enhanced biliary excretion of phosphatidylserine, and we hypothesized that ATP8B1 is a flippase for

  10. Asymptotic normalization coefficients (nuclear vertex constants) for the p+7Be→8B and the 7Be(p, γ)8B astrophysical S-factors at solar energies

    International Nuclear Information System (INIS)

    Igamov, S.B.; Yarmukhamedov, R.

    2007-01-01

    Full text: The 7 Be(p,γ) 8 B reaction rate given by in terms of the zero-energy astrophysical S-factor S(0) is one of the main input data in the solar neutrino problem because the high energy neutrinos are produced via the decay 8 B→ 7 Be+e + + n e . This quantity is determined by both extrapolating the measured absolute cross sections σexp (E) (or equivalently its experimental S-factors S exp (E) ) to solar energies (≅ 25 keV) and the theoretical predictions. Despite the steady and impressive progress in our understanding of this reaction have been made in last years in measurements S exp (E) at extremely low energies and the theoretical predictions S(E) at solar energies (E≤25 keV), ambiguities (up to about 35%) associated with prediction for S(0) however still exist, and it may considerably influence the predictions of the standard solar model. In this work the modified two - body potential approach is applied for a new analysis of the highly precise experimental astrophysical S-factors for the direct capture 7 Be(p, γ) 8 B reaction at E≤400 keV and 1000≤E≤1200 keV to obtain 'indirectly measured' values both of the asymptotic normalization coefficient (ANC) for the p+ 7 Be→ 8 B and of S(E) at E≤115 keV, including E=0. In this approach S(E) is expressed in the terms of ANC C Aα;lj 2 but not in the terms of the usual spectroscopic factor Z Aα;lj , which is related to the ANC C Aα;l. j as Z aα;lj =C Aα;lj 2 /b lj 2 , where b lj is the single-particle ANC for the wave function of the bound 8 B( 7 Be+p) state calculated within the shell model using the phenomenological Woods-Saxon potential with the geometric parameters (a radius r o and a diffuseness a). The approach allows one to remove the model dependence of the calculated direct on S(E) on the geometric parameters r o and a both for the two-body bound ( 7 Be+p) state and the p 7 Be- scattering state in minimum. The analysis of the experimental S exp (E) is performed by verifying values of

  11. Crystal structure of PrRh4.8B2

    International Nuclear Information System (INIS)

    Higashi, Iwami; Shishido, Toetsu; Takei, Humihiko; Kobayashi, Takaaki

    1988-01-01

    The crystal structure of a new rare earth ternary boride PrRh 4.8 B 2 was investigated, by single-crystal X-ray diffractometry. PrRh 4.8 B 2 crystallizes in the orthorhombic space group Immm with a = 9.697(4), b = 5.577(2), c = 25.64(3) A, Z=12. The intensity data were collected on a four-circle diffractometer with graphite-monochromatized Mo Kα radiation. The structure was solved by the Patterson method and refined with a full-matrix least-squares program to an R value (equal to Σvertical strokeΔFvertical stroke/Σvertical strokeF 0 vertical stroke) of 0.055 for 1176 reflections. (orig.)

  12. Measurement of 7Be and 8B solar neutrinos with Borexino

    International Nuclear Information System (INIS)

    Zavatarelli, S.; Bellini, G.; Bonetti, S.; Buizza-Avanzini, M.; Caccianiga, B.

    2009-01-01

    Borexino is a real-time liquid-scintillator detector for low-energy neutrino spectroscopy located at the Gran Sasso National Laboratories (Italy). Thanks to the unprecedented radio purity of the target mass it is providing the first direct and simultaneous measurements of the solar neutrino survival probability in both vacuum-dominated (7 B e ν) and matter-enhanced regions (8 B ν) by a single experiment. The measured interaction rates for both 7 B e and 8 B solar neutrinos are in fair agreement with the SSM predictions in case of the Lma-Msw oscillation solution and a further confirmation of the Lma scenario is provided by the absence of a day-night asymmetry in the 7 B e signal. These experimental results allow to improve the upper limit on the neutrino effective magnetic moment. Calibration campaigns aiming to reduce the systematical errors on fiducial volume definition and detector energy response are presently in progress.

  13. Fragmentation of the CRISPR-Cas Type I-B signature protein Cas8b.

    Science.gov (United States)

    Richter, Hagen; Rompf, Judith; Wiegel, Julia; Rau, Kristina; Randau, Lennart

    2017-11-01

    CRISPR arrays are transcribed into long precursor RNA species, which are further processed into mature CRISPR RNAs (crRNAs). Cas proteins utilize these crRNAs, which contain spacer sequences that can be derived from mobile genetic elements, to mediate immunity during a reoccurring virus infection. Type I CRISPR-Cas systems are defined by the presence of different Cascade interference complexes containing large and small subunits that play major roles during target DNA selection. Here, we produce the protein and crRNA components of the Type I-B CRISPR-Cas complex of Clostridium thermocellum and Methanococcus maripaludis. The C. thermocellum Cascade complexes were reconstituted and analyzed via size-exclusion chromatography. Activity of the heterologous M. maripaludis CRISPR-Cas system was followed using phage lambda plaques assays. The reconstituted Type-I-B Cascade complex contains Cas7, Cas5, Cas6b and the large subunit Cas8b. Cas6b can be omitted from the reconstitution protocol. The large subunit Cas8b was found to be represented by two tightly associated protein fragments and a small C-terminal Cas8b segment was identified in recombinant complexes and C. thermocellum cell lysate. Production of Cas8b generates a small C-terminal fragment, which is suggested to fulfill the role of the missing small subunit. A heterologous, synthetic M. maripaludis Type I-B system is active in E. coli against phage lambda, highlighting a potential for genome editing using endogenous Type-I-B CRISPR-Cas machineries. This article is part of a Special Issue entitled "Biochemistry of Synthetic Biology - Recent Developments" Guest Editor: Dr. Ilka Heinemann and Dr. Patrick O'Donoghue. Copyright © 2017 Elsevier B.V. All rights reserved.

  14. DETECTING GRAVITY MODES IN THE SOLAR {sup 8} B NEUTRINO FLUX

    Energy Technology Data Exchange (ETDEWEB)

    Lopes, Ilídio [Centro Multidisciplinar de Astrofísica, Instituto Superior Técnico, Universidade de Lisboa, Av. Rovisco Pais, 1049-001 Lisboa (Portugal); Turck-Chièze, Sylvaine, E-mail: ilidio.lopes@ist.utl.pt, E-mail: ilopes@uevora.pt, E-mail: sylvaine.turck-chieze@cea.fr [CEA/IRFU/Service d' Astrophysique, CE Saclay, F-91191 Gif sur Yvette (France)

    2014-09-10

    The detection of gravity modes produced in the solar radiative zone has been a challenge in modern astrophysics for more than 30 yr and their amplitude in the core is not yet determined. In this Letter, we develop a new strategy to look for standing gravity modes through solar neutrino fluxes. We note that due to a resonance effect, the gravity modes of low degree and low order have the largest impact on the {sup 8} B neutrino flux. The strongest effect is expected to occur for the dipole mode with radial order 2, corresponding to periods of about 1.5 hr. These standing gravity waves produce temperature fluctuations that are amplified by a factor of 170 in the boron neutrino flux for the corresponding period, in consonance with the gravity modes. From current neutrino observations, we determine that the maximum temperature variation due to the gravity modes in the Sun's core is smaller than 5.8 × 10{sup –4}. This study clearly shows that due to their high sensitivity to the temperature, the {sup 8} B neutrino flux time series is an excellent tool to determine the properties of gravity modes in the solar core. Moreover, if gravity mode footprints are discovered in the {sup 8} B neutrino flux, this opens a new line of research to probe the physics of the solar core as non-standing gravity waves of higher periods cannot be directly detected by helioseismology but could leave their signature on boron neutrino or on other neutrino fluxes.

  15. Magnetic and Moessbauer studies of amorphous Fe72-xYxHo8B20 alloys

    International Nuclear Information System (INIS)

    Krishnan, R.; Dumond, Y.; Ajan, A.; Shringi, S.N.; Prasad, S.

    1996-01-01

    We have carried out magnetic and Moessbauer studies of amorphous Fe 72-x Y x Ho 8 B 20 alloys. The Fe moment decreases with the addition of Y and a magnetic compensation occurs at 4 K for x=16. The temperature and field dependences of the magnetization have been interpreted using the mean field theory and Chudnovsky's model, respectively. These analyses yield some interesting parameters such as the random anisotropy, the exchange interactions J Fe-Fe , J Fe-Ho , etc. The Moessbauer studies show that the average hyperfine field decreases linearly with the addition of Y, in accordance with the decrease in the Fe moment. (orig.)

  16. A new wire chamber front-end system, based on the ASD-8 B chip

    International Nuclear Information System (INIS)

    Kruesemann, B.A.M.; Bassini, R.; Ellinghaus, F.; Frekers, D.; Hagemann, M.; Hannen, V.M.; Heynitz, H. von; Heyse, J.; Rakers, S.; Sohlbach, H.; Woertche, H.J.

    1999-01-01

    The Focal-Plane Polarimeter (FPP) for the Big-Bite Spectrometer van den Berg (Nucl. Instr. and Meth. B 99 (1995) 637ff) at the KVI requires the read-out of four large-area MWPCs and two VDCs with 3872 wires in total. The EUROSUPERNOVA collaboration (SNOVA) developed a digital 16 channel preamplifier front-end board, housing two amplifier-shaper-discriminatorchips ASD-8 B. The main features of this board are a fast single-wire readout, a high integration density, a low power consumption and compatibility to common instrumentation standards. The board represents the first successfully running application of the ASD-8 for wire chamber readout. (author)

  17. Rescue of defective ATP8B1 trafficking by CFTR correctors as a therapeutic strategy for familial intrahepatic cholestasis

    NARCIS (Netherlands)

    van der Woerd, Wendy L.; Wichers, Catharina G. K.; Vestergaard, Anna L.; Andersen, Jens Peter; Paulusma, Coen C.; Houwen, Roderick H. J.; van de Graaf, Stan F. J.

    Background & Aims ATP8B1 deficiency is an autosomal recessive liver disease characterized by intrahepatic cholestasis. ATP8B1 mutation p.I661T, the most frequent mutation in European patients, results in protein misfolding and impaired targeting to the plasma membrane. Similarly, mutations in cystic

  18. Rescue of defective ATP8B1 trafficking by CFTR correctors as a therapeutic strategy for familial intrahepatic cholestasis

    NARCIS (Netherlands)

    van der Woerd, Wendy L.; Wichers, Catharina G. K.; Vestergaard, Anna L.; Andersen, Jens Peter; Paulusma, Coen C.; Houwen, Roderick H. J.; van de Graaf, Stan F. J.

    2016-01-01

    ATP8B1 deficiency is an autosomal recessive liver disease characterized by intrahepatic cholestasis. ATP8B1 mutation p.I661T, the most frequent mutation in European patients, results in protein misfolding and impaired targeting to the plasma membrane. Similarly, mutations in cystic fibrosis

  19. Low Energy 8 B Solar Neutrinos with the Wideband Intelligent Trigger at Super-Kamiokande

    Science.gov (United States)

    Elnimr, Muhammad; Super-Kamiokande Collaboration

    2017-09-01

    The water Cherenkov experiment Super-Kamiokande (SK) has accumulated a sample of ˜ 90k solar neutrino data in the past two decades. Currently, the detector measures recoil electrons from solar 8 B neutrino-electron scattering above a kinetic energy of ˜ 3.5 MeV, limited by the capacity of the software trigger, although electrons as low as 2.5 MeV can be reconstructed. The next frontier for the low energy program at Super-K is the current operation of the Wideband Intelligent Trigger (WIT) to push the trigger threshold to the event reconstruction limit of 2.5 MeV. This opens up the possibility to explore the lower energy edge of the Mikheyev-Smirnov-Wolfenstein (MSW) effect in the sun. In this work we will present the prelimiary analysis of the accumlated WIT data taken so far as well as future prospects.

  20. Searches for high frequency variations in the 8-B neutrino flux at the Sudbury neutrino observatory

    Energy Technology Data Exchange (ETDEWEB)

    Rielage, Keith [Los Alamos National Laboratory; Seibert, Stanley R [Los Alamos National Laboratory; Hime, Andrew [Los Alamos National Laboratory; Elliott, Steven R [Los Alamos National Laboratory; Stonehill, L C [Los Alamos National Laboratory; Wouters, J M [Los Alamos National Laboratory; Aharmim, B [LAURENTIAN UNIV; Ahmed, S N [QUEEN' S UNIV; Anthony, A E [UNIV OF TEXAS; Barros, N [PORTUGAL; Beier, E W [UNIV OF PA; Bellerive, A [CARLETON UNIV; Belttran, B [UNIV OF ALBERTA; Bergevin, M [LBNL; Biller, S D [UNIV OF OXFORD; Boudjemline, K [CARLETON UNIV; Burritt, T H [UNIV OF WASHINGTON; Cai, B [QUEEN' S UNIV; Chan, Y D [LBNL; Chauhan, D [LAURENTIAN UNIV; Chen, M [QUEEN' S UNIV; Cleveland, B T [UNIV OF OXFORD; Cox - Mobrand, G A [UNIV OF WASHINGTON; Dai, X [QUEEN' S UNIV; Deng, H [UNIV OF PA; Detwiler, J [LBNL; Dimarco, M [QUEEN' S UNIV; Doe, P J [UNIV OF WASHINGTON; Drouin, P - L [CARLTON UNIV; Duba, C A [UNIV OF WASHINGTON; Duncan, F A [SNOLAB, SUDBURY; Dunford, M [UNIV OF PA; Earle, E D [QUEEN' S UNIV; Evans, H C [QUEEN' S UNIV; Ewan, G T [QUEEN' S UNIV; Farine, J [LAURENTTIAN UNIV; Fergani, H [UNIV OF OXFORD; Fleurot, F [LAURENTIAN UNIV; Ford, R J [SNOLAB, SUDBURY; Formaggilo, J A [MASSACHUSETTS INST. OF TECH.; Gagnon, N [UNIV OF WASHINGTON; Goon, J Tm [LOUISIANA STATE UNIV; Guillian, E [QUEEN' S UNIV; Habib, S [UNIV OF ALBERTA; Hahn, R L [BNL; Hallin, A L [UNIV OF ALBERTA; Hallman, E D [LAURENTIAN UNIV; Harvey, P J [QUEEN' S UNIV; Hazama, R [UNIV OF WASHINGTON; Heintzelman, W J [UNIV OF PA; Heise, J [SNOLAB, SUDBURY; Helmer, R L [TRIUMF; Howard, C [UNIV OF ALBERTA; Howe, M A [UNIV OF WASHINGTON; Huang, M [UNIV OF TEXAS; Jamieson, B [UNIV OF BRITISH COLUMBIA; Jelley, N A [UNIV OF OXFORD; Keeter, K J [SNOLAB, SUDBURY; Klein, J R [UNIV OF TEXAS; Kos, M [QUEEN' S UNIV; Kraus, C [QUEEN' S UNIV; Krauss, C B [UNIV OF ALBERTA; Kutter, T [LOUISIANA STATE UNIV; Kyba, C C M [UNIV OF PA; Law, J [UNIV OF GUELPH; Lawson, I T [SNOLAB, SUDBURY; Lesko, K T [LBNL; Leslie, J R [QUEEN' S UNIV; Loach, J C [UNIV OF OXFORD; Maclellan, R [QUEEN' S UNIV; Majerus, S [UNIV OF OXFORD; Mak, H B [QUEEN' S UNIV; Maneira, J [PORTUGAL; Martin, R [QUEEN' S UNIV; Mccauley, N [UNIV OF PA; Mc Donald, A B [QUEEN' S UNIV; Mcgee, S [UNIV OF WASHINGTON; Miffin, C [CARLETON UNIV; Miller, M L [MASSACHUSETTS INST. OF TECH.; Monreal, B [MASSACHUSETTS INST. OF TECH.; Monroe, J [MASSACHUSETTS INST. OF TECH; Morissette, B [SNOLAB, SUDBURY; Nickel, B G [UNIV OF GUELPH; Noble, A J [QUEEN' S UNIV; O' Keeffe, H M [UNIV OF OXFORD; Oblath, N S [UNIV OF WASHINGTON; Orebi Gann, G D [UNIV OF OXFORD; Oser, S M [UNIV OF BRITISH COLUMBIA; Ott, R A [MASSACHUSETTS INST. OF TECH.; Peeters, S J M [UNIV OF OXFORD; Poon, A W P [LBNL; Prior, G [LBNL; Reitzner, S D [UNIV OF GUELPH; Robertson, B C [QUEEN' S UNIV; Robertson, R G H [UNIV OF WASHINGTON; Rollin, E [CARLETON UNIV; Schwendener, M H [LAURENTIAN UNIV; Secrest, J A [UNIV OF PA; Seibert, S R [UNIV OF TEXAS; Simard, O [CARLETON UNIV; Sinclair, D [CARLETON UNIV; Sinclair, L [CARLETON UNIV; Skensved, P [QUEEN' S UNIV; Sonley, T J [MASSACHUSETTS INST. OF TECH.; Tesic, G [CARLETON UNIV; Tolich, N [UNIV OF WASHINGTON; Tsui, T [UNIV OF BRITISH COLUMBIA; Tunnell, C D [UNIV OF TEXAS; Van Berg, R [UNIV OF PA; Van Devender, B A [UNIV OF WASHINGTON; Virtue, C J [LAURENTIAN UNIV; Wall, B L [UNIV OF WASHINGTON; Waller, D [CARLETON UNIV; Wan Chan Tseung, H [UNIV OF OXFORD; West, N [UNIV OF OXFORD; Wilkerson, J F [UNIV OF WASHINGTON; Wilson, J R [UNIV OF OXFORD; Wright, A [QUEEN' S UNIV; Yeh, M [BNL; Zhang, F [CARLETON UNIV; Zuber, K [UNIV OF OXFORD

    2009-01-01

    We have peformed three searches for high-frequency signals in the solar neutrino flux measured by the Sudbury Neutrino Observatory (SNO), motivated by the possibility that solar g-mode oscillations could affect the production or propagation of solar {sup 8}B neutrinos. The first search looked for any significant peak in the frequency range l/day to 144/day, with a sensitivity to sinusoidal signals with amplitudes of 12% or greater. The second search focused on regions in which g-mode signals have been claimed by experiments aboard the SoHO satellite, and was sensitive to signals with amplitudes of 10% or greater. The third search looked for extra power across the entire frequency band. No statistically significant signal was detected in any of the three searches.

  1. Prediction to natural circulation in semiscale SBLOCA test, S-NC-8B

    International Nuclear Information System (INIS)

    Bang, Young Seok; Seul, Kwang Won; Lee, Sukho; Kim, Hho Jung

    1995-01-01

    Natural circulation and the associated thermal-hydraulic behavior are predicted by RELAP5/MOD3.1 code against the test S-NC-8B, which simulated 0.1% equivalent SBLOCA in PWR. The Semiscale Mod-2A facility and the test-specific initial/boundary condition are modeled. The calculation result is compared with the experiment data in terms of natural circulation characteristic and the code predictability is evaluated on natural circulation. As a result, flow rate during single-and two-phase natural circulation modes is well predicted and slightly overpredicted with oscillation in transition and reflux regimes. Additional sensitivity calculations are attempted with different discharge coefficient and break modeling to investigate the break flow effect

  2. Investigation of the nuclear matter density distributions of the exotic 12Be,14Be and 8B nuclei by elastic proton scattering in inverse kinematics

    International Nuclear Information System (INIS)

    Ilieva, Stoyanka

    2008-01-01

    In the current experiment, the differential cross sections for proton elastic scattering on the isotopes 7,9,10,11,12,14 Be and 8 B were measured. As results from the experiment, the absolute differential cross sections dσ/dt as a function of the four momentum transfer t were obtained. In this work the differential cross sections for elastic p- 12 Be, p- 14 Be and p- 8 B scattering at low t (t≤0.05(GeV/c) 2 ) are presented. The measured cross sections were analyzed within the Glauber multiple-scattering theory using different density parameterizations, and the nuclear matter density distributions and radii of the investigated isotopes were determined. The determined rms matter radius is 3.11±0.04±0.13 fm. In the case of the 12 Be nucleus the results showed an extended matter distribution as well. For this nucleus a matter radius of 2.82±0.03±0.12 fm was determined. An interesting result is that the free 12 Be nucleus behaves differently from the core of 14 Be and is much more extended than it. Preliminary experimental results for the isotope 8 B are also presented. An extended matter distribution was obtained (though much more compact as compared to the neutron halos). A proton halo structure was observed for the first time with the proton elastic scattering method. The deduced matter radius is 2.60±0.02±0.26 fm. Results from the feasibility studies of the EXL detector setup, performed at the present ESR storage ring, are presented. (orig.)

  3. Two-proton pickup studies with the (6Li,8B) reaction

    Energy Technology Data Exchange (ETDEWEB)

    Weisenmiller, R.B.

    1976-12-03

    The (/sup 6/Li,/sup 8/B) reaction has been investigated on targets of /sup 26/Mg, /sup 24/Mg, /sup 16/O, /sup 13/C, /sup 12/C, /sup 11/B, /sup 10/B, and /sup 9/Be at a bombarding energy of 80.0 MeV, and on targets of /sup 16/O, /sup 12/C, /sup 9/Be, /sup 7/Li, and /sup 6/Li at a bombarding energy of 93.3 MeV. Only levels consistent with direct, single-step two-proton pickup reaction mechanisms were observed to be strongly populated. On T/sub z/ = 0 targets, the spectroscopic selectivity of this reaction resembles that of the analogous (p,t) reaction. Additionally, these data demonstrate the dominance of spatially symmetric transfer of the two protons. On T/sub z/ greater than 0 targets the (/sup 6/Li,/sup 8/B) reaction was employed to locate two previously unreported levels (at 7.47 +- 0.05 MeV and 8.86 +- 0.07 MeV) in the T/sub z/ = 2 nuclide /sup 24/Ne and to establish the low-lying 1p-shell states in the T/sub z/ = /sup 3///sub 2/ nuclei /sup 11/Be, /sup 9/Li, and /sup 7/He. However, no evidence was seen for any narrow levels in the T/sub z/ = /sup 3///sub 2/ nuclide /sup 5/H nor for any narrow excited states in /sup 7/He. The angular distributions reported here are rather featureless and decrease monotonically with increasing angle. This behavior can be shown by a semi-classical reaction theory to be a consequence of the reaction kinematics. A semi-classical approach also suggests that the kinematic term in the transition matrix element is only weakly dependent upon the angular momentum transfer (which is consistent with simple Distorted Wave Born Approximation calculations). However, only qualitative agreement was obtained between the observed relative transition yields and semi-classical predictions, using the two-nucleon coefficients of fractional parentage of Cohen and Kurath, probably due to the limitations of the semi-classical reaction theory.

  4. Two-proton pickup studies with the (6Li,8B) reaction

    International Nuclear Information System (INIS)

    Weisenmiller, R.B.

    1976-01-01

    The ( 6 Li, 8 B) reaction has been investigated on targets of 26 Mg, 24 Mg, 16 O, 13 C, 12 C, 11 B, 10 B, and 9 Be at a bombarding energy of 80.0 MeV, and on targets of 16 O, 12 C, 9 Be, 7 Li, and 6 Li at a bombarding energy of 93.3 MeV. Only levels consistent with direct, single-step two-proton pickup reaction mechanisms were observed to be strongly populated. On T/sub z/ = 0 targets, the spectroscopic selectivity of this reaction resembles that of the analogous (p,t) reaction. Additionally, these data demonstrate the dominance of spatially symmetric transfer of the two protons. On T/sub z/ greater than 0 targets the ( 6 Li, 8 B) reaction was employed to locate two previously unreported levels (at 7.47 +- 0.05 MeV and 8.86 +- 0.07 MeV) in the T/sub z/ = 2 nuclide 24 Ne and to establish the low-lying 1p-shell states in the T/sub z/ = 3 / 2 nuclei 11 Be, 9 Li, and 7 He. However, no evidence was seen for any narrow levels in the T/sub z/ = 3 / 2 nuclide 5 H nor for any narrow excited states in 7 He. The angular distributions reported here are rather featureless and decrease monotonically with increasing angle. This behavior can be shown by a semi-classical reaction theory to be a consequence of the reaction kinematics. A semi-classical approach also suggests that the kinematic term in the transition matrix element is only weakly dependent upon the angular momentum transfer (which is consistent with simple Distorted Wave Born Approximation calculations). However, only qualitative agreement was obtained between the observed relative transition yields and semi-classical predictions, using the two-nucleon coefficients of fractional parentage of Cohen and Kurath, probably due to the limitations of the semi-classical reaction theory

  5. WASP-12b and HAT-P-8b are Members of Triple Star Systems

    Science.gov (United States)

    Bechter, Eric B.; Crepp, Justin R.; Ngo, Henry; Knutson, Heather A.; Batygin, Konstantin; Hinkley, Sasha; Muirhead, Philip S.; Johnson, John Asher; Howard, Andrew W.; Montet, Benjamin T.; Matthews, Christopher T.; Morton, Timothy D.

    2014-06-01

    We present high spatial resolution images that demonstrate that WASP-12b and HAT-P-8b orbit the primary stars of hierarchical triple star systems. In each case, two distant companions with colors and brightnesses consistent with M dwarfs co-orbit the hot Jupiter planet host as well as one another. Our adaptive optics images spatially resolve the secondary around WASP-12, previously identified by Bergfors et al. and Crossfield et al. into two distinct sources separated by 84.3 ± 0.6 mas (21 ± 3 AU). We find that the secondary to HAT-P-8, also identified by Bergfors et al., is in fact composed of two stars separated by 65.3 ± 0.5 mas (15 ± 1 AU). Our follow-up observations demonstrate physical association through common proper motion. HAT-P-8 C has a particularly low mass, which we estimate to be 0.18 ± 0.02 M ⊙ using photometry. Due to their hierarchy, WASP-12 BC and HAT-P-8 BC will enable the first dynamical mass determination for hot Jupiter stellar companions. These previously well studied planet hosts now represent higher-order multi-star systems with potentially complex dynamics, underscoring the importance of diffraction-limited imaging and providing additional context for understanding the migrant population of transiting hot Jupiters.

  6. WASP-12b AND HAT-P-8b are members of triple star systems

    International Nuclear Information System (INIS)

    Bechter, Eric B.; Crepp, Justin R.; Matthews, Christopher T.; Ngo, Henry; Knutson, Heather A.; Batygin, Konstantin; Johnson, John Asher; Hinkley, Sasha; Muirhead, Philip S.; Montet, Benjamin T.; Morton, Timothy D.; Howard, Andrew W.

    2014-01-01

    We present high spatial resolution images that demonstrate that WASP-12b and HAT-P-8b orbit the primary stars of hierarchical triple star systems. In each case, two distant companions with colors and brightnesses consistent with M dwarfs co-orbit the hot Jupiter planet host as well as one another. Our adaptive optics images spatially resolve the secondary around WASP-12, previously identified by Bergfors et al. and Crossfield et al. into two distinct sources separated by 84.3 ± 0.6 mas (21 ± 3 AU). We find that the secondary to HAT-P-8, also identified by Bergfors et al., is in fact composed of two stars separated by 65.3 ± 0.5 mas (15 ± 1 AU). Our follow-up observations demonstrate physical association through common proper motion. HAT-P-8 C has a particularly low mass, which we estimate to be 0.18 ± 0.02 M ☉ using photometry. Due to their hierarchy, WASP-12 BC and HAT-P-8 BC will enable the first dynamical mass determination for hot Jupiter stellar companions. These previously well studied planet hosts now represent higher-order multi-star systems with potentially complex dynamics, underscoring the importance of diffraction-limited imaging and providing additional context for understanding the migrant population of transiting hot Jupiters.

  7. WASP-12b AND HAT-P-8b are members of triple star systems

    Energy Technology Data Exchange (ETDEWEB)

    Bechter, Eric B.; Crepp, Justin R.; Matthews, Christopher T. [Department of Physics, University of Notre Dame, 225 Nieuwland Science Hall, Notre Dame, IN 46556 (United States); Ngo, Henry; Knutson, Heather A.; Batygin, Konstantin; Johnson, John Asher [Department of Planetary Science, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Hinkley, Sasha; Muirhead, Philip S.; Montet, Benjamin T.; Morton, Timothy D. [Department of Astronomy, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Howard, Andrew W., E-mail: ebechter@nd.edu [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States)

    2014-06-10

    We present high spatial resolution images that demonstrate that WASP-12b and HAT-P-8b orbit the primary stars of hierarchical triple star systems. In each case, two distant companions with colors and brightnesses consistent with M dwarfs co-orbit the hot Jupiter planet host as well as one another. Our adaptive optics images spatially resolve the secondary around WASP-12, previously identified by Bergfors et al. and Crossfield et al. into two distinct sources separated by 84.3 ± 0.6 mas (21 ± 3 AU). We find that the secondary to HAT-P-8, also identified by Bergfors et al., is in fact composed of two stars separated by 65.3 ± 0.5 mas (15 ± 1 AU). Our follow-up observations demonstrate physical association through common proper motion. HAT-P-8 C has a particularly low mass, which we estimate to be 0.18 ± 0.02 M {sub ☉} using photometry. Due to their hierarchy, WASP-12 BC and HAT-P-8 BC will enable the first dynamical mass determination for hot Jupiter stellar companions. These previously well studied planet hosts now represent higher-order multi-star systems with potentially complex dynamics, underscoring the importance of diffraction-limited imaging and providing additional context for understanding the migrant population of transiting hot Jupiters.

  8. Nanocrystallization in Co67Cr7Fe4Si8B14 Amorphous Alloy Ribbons

    Directory of Open Access Journals (Sweden)

    Zahra Jamili-Shirvan

    2013-12-01

    Full Text Available The nanocrystallization of Co67Fe4Cr7Si8B14 amorphous ribbons which prepared by planar flow melt spinning process (PFMS was investigated. Crystallization of the ribbons was studied by differential thermal analysis (DTA, X-ray diffraction (XRD and transmission electron microscopy (TEM. The DTA result of amorphous ribbon at heating rate of 10˚C/min showedoccurrence of phase transitions in two stages. The ribbons were isothermally annealed for 30 minutes in argon atmosphere at different temperatures between 300 and 650ºC with 25ºC steps. The magnetic properties of annealed samples were measured using a vibrating sample magnetometer (VSM. The VSM results revealed that optimum soft magnetic properties occurred at 400ºC. XRD patterns showed that the samples isothermally annealed up to 450ºC were amorphous, while TEM results at 400ºC indicated 7-8 nm mean size nanocrytallites in amorphous matrix and size of the nanocrystallites increased by increasing temperature. Also by X-ray diffraction pattern, precipitation of different phases at higher temperatures confirmed.

  9. AV-8B Remanufacture Program as Part of the Audit of the Defense Acquisition Board Review Process - FY 1994

    Science.gov (United States)

    1994-06-03

    wft*:¥A:ft:i:ft& OFFICE OF THE INSPECTOR GENERAL AV-8B REMANUFACTURE PROGRAM AS PART OF THE AUDIT OF THE DEFENSE ACQUISITION BOARD...Part of the Audit of the Defense Acquisition Board Review Process - FY 1994 B. DATE Report Downloaded From the Internet: 03/23/99 C. Report’s Point...NAVY FOR RESEARCH DEVELOPMENT AND ACQUISITION SUBJECT: Audit Report on the AV-8B Remanufacture Program as Part of the Audit of the Defense

  10. Evidence for a functional subdivision of Premotor Ear-Eye Field (Area 8B.

    Directory of Open Access Journals (Sweden)

    Marco eLanzilotto

    2015-01-01

    Full Text Available The Supplementary Eye Field (SEF and the Frontal Eye Field (FEF have been described as participating in gaze shift control. Recent evidence suggests, however, that other areas of the dorsomedial prefrontal cortex also influence gaze shift. Herein, we have investigated electrically evoked ear- and eye movements from the Premotor Ear-Eye Field, or PEEF (area 8B of macaque monkeys. We stimulated PEEF during spontaneous condition (outside the task performance and during the execution of a visual fixation task (VFT. In the first case, we functionally identified two regions within the PEEF: a core and a belt. In the core region, stimulation elicited forward ear movements; regarding the evoked eye movements, in some penetrations, stimulation elicited contraversive fixed-vectors with a mean amplitude of 5.14°; while in other penetrations, we observed prevalently contralateral goal-directed eye movements having end-points that fell within 15° in respect to the primary eye position. On the contrary, in the belt region, stimulation elicited backward ear movements; regarding the eye movements, in some penetrations stimulation elicited prevalently contralateral goal-directed eye movements having end-points that fell within 15° in respect to the primary eye position, while in the lateral edge of the investigated region, stimulation elicited contralateral goal-directed eye movements having end-points that fell beyond 15° in respect to the primary eye position. Stimulation during VFT either did not elicit eye movements or evoked saccades of only a few degrees. Finally, even though no head rotation movements were observed during the stimulation period, we viewed a relationship between the duration of stimulation and the neck forces exerted by the monkey’s head. We propose an updated vision of the PEEF composed of two functional regions, core and belt, which may be involved in integrating auditory and visual information important to the programming of gaze

  11. Landing Gear Stroke and Load Predictions for the AV-8B Aircraft and Three Ski Jump Ramp Profiles for the Italian Carrier Andrea Doria

    National Research Council Canada - National Science Library

    Imhof, Gregory

    2004-01-01

    .... The effort was funded through a 90-day contract to use the NAVAIR AV-8B simulation to assess the landing gear stroke and load characteristics of the AV-8B aircraft with three potential ski jump...

  12. Modified two-body potential model to the 3He(α,γ)8B reaction at extremely low energies

    International Nuclear Information System (INIS)

    Igamov, S.B.; Santullaev, A.; Yarmukhamedov, R.

    2005-01-01

    Full text: A reliable estimation of rates of different nuclear astrophysical reactions A(α,γ)B responsible for light elements abundance is one of the most actual problem of the modern nuclear astrophysics. Solution of this problem is impossible without obtaining of rather low energy cross sections (or equivalently its astrophysical S-factor (AS) S Aa (E)) for such reactions as 3 He(α,γ) 8 B, 7 Be(p,γ) 8 B, etc. In the present work modified two-body potential approach allowing to determine both the asymptotic normalization constant (ANC) of the overlap integral for the bound wave function f the nucleus B in the (A+α)-channel C Aα;1.j (or respective nuclear vertex constant for the virtual decay B→A+α, where 1(j) is orbital (total) angular momentum of a particle α in the nucleus B=(A+α), and the AS S Aα (E) at the stellar energies (E≤25 keV) from an analysis of the analysis of the S exp (E) for the peripheral direct capture reaction A(α,γ)B is developed. The method involves two additional conditions that verify the peripheral character of the reaction under consideration and on it S(E) is expressed i the terms of ANC C Aα;1.j as Z Aα;1.j =C Aα;1.j 2 /b l +j 2 , where b lj is the single-particle ANC for the wave function of the bound B=(A+α) state calculated within the shell model using the phenomenological Woods-Saxon potential with the geometric parameters (a radius r 0 and a diffuseness a). The value of b lj strongly changes as a function (r 0 ,a)-pair is determined by variation of values of the parameters r 0 , and a in a wide physical acceptable range. The present method allows one to remove the model dependence of the calculated direct on S(E) on the geometric parameters r 0 , and a both for the two-body bound (A+α) state and the Aα-scattering state in minimum. The developed method has been applied to the analysis of the experimental S exp (E) of the direct capture 3 He(α,γ) 7 Be and 7 Be(p,γ) 8 B reactions at extremely low energies. By

  13. SEARCH FOR GLOBAL f-MODES AND p-MODES IN THE {sup 8}B NEUTRINO FLUX

    Energy Technology Data Exchange (ETDEWEB)

    Lopes, Ilídio, E-mail: ilidio.lopes@ist.utl.pt, E-mail: ilopes@uevora.pt [Centro Multidisciplinar de Astrofísica, Instituto Superior Técnico, Universidade de Lisboa, Av. Rovisco Pais, 1049-001 Lisboa (Portugal); Departamento de Física, Escola de Ciências e Tecnologia, Universidade de Évora, Colégio Luis António Verney, 7002-554 Évora (Portugal)

    2013-11-01

    The impact of global acoustic modes on the {sup 8}B neutrino flux time series is computed for the first time. It is shown that the time fluctuations of the {sup 8}B neutrino flux depend on the amplitude of acoustic eigenfunctions in the region where the {sup 8}B neutrino flux is produced: modes with low n (or order) that have eigenfunctions with a relatively large amplitude in the Sun's core strongly affect the neutrino flux; conversely, modes with high n that have eigenfunctions with a minimal amplitude in the Sun's core have a very small impact on the neutrino flux. It was found that the global modes with a larger impact on the {sup 8}B neutrino flux have a frequency of oscillation in the interval 250 μHz to 500 μHz (or a period in the interval 30 minutes to 70 minutes), such as the f-modes (n = 0) for the low degrees, radial modes of order n ≤ 3, and the dipole mode of order n = 1. Their corresponding neutrino eigenfunctions are very sensitive to the solar inner core and are unaffected by the variability of the external layers of the solar surface. If time variability of neutrinos is observed for these modes, it will lead to new ways of improving the sound speed profile inversion in the central region of the Sun.

  14. Determination of S_1_7 from systematic analyses on "8B Coulomb breakup with the Eikonal-CDCC method

    International Nuclear Information System (INIS)

    Ogata, K.; Matsumoto, T.; Yamashita, N.; Kamimura, M.; Yahiro, M.; Iseri, Y.

    2003-01-01

    Systematic analysis of "8B Coulomb dissociation with the Asymptotic Normalization Coefficient (ANC) method is proposed to determine the astrophysical factor S_1_7(0) accurately. An important advantage of the analysis is that uncertainties of the extracted S_1_7(0) coming from the use of the ANC method can quantitatively be evaluated, in contrast to previous analyses using the Virtual Photon Theory (VPT). Calculation of measured spectra in dissociation experiments is done by means of the method of Continuum-Discretized Coupled-Channels (CDCC). From the analysis of "5"8Ni("8B,"7Be+p) "5"8Ni at 25.8 MeV, S_1_7(0) = 22.83 ± 0.51(theo) ± 2.28(expt) (eVb) is obtained; the ANC method turned out to work in this case within 1% of error. Preceding systematic analysis of experimental data at intermediate energies, we propose hybrid (HY) Coupled-Channels (CC) calculation of "8B Coulomb dissociation, which makes numerical calculation much simple, retaining its accuracy. The validity of the HY calculation is tested for "5"8Ni("8B,"7Be+p) "5"8Ni at 240 MeV. The ANC method combined with the HY CC calculation is shown to be a powerful technique to obtain a reliable S_1_7(0).

  15. Nanocrystal Growth in Thermally Treated Fe75Ni2Si8B13C2 Amorphous Alloy

    Czech Academy of Sciences Publication Activity Database

    Minić, Dragica M.; Blagojević, V.; Minić, Dušan M.; David, Bohumil; Pizúrová, Naděžda; Žák, Tomáš

    43A, č. 9 (2012), s. 3062-3069 ISSN 1073-5623 R&D Projects: GA MŠk 1M0512 Institutional support: RVO:68081723 Keywords : Nanocrystal growth * Fe75Ni2Si8B13C2 * Amorphous alloy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.627, year: 2012

  16. Parks not Parkways

    DEFF Research Database (Denmark)

    Conley, Jim; Jensen, Ole B.

    2016-01-01

    This case study of a dispute over a project to construct a road through green space in a small Canadian city brings together two hitherto separate theoretical approaches to mobility disputes: “culture stories” and “regimes of engagement”. The stories opponents tell, in interviews and documents, c...

  17. Simultaneous measurement of angular distribution of elastic scattering for 6Li, 7Be, and 8B in 58Ni

    International Nuclear Information System (INIS)

    Ruiz S, A.; Martinez Q, E.; Aguilera R, E.F.; Murillo O, G.; Lizcano C, D.; Gomez C, A.

    2007-01-01

    The experimental angular distributions of elastic scattering for the projectiles 6 Li, 7 Be, 8 B in 58 Ni were obtained. Using the Optical model with a Woods-Saxon potential form, as much for the real part as for the imaginary one, an adjustment to the experimental data varying only the depth of the imaginary part of the potential is made. A comparison of the results obtained for each projectile is made. (Author)

  18. Analysis of the 7Be (P, γ) 8B reaction at extremely low energies within the modified two-body potential approach

    International Nuclear Information System (INIS)

    Sanetullaev, A.; Igamov, S.B.; Yarmukhamedov, R.

    2004-01-01

    Full text: Obtaining the extremely low energy cross sections for the reaction 7 Be(p,γ ) 8 B is of great interest for a reliable estimation of the rate of this reaction, which is crucial for an accurate determination of the solar neutrino flux. At present, in current literature, there is a rather wide spread in estimation of this rate (see, for instance, Ref. [1] and references therein). In this work, the modified two-body potential approach for analysis of the astrophysical S- factor S(E) for the peripheral direct radiative capture 7 Be(p,γ ) 8 B reaction of astrophysical interest is applied, in which the additional conditions of verification of the peripheral character of the reaction under consideration are formulated. The method involves the information on the asymptotic normalization coefficient (ANC) for the virtual decay 8 B → 7 Be+p and allows one to exclude the model dependence of the calculated direct astrophysical S-factor S(E) on the geometric parameters (radius r 0 and diffuseness a) of the adopted Woods-Saxon potential, which is usually used for calculations both for the two-body ( 7 Be+p)-bound state and for the 7 Be p -scattering state. The rather precise experimental astrophysical S-factor, S exp (E), in the energy range 100 7 Be(p,γ ) 8 B reaction, measured recently by the authors of Ref. [1] is used for the analysis. It is demonstrated that at extremely low energies this reaction is strongly peripheral and the measured S exp (E) can be used as an independent source of getting the information about the ANC. The new information about values of the ANC is obtained with an estimation of the weighted mean errors for them, which involves both the experimental errors of the S exp (E), and uncertainty of the method not exceeding 4%. The extracted value of the ANC is equal to C 2 =C 2 1/2 +C 2 3/2 =5.68± 0.15 fm -1 , where the indices show the value total angular momentum of the proton in the (p+ 7 Be)-bound state of 8 B. It was also demonstrated

  19. Magnetic and Mössbauer studies of amorphous Fe 72- xY xHo 8B 20 alloys

    Science.gov (United States)

    Krishnan, R.; Driouch, L.; Lassri, H.; Dumond, Y.; Ajan, Antony; Shringi, S. N.; Prasad, Shiva

    1996-11-01

    We have carried out magnetic and Mössbauer studies of amorphous Fe 72- xY xHo 8B 20 alloys. The Fe moment decreases with the addition of Y and a magnetic compensation occurs at 4 K for x = 16. The temperature and field dependences of the magnetization have been interpreted using the mean field theory and Chudnovsky's model, respectively. These analyses yield some interesting parameters such as the random anisotropy, the exchange interactions JFe-Fe, JFe-Ho, etc. The Mössbauer studies show that the average hyperfine field decreases linearly with the addition of Y, in accordance with the decrease in the Fe moment.

  20. Crystallization of an amorphous Fe72Ni9Si8B11 alloy upon laser heating and isothermal annealing

    International Nuclear Information System (INIS)

    Girzhon, V.V.; Smolyakov, A.V.; Yastrebova, T.S.

    2003-01-01

    With the use of methods of x-ray diffraction, resistometric and metallographic analyses specific features of crystallization and phase formation in amorphous alloy Fe 72 Ni 9 Si 8 B 11 are studied under various heating conditions. It is shown that laser heating results in alloy crystallization by an explosive mechanism when attaining a certain density of irradiation power. It is stated that ribbon surface laser heating with simultaneous water cooling of an opposite surface allows manufacturing two-layer amorphous-crystalline structures of the amorphous matrix + α-(Fe, Si) - amorphous matrix type [ru

  1. A mouse genetic model for familial cholestasis caused by ATP8B1 mutations reveals perturbed bile salt homeostasis but no impairment in bile secretion

    NARCIS (Netherlands)

    Pawlikowska, Ludmila; Groen, Annemiek; Eppens, Elaine F.; Kunne, Cindy; Ottenhoff, Roelof; Looije, Norbert; Knisely, A. S.; Killeen, Nigel P.; Bull, Laura N.; Elferink, Ronald P. J. Oude; Freimer, Nelson B.

    2004-01-01

    Mutations in ATP8B1, a broadly expressed P-type ATPase, result, through unknown mechanisms, in disorders of bile secretion. These disorders vary in severity from mild and episodic to progressive with liver failure. We generated Atp8b1(G308V/G308V) mutant mice, which carry a mutation orthologous to

  2. Internal friction in cold-rolled metallic glasses Cu50Ti50 and Ni78Si8B14

    International Nuclear Information System (INIS)

    Zolotukhin, I.V.; Khonik, V.A.; Ryabtseva, T.N.; Belyavskii, V.I.

    1989-01-01

    The influence of cold rolling on the low temperature (30 to 300 K) internal friction of metallic glasses Cu 50 Ti 50 and Ni 78 Si 8 B 14 is investigated. It is shown that cold rolling of both metallic glasses up to 2 to 6% results in the appearance of a high relaxation damping peak around 260 to 280 K. The internal friction background below the peak shows a strong amplitude dependence. In highly predeformed specimens (∼ 16%) the internal friction peak is absent. Electron irradiation (2 MeV, 10 19 cm -2 ) leads to the suppression of the deformation-induced internal friction peak. The results are interpreted in the framework of the dislocation models of plastic flow of metallic glasses. (author)

  3. New experimental limits on heavy neutrino mixing in 8B decay obtained with the BOREXINO counting test facility

    International Nuclear Information System (INIS)

    Back, H.O.; Hagner, C.; Vogelaar, R.B.

    2003-01-01

    If heavy neutrinos with mass m νH ≥2m e are emitted in the decays of 8 B in the Sun, then decays ν H →ν L +e + +e - should be observed. The results of background measurements with the BOREXINO Counting Test Facility have been used to obtain bounds on the number of these decays. As a result, new limits on the coupling |U eH | 2 of a massive neutrino in the range of 1.1 to 12 MeV have been derived (|U eH | 2 ≤10 -3 -10 -5 ). The obtained limits on the mixing parameter are stronger than those obtained in the previous experiments using nuclear reactors and accelerators

  4. Multiple proton decays of 6Be, 8C, 8B(IAS) and excited states in 10C

    Science.gov (United States)

    Sobotka, Lee

    2011-10-01

    Recent technical advances have allowed for high-order correlation experiments to be done. We have primarily focused on experiments in which the final channels are composed of only alphas and protons. Four cases we have studied are: 6Be, 10C*, 8C, and 8B*(IAS) via 3, 4, 5, and 3-particle correlation measurements, respectively. While the first case had been studied before, our work presents very high statistics in the full Jacobi coordinates (the coordinates needed to describe 3-body decay.) Our study of 10C excited states provides isolatable examples of: correlated 2p decay, from one state, and the decay of another which is unusually highly correlated, a ``ménage a quatre.'' 8C decay presents the only case of sequential 3-body 2p decay steps (i.e. 2p-2p.) The intermediate in this 2-step process is the first example (6Be) mentioned above. Unlike the well-studied second step (6Be decay), the first step in this 2p-2p process provides another example of correlated 2p emission. The decay of 8B(IAS), the isobaric analog of 8C, also decays overwhelmingly by 2p emission, in this case to 6Li(IAS). This IAS-to-IAS 2p decay is one for which decay to the potential 1p intermediates is energetically allowed but isospin forbidden. This represents an expansion, over that originally envisioned by Goldanski, of the conceivable nuclear territory for 2p decay.

  5. Stromal Activation Associated with Development of Prostate Cancer in Prostate-Targeted Fibroblast Growth Factor 8b Transgenic Mice

    Directory of Open Access Journals (Sweden)

    Teresa D. Elo

    2010-11-01

    Full Text Available Expression of fibroblast growth factor 8 (FGF-8 is commonly increased in prostate cancer. Experimental studies have provided evidence that it plays a role in prostate tumorigenesis and tumor progression. To study how increased FGF-8 affects the prostate, we generated and analyzed transgenic (TG mice expressing FGF-8b under the probasin promoter that targets expression to prostate epithelium. Prostates of the TG mice showed an increased size and changes in stromal and epithelialmorphology progressing fromatypia and prostatic intraepithelial neoplasia (mouse PIN, mPIN lesions to tumors with highly variable phenotype bearing features of adenocarcinoma, carcinosarcoma, and sarcoma. The development of mPIN lesions was preceded by formation of activated stroma containing increased proportion of fibroblastic cells, rich vasculature, and inflammation. The association between advancing stromal and epithelial alterations was statistically significant. Microarray analysis and validation with quantitative polymerase chain reaction revealed that expression of osteopontin and connective tissue growth factor was markedly upregulated in TG mouse prostates compared with wild type prostates. Androgen receptor staining was decreased in transformed epithelium and in hypercellular stroma but strongly increased in the sarcoma-like lesions. In conclusion, our data demonstrate that disruption of FGF signaling pathways by increased epithelial production of FGF-8b leads to strongly activated and atypical stroma, which precedes development of mPIN lesions and prostate cancer with mixed features of adenocarcinoma and sarcoma in the prostates of TG mice. The results suggest that increased FGF-8 in human prostate may also contribute to prostate tumorigenesis by stromal activation.

  6. Screening a phage display library for a novel FGF8b-binding peptide with anti-tumor effect on prostate cancer

    International Nuclear Information System (INIS)

    Wang, Wenhui; Chen, Xilei; Li, Tao; Li, Yanmei; Wang, Ruixue; He, Dan; Luo, Wu; Li, Xiaokun; Wu, Xiaoping

    2013-01-01

    Fibroblast growth factor 8b (FGF8b) is the major isoform of FGF8 expressed in prostate cancer and it correlates with the stage and grade of the disease. FGF8b has been considered as a potential target for prostate cancer therapy. Here we isolated 12 specific FGF8b-binding phage clones by screening a phage display heptapeptide library with FGF8b. The peptide (HSQAAVP, named as P12) corresponding to one of these clones showed high homology to the immunoglobulin-like (Ig-like) domain II(D2) of high-affinity FGF8b receptor (FGFR3c), contained 3 identical amino acids (AVP) to the authentic FGFR3 D2 sequence aa 163–169 (LLAVPAA) directly participating in ligand binding, carried the same charges as its corresponding motif (aa163–169) in FGFR3c, suggesting that P12 may have a greater potential to interrupt FGF8b binding to its receptors than other identified heptapeptides do. Functional analysis indicated that synthetic P12 peptides mediate significant inhibition of FGF8b-induced cell proliferation, arrest cell cycle at the G0/G1 phase via suppression of Cyclin D1 and PCNA, and blockade of the activations of Erk1/2 and Akt cascades in both prostate cancer cells and vascular endothelial cells. The results demonstrated that the P12 peptide acting as an FGF8b antagonist may have therapeutic potential in prostate cancer. - Highlights: ► A novel FGF8b-binding peptide P12 was isolated from a phage display library. ► The mechanisms for P12 peptide inhibiting cell proliferation were proposed. ► P12 caused cell cycle arrest at G0/G1 phase via suppression of Cyclin D1 and PCNA. ► P12 suppressed FGF8b-induced activations of Akt and MAP kinases. ► P12 acting as an FGF8b antagonist may have therapeutic potential in prostate cancer

  7. Screening a phage display library for a novel FGF8b-binding peptide with anti-tumor effect on prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Wenhui; Chen, Xilei; Li, Tao; Li, Yanmei; Wang, Ruixue; He, Dan; Luo, Wu [Institute of Tissue Transplantation and Immunology, Jinan University, Guangzhou 510632 (China); Li, Xiaokun [Institute of Tissue Transplantation and Immunology, Jinan University, Guangzhou 510632 (China); School of Pharmaceutical Science, Wenzhou Medical College, Wenzhou 325035 (China); Wu, Xiaoping, E-mail: twxp@jnu.edu.cn [Institute of Tissue Transplantation and Immunology, Jinan University, Guangzhou 510632 (China); School of Pharmaceutical Science, Wenzhou Medical College, Wenzhou 325035 (China)

    2013-05-01

    Fibroblast growth factor 8b (FGF8b) is the major isoform of FGF8 expressed in prostate cancer and it correlates with the stage and grade of the disease. FGF8b has been considered as a potential target for prostate cancer therapy. Here we isolated 12 specific FGF8b-binding phage clones by screening a phage display heptapeptide library with FGF8b. The peptide (HSQAAVP, named as P12) corresponding to one of these clones showed high homology to the immunoglobulin-like (Ig-like) domain II(D2) of high-affinity FGF8b receptor (FGFR3c), contained 3 identical amino acids (AVP) to the authentic FGFR3 D2 sequence aa 163–169 (LLAVPAA) directly participating in ligand binding, carried the same charges as its corresponding motif (aa163–169) in FGFR3c, suggesting that P12 may have a greater potential to interrupt FGF8b binding to its receptors than other identified heptapeptides do. Functional analysis indicated that synthetic P12 peptides mediate significant inhibition of FGF8b-induced cell proliferation, arrest cell cycle at the G0/G1 phase via suppression of Cyclin D1 and PCNA, and blockade of the activations of Erk1/2 and Akt cascades in both prostate cancer cells and vascular endothelial cells. The results demonstrated that the P12 peptide acting as an FGF8b antagonist may have therapeutic potential in prostate cancer. - Highlights: ► A novel FGF8b-binding peptide P12 was isolated from a phage display library. ► The mechanisms for P12 peptide inhibiting cell proliferation were proposed. ► P12 caused cell cycle arrest at G0/G1 phase via suppression of Cyclin D1 and PCNA. ► P12 suppressed FGF8b-induced activations of Akt and MAP kinases. ► P12 acting as an FGF8b antagonist may have therapeutic potential in prostate cancer.

  8. Determination of the S18 astrophysical factor for 8B(p,γ)9C from the breakup of 9C at intermediate energies

    International Nuclear Information System (INIS)

    Trache, L.; Mukhamedzhanov, A.M.; Tribble, R.E.; Carstoiu, F.

    2002-06-01

    We have used existing data on the one-proton-removal cross section of 9 C at 285 MeV/u and Glauber model calculations to extract the asymptotic normalization coefficient for the wave function of the last proton in the ground state of 9 C. The calculations are done first using folded potentials starting from two different effective nucleon-nucleon interactions and second in the optical limit using three nucleon-nucleon interactions, and the results are found to be consistent, with no new parameters adjusted. We find C 2 (p 3/2 ) + C 2 (p 1/2 ) = 1.22±0.13 fm -1 . From this result we obtain the astrophysical factor for the proton radiative capture reaction 8 B(p,γ) 9 C as S 18 (0) = 46 ± 6 eV.b. The calculated energy dependence of the astrophysical S-factor for the energy region E cm = 0 - 0.8 MeV and the reaction rates for T 9 = 0 - 1 are included. (authors)

  9. Modern completion and start-up techniques for petroleum wells on Mittelplate: Mittelplate A 3a and 8b; Moderne Komplettierung und Inproduktionssetzung von Erdoelbohrungen auf Mittelplate am Beispiel Mittelplate A 3a und 8b

    Energy Technology Data Exchange (ETDEWEB)

    Sauer, P. [RWE-DEA AG, Friedrichskoog (Germany). Foerderbetrieb Holstein

    1998-12-31

    The Mittelplate offshore platform is located 7 km offshore Schleswig-Holstein in the Wattenmeer national park. The contribution describes the completion and start-up operations. (orig.) [Deutsch] Seit ueber zehn Jahren betreibt das Mittelplate Konsortium die Bohr- und Foerderinsel Mittelplate. Sie liegt 7 km vor der Nordseekueste Schleswig-Holsteins im Nationalpark Wattenmeer an der Position von einer der drei vorausgegangenen Erkundungsbohrungen. Auf der mit Spundwaenden eingefassten kuenstlichen Insel befinden sich die notwendigen Foerder-, Aufbereitungs- und Zwischenlagereinrichtungen fuer Erdoel, als auch die Energieversorgungs-, Prozesssteuer- und Wohnbereiche. Ein in die Insel integrierter Hafen nimmt zum Abtransport des Reinoels eine der drei Oeltransport-Bargen auf, mit denen das Reinoel zum Anlanden nach Brunsbuettel gebracht wird. Am Beispiel der beiden in 1997 komplettierten Bohrungen Mittelplate A 3a und 8b soll im Folgenden ueber die Komplettierung und Inproduktionssetzung von Bohrungen auf Mittelplate berichtet werden. Es werden die Anforderungen an die Komplettierungstechnik vorgestellt und im Hinblick darauf die Beispielbohrungen erlaeutert. Abschliessend soll ein Blick in die Praxis der Komplettierungsarbeiten und der Inproduktionssetzung geworfen werden. (orig.)

  10. Investigation of the nuclear matter density distributions of the exotic {sup 12}Be,{sup 14}Be and {sup 8}B nuclei by elastic proton scattering in inverse kinematics

    Energy Technology Data Exchange (ETDEWEB)

    Ilieva, Stoyanka

    2008-07-01

    In the current experiment, the differential cross sections for proton elastic scattering on the isotopes {sup 7,9,10,11,12,14}Be and {sup 8}B were measured. As results from the experiment, the absolute differential cross sections d{sigma}/dt as a function of the four momentum transfer t were obtained. In this work the differential cross sections for elastic p-{sup 12}Be, p-{sup 14}Be and p-{sup 8}B scattering at low t (t{<=}0.05(GeV/c){sup 2}) are presented. The measured cross sections were analyzed within the Glauber multiple-scattering theory using different density parameterizations, and the nuclear matter density distributions and radii of the investigated isotopes were determined. The determined rms matter radius is 3.11{+-}0.04{+-}0.13 fm. In the case of the {sup 12}Be nucleus the results showed an extended matter distribution as well. For this nucleus a matter radius of 2.82{+-}0.03{+-}0.12 fm was determined. An interesting result is that the free {sup 12}Be nucleus behaves differently from the core of {sup 14}Be and is much more extended than it. Preliminary experimental results for the isotope {sup 8}B are also presented. An extended matter distribution was obtained (though much more compact as compared to the neutron halos). A proton halo structure was observed for the first time with the proton elastic scattering method. The deduced matter radius is 2.60{+-}0.02{+-}0.26 fm. Results from the feasibility studies of the EXL detector setup, performed at the present ESR storage ring, are presented. (orig.)

  11. A DFT investigation on group 8B transition metal-doped silicon carbide nanotubes for hydrogen storage application

    Science.gov (United States)

    Tabtimsai, Chanukorn; Ruangpornvisuti, Vithaya; Tontapha, Sarawut; Wanno, Banchob

    2018-05-01

    The binding of group 8B transition metal (TMs) on silicon carbide nanotubes (SiCNT) hydrogenated edges and the adsorption of hydrogen molecule on the pristine and TM-doped SiCNTs were investigated using the density functional theory method. The B3LYP/LanL2DZ method was employed in all calculations for the considered structural, adsorption, and electronic properties. The Os atom doping on the SiCNT is found to be the strongest binding. The hydrogen molecule displays a weak interaction with pristine SiCNT, whereas it has a strong interaction with TM-doped SiCNTs in which the Os-doped SiCNT shows the strongest interaction with the hydrogen molecule. The improvement in the adsorption abilities of hydrogen molecule onto TM-doped SiCNTs is due to the protruding structure and the induced charge transfer between TM-doped SiCNT and hydrogen molecule. These observations point out that TM-doped SiCNTs are highly sensitive toward hydrogen molecule. Moreover, the adsorptions of 2-5 hydrogen molecules on TM-doped SiCNT were also investigated. The maximum storage number of hydrogen molecules adsorbed on the first layer of TM-doped SiCNTs is 3 hydrogen molecules. Therefore, TM-doped SiCNTs are suitable to be sensing and storage materials for hydrogen gas.

  12. Table-like magnetocaloric effect of Fe88−xNdxCr8B4 composite materials

    International Nuclear Information System (INIS)

    Lai, J.W.; Zheng, Z.G.; Zhong, X.C.; Franco, V.; Montemayor, R.; Liu, Z.W.; Zeng, D.C.

    2015-01-01

    The narrow working temperature range due to the sharp magnetic entropy change |ΔS M | peak and large thermal or magnetic hysteresis restricts the practical application of magnetocaloric materials. In this work, the table-like magnetocaloric effect (MCE) was obtained in the multilayer composite of Fe 88−x Nd x Cr 8 B 4 alloys with various Nd substitutions for Fe (x=5, 8, 10, 12, and 15), which were prepared by arc-melting followed by melt-spinning. The substation of Nd was found to enhance the glass-forming ability. For the alloys with Nd substitution from 5 at% to 15 at%, the Curie temperature (T C ) ranged from 322 K to 350 K and the peak value of |ΔS M | remained almost constant, 3.4–3.5 J/(kg K) under an applied field of 0–5 T. The composite with various Nd contents was prepared by stocking the ribbons layer by layer. The |ΔS M | of the composite approached a nearly constant value of ∼3.2 J/(kg K) in a field change of 0–5 T in a wide temperature span over 40 K, resulting in large refrigerant capacity value of >408 J/kg. This |ΔS M | value was much larger than the previous reported Fe-based amorphous composite Fe 78−x Ce x Si 4 Nb 5 B 12 Cu 1 . This composite can be used as the working material in the Ericsson-cycle magnetic regenerative refrigerator around room temperature. - Highlights: • The T C ranges from 322 K to 350 K when increasing Nd substitution from 5 to 15 at%. • |ΔS M | remains relatively constant, about 3.4–3.5 J/(kg K) under H=0–5 T. • RC decreases from 93 to 78 J/kg in a field change of 1.5 T when Nd increasing. • Table-like MCE ,|ΔS M | ~3.2J/kg K under 0–5 T, appeared in the composite. • A wide working temperature range (40 K) and enhanced RC (>408J/kg) were obtained in the composite

  13. 26 CFR 31.3401(a)(8)(B)-1 - Remuneration for services performed in possession of the United States (other than Puerto Rico...

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE Collection of Income Tax at Source § 31.3401(a)(8)(B)-1 Remuneration for services... based upon any evidence reasonably sufficient to induce such belief, even though such evidence may be...

  14. Effects of hydrostatic pressure and biaxial strains on the elastic and electronic properties of t-C8B2N2

    Science.gov (United States)

    Zhu, Haiyan; Shi, Liwei; Li, Shuaiqi; Duan, Yifeng; Zhang, Shaobo; Xia, Wangsuo

    2018-04-01

    The effects of hydrostatic pressure and biaxial strains on the elastic and electronic properties of a superhard material t-C8B2N2 have been studied using first-principles calculations. The structure is proven to be mechanically and dynamically stable under the applied external forces. All the elastic constants (except C66) and elastic modulus increase (decrease) with increasing pressure and compressive (tensile) biaxial strain ɛxx. A microscopic model is used to calculate the Vicker's hardness of every single bond as well as the crystal. The hardness of t-C8B2N2 (64.7 GPa) exceeds that of c-BN (62 GPa) and increases obviously by employing pressure and compressive ɛxx. Furthermore, the Debye temperature and anisotropy of sound velocities for t-C8B2N2 have been discussed. t-C8B2N2 undergoes an indirect to direct bandgap transition when ɛxx > 2%; however, the indirect bandgap character of the material remains under pressure.

  15. Breakup of 8B on 58Ni at energies around the Coulomb barrier and the astrophysical S17(0 factor revisited

    Directory of Open Access Journals (Sweden)

    Morales-Rivera J.C.

    2017-01-01

    Full Text Available Calculations of breakup and direct proton transfer for the 8B+58Ni system at energies around the Coulomb barrier (EB,lab=22.95 MeV were performed by the continuum-discretized coupled channels (CDCC method and the coupled-reaction-channels (CRC method, respectively. For the 7Be+58Ni interaction, we used a semimicroscopic optical model potential (OMP that combines microscopic calculations of the mean-field double folding potential and a phenomenological construction of the dynamical polarization potential (DPP. The 7Be angular distribution at Elab=25.75 MeV from the 8B breakup on 58Ni was calculated and the spectroscopic factor for 8B → 7Be+p vertex, Sexpt = 1.10 ± 0.05, was deduced. The astrophysical S17(0 factor was calculated equal to 20.7 ±1.1 eV•b, being in good agreement with the previously reported values.

  16. Constraining the 7Be(p,γ)8B S-factor with the new precise 7Be solar neutrino flux from Borexino

    Science.gov (United States)

    Takács, M. P.; Bemmerer, D.; Junghans, A. R.; Zuber, K.

    2018-02-01

    Among the solar fusion reactions, the rate of the 7Be(p , γ)8B reaction is one of the most difficult to determine rates. In a number of previous experiments, its astrophysical S-factor has been measured at E = 0.1- 2.5 MeV centre-of-mass energy. However, no experimental data is available below 0.1 MeV. Thus, an extrapolation to solar energies is necessary, resulting in significant uncertainty for the extrapolated S-factor. On the other hand, the measured solar neutrino fluxes are now very precise. Therefore, the problem of the S-factor determination is turned around here: Using the measured 7Be and 8B neutrino fluxes and the Standard Solar Model, the 7Be(p , γ)8B astrophysical S-factor is determined at the solar Gamow peak. In addition, the 3He(α , γ)7Be S-factor is redetermined with a similar method.

  17. WARM SPITZER OBSERVATIONS OF THREE HOT EXOPLANETS: XO-4b, HAT-P-6b, AND HAT-P-8b

    Energy Technology Data Exchange (ETDEWEB)

    Todorov, Kamen O. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Deming, Drake [Planetary Systems Laboratory, NASA' s Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Knutson, Heather A. [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States); Burrows, Adam [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 05844 (United States); Sada, Pedro V. [Department of Physics and Mathematics, University of Monterrey, Monterrey (Mexico); Cowan, Nicolas B. [Department of Physics and Astronomy, Northwestern University, Evanston, IL 60208 (United States); Agol, Eric [Department of Astronomy, University of Washington, Box 351580, Seattle, WA 98195 (United States); Desert, Jean-Michel; Charbonneau, David [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Fortney, Jonathan J.; Laughlin, Gregory [Department of Astronomy and Astrophysics, University of California at Santa Cruz, Santa Cruz, CA 95064 (United States); Langton, Jonathan [Department of Physics, Principia College, Elsah, IL 62028 (United States); Showman, Adam P.; Lewis, Nikole K. [Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721 (United States)

    2012-02-10

    We analyze Warm Spitzer/Infrared Array Camera observations of the secondary eclipses of three planets, XO-4b, HAT-P-6b, and HAT-P-8b. We measure secondary eclipse amplitudes at 3.6 {mu}m and 4.5 {mu}m for each target. XO-4b exhibits a stronger eclipse depth at 4.5 {mu}m than at 3.6 {mu}m, which is consistent with the presence of a temperature inversion. HAT-P-8b shows a stronger eclipse amplitude at 3.6 {mu}m and is best described by models without a temperature inversion. The eclipse depths of HAT-P-6b can be fitted with models with a small or no temperature inversion. We consider our results in the context of a postulated relationship between stellar activity and temperature inversion and a relationship between irradiation level and planet dayside temperature, as discussed by Knutson et al. and Cowan and Agol, respectively. Our results are consistent with these hypotheses, but do not significantly strengthen them. To measure accurate secondary eclipse central phases, we require accurate ephemerides. We obtain primary transit observations and supplement them with publicly available observations to update the orbital ephemerides of the three planets. Based on the secondary eclipse timing, we set upper boundaries for ecos ({omega}) for HAT-P-6b, HAT-P-8b, and XO-4b and find that the values are consistent with circular orbits.

  18. Isovalent substitutes play in different ways: Effects of isovalent substitution on the thermoelectric properties of CoSi_0_._9_8B_0_._0_2

    International Nuclear Information System (INIS)

    Sun, Hui; Lu, Xu; Morelli, Donald T.

    2016-01-01

    Boron-added CoSi, CoSi_0_._9_8B_0_._0_2, possesses a very high thermoelectric power factor of 60 μW cm"−"1 K"−"2 at room temperature, which is among the highest power factors that have ever been reported for near-room-temperature thermoelectric applications. Since the electrical properties of this material have been tuned properly, isovalent substitution for its host atoms is intentionally employed to reduce the lattice thermal conductivity while maintaining the electronic properties unchanged. In our previous work, the effect of Rh substitution for Co atoms on the thermoelectric properties of CoSi_0_._9_8B_0_._0_2 has been studied. Here, we present a study of the substitution of Ge for Si atoms in this compound. Even though Ge and Rh are isovalent with their corresponding host atoms, they play different roles in determining the electrical and thermal transport properties. Through the evaluation of the lattice thermal conductivity by the Debye approximation and the comparison between the high-temperature Seebeck coefficients, we propose that Rh substitution leads to a further overlapping of the conduction and the valence bands, while Ge substitution only shifts the Fermi level upward into the conduction band. Our results show that the influence of isovalent substitution on the electronic structure cannot be ignored when the alloying method is used to improve thermoelectric properties.

  19. Measurement of the nue and Total 8B Solar Neutrino Fluxes with theSudbury Neutrino Observatory Phase I Data Set

    Energy Technology Data Exchange (ETDEWEB)

    Aharmim, B.; Ahmad, Q.R.; Ahmed, S.N.; Allen, R.C.; Andersen,T.C.; Anglin, J.D.; Buehler, G.; Barton, J.C.; Beier, E.W.; Bercovitch,M.; Bergevin, M.; Bigu, J.; Biller, S.D.; Black, R.A.; Blevis, I.; Boardman, R.J.; Boger, J.; Bonvin, E.; Boulay, M.G.; Bowler, M.G.; Bowles, T.J.; Brice, S.J.; Browne, M.C.; Bullard, T.V.; Burritt, T.H.; Cameron, J.; Chan, Y.D.; Chen, H.H.; Chen, M.; Chen, X.; Cleveland, B.T.; Cowan, J.H.M.; Cowen, D.F.; Cox, G.A.; Currat, C.A.; Dai, X.; Dalnoki-Veress, F.; Davidson, W.F.; Deng, H.; DiMarco, M.; Doe, P.J.; Doucas, G.; Dragowsky, M.R.; Duba, C.A.; Duncan, F.A.; Dunford, M.; Dunmore, J.A.; Earle, E.D.; Elliott, S.R.; Evans, H.C.; Ewan, G.T.; Farine, J.; Fergani, H.; Ferraris, A.P.; Fleurot, F.; Ford, R.J.; Formaggio, J.A.; Fowler, M.M.; Frame, K.; Frank, E.D.; Frati, W.; Gagnon,N.; Germani, J.V.; Gil, S.; Goldschmidt, A.; Goon, J.T.M.; Graham, K.; Grant, D.R.; Guillian, E.; Hahn, R.L.; Hallin, A.L.; Hallman, E.D.; Hamer, A.S.; Hamian, A.A.; Handler, W.B.; Haq, R.U.; Hargrove, C.K.; Harvey, P.J.; Hazama, R.; Heeger, K.M.; Heintzelman, W.J.; Heise, J.; Helmer, R.L.; Henning, R.; Hepburn, J.D.; Heron, H.; Hewett, J.; Hime,A.; Howard, C.; Howe, M.A.; Huang, M.; Hykawy, J.G.; Isaac, M.C.P.; Jagam, P.; Jamieson, B.; Jelley, N.A.; Jillings, C.; Jonkmans, G.; Kazkaz, K.; Keener, P.T.; Kirch, K.; Klein, J.R.; Knox, A.B.; Komar,R.J.; Kormos, L.L.; Kos, M.; Kouzes, R.; Krueger, A.; Kraus, C.; Krauss,C.B.; Kutter, T.; Kyba, C.C.M.; Labranche, H.; Lange, R.; Law, J.; Lawson, I.T.; Lay, M.; Lee, H.W.; Lesko, K.T.; Leslie, J.R.; Levine, I.; Loach, J.C.; Locke, W.; Luoma, S.; Lyon, J.; MacLellan, R.; Majerus, S.; Mak, H.B.; Maneira, J.; Marino, A.D.; Martin, R.; McCauley, N.; McDonald,A.B.; McDonald, D.S.; McFarlane, K.; McGee, S.; McGregor, G.; MeijerDrees, R.; Mes, H.; Mifflin, C.; Miknaitis, K.K.S.; Miller, M.L.; Milton,G.; Moffat, B.A.; Monreal, B.; Moorhead, M.; Morrissette, B.; Nally,C.W.; Neubauer, M.S.; et al.

    2007-02-01

    This article provides the complete description of resultsfrom the Phase I data set of the Sudbury Neutrino Observatory (SNO). ThePhase I data set is based on a 0.65 kt-year exposure of heavy water tothe solar 8B neutrino flux. Included here are details of the SNO physicsand detector model, evaluations of systematic uncertainties, andestimates of backgrounds. Also discussed are SNO's approach tostatistical extraction of the signals from the three neutrino reactions(charged current, neutral current, and elastic scattering) and theresults of a search for a day-night asymmetry in the ?e flux. Under theassumption that the 8B spectrum is undistorted, the measurements fromthis phase yield a solar ?e flux of ?(?e) =1.76+0.05?0.05(stat.)+0.09?0.09 (syst.) x 106 cm?2 s?1, and a non-?ecomponent ?(? mu) = 3.41+0.45?0.45(stat.)+0.48?0.45 (syst.) x 106 cm?2s?1. The sum of these components provides a total flux in excellentagreement with the predictions of Standard Solar Models. The day-nightasymmetry in the ?e flux is found to be Ae = 7.0 +- 4.9 (stat.)+1.3?1.2percent (sys.), when the asymmetry in the total flux is constrained to bezero.

  20. Navier-Stokes simulation of external/internal transonic flow on the forebody/inlet of the AV-8B Harrier II

    Science.gov (United States)

    Mysko, Stephen J.; Chyu, Wei J.; Stortz, Michael W.; Chow, Chuen-Yen

    1993-01-01

    In this work, the computation of combined external/internal transonic flow on the complex forebody/inlet configuration of the AV-8B Harrier II is performed. The actual aircraft has been measured and its surface and surrounding domain, in which the fuselage and inlet have a common wall, have been described using structured grids. The 'thin-layer' Navier-Stokes equations were used to model the flow along with the Chimera embedded multi-block technique. A fully conservative, alternating direction implicit (ADI), approximately factored, partially fluxsplit algorithm was employed to perform the computation. Comparisons to some experimental wind tunnel data yielded good agreement for flow at zero incidence and angle of attack. The aim of this paper is to provide a methodology or computational tool for the numerical solution of complex external/internal flows.

  1. Simultaneous measurement of angular distribution of elastic scattering for {sup 6}Li, {sup 7}Be, and {sup 8}B in {sup 58}Ni; Medida simultanea de Distribuciones Angulares de Dispersion Elastica para {sup 6}Li, {sup 7}Be, y {sup 8}B en {sup 58}Ni

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz S, A. [Facultad de Ciencias, UAEM, Toluca, Estado de Mexico (Mexico); Martinez Q, E.; Aguilera R, E.F.; Murillo O, G.; Lizcano C, D.; Gomez C, A. [Departamento de Aceleradores, ININ, 52750 La Marquesa, Estado de Mexico (Mexico)

    2007-07-01

    The experimental angular distributions of elastic scattering for the projectiles {sup 6}Li, {sup 7}Be, {sup 8}B in {sup 58}Ni were obtained. Using the Optical model with a Woods-Saxon potential form, as much for the real part as for the imaginary one, an adjustment to the experimental data varying only the depth of the imaginary part of the potential is made. A comparison of the results obtained for each projectile is made. (Author)

  2. The effect of Al–8B grain refiner and heat treatment conditions on the microstructure, mechanical properties and dry sliding wear behavior of an Al–12Zn–3Mg–2.5Cu aluminum alloy

    International Nuclear Information System (INIS)

    Alipour, M.; Azarbarmas, M.; Heydari, F.; Hoghoughi, M.; Alidoost, M.; Emamy, M.

    2012-01-01

    Highlights: ► The effect of Al–8B on the properties of aluminum alloy was studied. ► Al–8B is an effective in reducing the grain and reagent fine microstructure. ► Al–8B is an effective in optimization of properties. -- Abstract: In this study the effect of Al–8B grain refiner on the structural and properties of Al–12Zn–3Mg–2.5Cu aluminum alloy were investigated. The optimum amount for B containing grain refiner was selected as 3.75 wt.%. The results showed that B containing grain refiner is more effective in reducing average grain size of the alloy. T6 heat treatment was applied for all specimens before tensile testing. Significant improvements in mechanical properties were obtained with the addition of grain refiner combined with T6 heat treatment. After the heat treatment, the average tensile strength increased from 479 MPa to 537 MPa for sample refined with 3.75 wt.% Al–8B. The fractography of the fractured faces and microstructure evolution was characterized by scanning electron microscopy and optical microscopy. Dry sliding wear performance of the alloy was examined in normal atmospheric conditions. The experimental results showed that the T6 heat treatment considerably improved the resistance of Al–12Zn–3Mg–2.5Cu aluminum alloy to the dry sliding wear.

  3. Identification of sialyltransferase 8B as a generalized susceptibility gene for psychotic and mood disorders on chromosome 15q25-26.

    Directory of Open Access Journals (Sweden)

    Erica Z McAuley

    Full Text Available We previously identified a significant bipolar spectrum disorder linkage peak on 15q25-26 using 35 extended families with a broad clinical phenotype, including bipolar disorder (types I and II, recurrent unipolar depression and schizoaffective disorder. However, the specific gene(s contributing to this signal had not been identified. By a fine mapping association study in an Australian case-control cohort (n = 385, we find that the sialyltransferase 8B (ST8SIA2 gene, coding for an enzyme that glycosylates proteins involved in neuronal plasticity which has previously shown association to both schizophrenia and autism, is associated with increased risk to bipolar spectrum disorder. Nominal single point association was observed with SNPs in ST8SIA2 (rs4586379, P = 0.0043; rs2168351, P = 0.0045, and a specific risk haplotype was identified (frequency: bipolar vs controls = 0.41 vs 0.31; χ(2 = 6.46, P = 0.011, OR = 1.47. Over-representation of the specific risk haplotype was also observed in an Australian schizophrenia case-control cohort (n = 256 (χ(2 = 8.41, P = 0.004, OR = 1.82. Using GWAS data from the NIMH bipolar disorder (n = 2055 and NIMH schizophrenia (n = 2550 cohorts, the equivalent haplotype was significantly over-represented in bipolar disorder (χ(2 = 5.91, P = 0.015, OR = 1.29, with the same direction of effect in schizophrenia, albeit non-significant (χ(2 = 2.3, P = 0.129, OR = 1.09. We demonstrate marked down-regulation of ST8SIA2 gene expression across human brain development and show a significant haplotype×diagnosis effect on ST8SIA2 mRNA levels in adult cortex (ANOVA: F(1,87 = 6.031, P = 0.016. These findings suggest that variation the ST8SIA2 gene is associated with increased risk to mental illness, acting to restrict neuronal plasticity and disrupt early neuronal network formation, rendering the developing and adult brain more vulnerable to

  4. Table-like magnetocaloric effect of Fe{sub 88−x}Nd{sub x}Cr{sub 8}B{sub 4} composite materials

    Energy Technology Data Exchange (ETDEWEB)

    Lai, J.W.; Zheng, Z.G.; Zhong, X.C. [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510640 (China); Franco, V. [Departamento Física de la Materia Condensada, ICMSE-CSIC, Universidad de Sevilla, P.O. Box 1065, 41080 Sevilla (Spain); Montemayor, R.; Liu, Z.W. [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510640 (China); Zeng, D.C., E-mail: medczeng@scut.edu.cn [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510640 (China)

    2015-09-15

    The narrow working temperature range due to the sharp magnetic entropy change |ΔS{sub M}| peak and large thermal or magnetic hysteresis restricts the practical application of magnetocaloric materials. In this work, the table-like magnetocaloric effect (MCE) was obtained in the multilayer composite of Fe{sub 88−x}Nd{sub x}Cr{sub 8}B{sub 4} alloys with various Nd substitutions for Fe (x=5, 8, 10, 12, and 15), which were prepared by arc-melting followed by melt-spinning. The substation of Nd was found to enhance the glass-forming ability. For the alloys with Nd substitution from 5 at% to 15 at%, the Curie temperature (T{sub C}) ranged from 322 K to 350 K and the peak value of |ΔS{sub M}| remained almost constant, 3.4–3.5 J/(kg K) under an applied field of 0–5 T. The composite with various Nd contents was prepared by stocking the ribbons layer by layer. The |ΔS{sub M}| of the composite approached a nearly constant value of ∼3.2 J/(kg K) in a field change of 0–5 T in a wide temperature span over 40 K, resulting in large refrigerant capacity value of >408 J/kg. This |ΔS{sub M}| value was much larger than the previous reported Fe-based amorphous composite Fe{sub 78−x}Ce{sub x}Si{sub 4}Nb{sub 5}B{sub 12}Cu{sub 1}. This composite can be used as the working material in the Ericsson-cycle magnetic regenerative refrigerator around room temperature. - Highlights: • The T{sub C} ranges from 322 K to 350 K when increasing Nd substitution from 5 to 15 at%. • |ΔS{sub M}| remains relatively constant, about 3.4–3.5 J/(kg K) under H=0–5 T. • RC decreases from 93 to 78 J/kg in a field change of 1.5 T when Nd increasing. • Table-like MCE ,|ΔS{sub M}| ~3.2J/kg K under 0–5 T, appeared in the composite. • A wide working temperature range (40 K) and enhanced RC (>408J/kg) were obtained in the composite.

  5. Cesarean Sections

    Science.gov (United States)

    ... birth after a C-section, called a VBAC ) Emergency C-Sections Some C-sections are unexpected emergency ... side to nurse or using the clutch (or football) hold can take the pressure off your abdomen. ...

  6. OPERATION DOMINIC, FISH BOWL SERIES. Project Officer’s Report. Project 8B. Nuclear Weapon X-Ray Effects as Measured by Passive Instruments

    Science.gov (United States)

    1985-09-01

    different environ- ments of SF’ and Marshmallow . The data from the Marshmallow gages are reduced and reported in this section; comparison to SF...were adjusted accordingly. Failure of similar gages to fracture in the Marshmallow event made it appear desirable to increase the probability of...and Capt. Claude M. Gillespie; "Reentry Vehicle Composites (U)" POR-1853, Project 834, Operation Nougat, Shot Marshmallow , May 1963; Air Force

  7. Bioclim Deliverable D8b: development of the physical/statistical down-scaling methodology and application to climate model Climber for BIOCLIM Work-package 3

    International Nuclear Information System (INIS)

    2003-01-01

    too coarse and simplified. This is why we first need to find these 'physically based' relations between large scale model outputs and regional scale predictors. This is a solution to the specific problem of down-scaling from an intermediate complexity model such as CLIMBER. There are several other types of down-scaling methodologies, such has the dynamical and rule-based method presented in other BIOCLIM deliverables. A specificity of the present method is to attempt to use physical considerations in the down-scaling while a detailed 'dynamical' approach is out of reach because CLIMBER mainly provides the average climate. By contrast, an input of time-variability at various scales is necessary for a more dynamical approach. This report is organised as follows: Section 2 relates to the design and validation of the method, while section 3 reports the application to BIOCLIM simulations. We first present the employed data sources, which are the model results and the observed climatology. We then present the principles of the down-scaling method, the formulation of the predictors and the calibration of the statistical model, including results for the last glacial maximum. In section 3, the results are first presented as time series for each site, then as maps at specific times, or snapshots

  8. Oxygen Non-Stoichiometry and Electrical Conductivity of LA0.2Sr0.8Fe0.8B0.2O3-d, B = Fe, Ti, Ta

    NARCIS (Netherlands)

    Lohne, O.F.; Phung, T.N.; Grande, T.; Bouwmeester, Henricus J.M.; Hendriksen, P.V.; Sogaard, M.; Wiik, K.

    2014-01-01

    The oxygen non-stoichiometry was determined by coulometric titration for the perovskite oxides La0.2Sr0.8FeO3−δ and La0.2Sr0.8Fe0.8B0.2O3−δ (B = Ti4+ and Ta5+) in the temperature range 600 ◦C ≤ T ≤ 900 ◦C and the oxygen partial pressure range: 1 · 10−15 ≤ pO2 ≤ 0.209 atm. The non-stoichiometry (δ)

  9. Effect of heat treatment on the electrochemical behaviour and catalytic activity of metal-glass of an Fe76.1Cu1.0Nb3.0Si13.8B6.1

    International Nuclear Information System (INIS)

    Zhdanova, L.I.; Sharipova, E.Kh.; Lad'yanov, V.I.; Volkov, V.A.

    1999-01-01

    Effect of the different degree of the initial surface crystallization of Fe 76.1 Cu 1.0 Nb 3.0 Si 13.8 B 6.1 metal glasses on the electrochemical behaviour and catalytic activity of the alloy during thermal treatment of tapes was studied. Growth of amorphous-nanocrystalline structure during annealing is shown to improve protective properties of fast-hardened tapes. The highest corrosion resistance of the material is manifested when in nanocrystalline state subsequent to annealing under 550 deg C [ru

  10. 15 CFR 8b.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ..., structures, equipment, roads, walks, parking lots, industrial parks, or other real or personal property or... current alcohol or drug abuse, would constitute a direct threat to property or to the safety of others. (3..., speaking, breathing, learning, working, and receiving education or vocational training. (iii) Has a record...

  11. Nitrogen versus helium: effects of the choice of the atomizing gas on the structures of Fe50Ni30Si10B10 and Fe32Ni36Ta7Si8B17 powders

    International Nuclear Information System (INIS)

    Zambon, A.

    2004-01-01

    Gas atomization can produce, besides a possible significant degree of undercooling, high cooling rates, whose extent depends on the size of the droplets, on their velocity with respect to the surrounding medium, on the thermo-physical properties of both the alloy and the gas, and of course on the operating conditions such as melt overheating and gas-to-metal flow ratio. In this respect it is well-known that the atomizing gas can play a significant role in determining both the powder size distribution and the kind and mix of phases which result from the solidification and cooling processes. The microstructures and solidification morphologies of powders obtained from nitrogen and helium sonic gas atomization of two iron-nickel base glass forming alloys, Fe 50 Ni 30 Si 10 B 10 and Fe 32 Ni 36 Ta 7 Si 8 B 17 , were investigated by means of light microscopy, X-ray diffraction (XRD) and differential thermal analysis (DTA). The Fe 32 Ni 36 Ta 7 Si 8 B 17 alloy exhibits a higher proneness to the development of amorphous phase than the Fe 50 Ni 30 Si 10 B 10 alloy, while the effect of the higher speed attainable by the stream of helium with respect to that of nitrogen, affords not only to obtain a larger amount of particles in the finer size ranges, but also to affect the relative amounts of phases within the different size fractions

  12. High hard magnetic properties and cellular structure of nanocomposite magnet Nd4.5Fe73.8B18.5Cr0.5Co1.5Nb1Cu0.2

    International Nuclear Information System (INIS)

    The, N.D.; Chau, N.; Vuong, N.V.; Quyen, N.H.

    2006-01-01

    The formation of special nanostructure, cellular structure, in Nd 4.5 Fe 73.8 B 18.5 Cr 0.5 Co 1.5 Nb 1 Cu 0.2 nanocomposite magnet has been observed by means of SEM for the first time. Ultrafine structure of cellules with thickness of 20-25 nm and length in range of 200-300 nm leads to high shape anisotropy of the materials. Therefore, high hard magnetic properties were obtained with (BH) max up to 17.3 MG Oe in ribbons with very high remanence of 13.5 kG. The role of Cr and Co in the formation and refinement of cellular structure is proposed. Effect of heat treatment on hard magnetic properties is discussed in detail

  13. Oxygen Non-Stoichiometry and Electrical Conductivity of La0.2Sr0.8Fe0.8B0.2O3 − δ, B = Fe, Ti, Ta

    DEFF Research Database (Denmark)

    Lohne, Ørjan Fossmark; Phung, Tan Nhut; Grande, Tor

    2014-01-01

    The oxygen non-stoichiometry was determined by coulometric titration for the perovskite oxides La0.2Sr0.8FeO3 − δ and La0.2Sr0.8Fe0.8B0.2O3 − δ (B = Ti4+ and Ta5+) in the temperature range 600 °C ⩽ T ⩽ 900 °C and the oxygen partial pressure range: 1⋅10-15≤po2≤0.209 atm. The non-stoichiometry (δ...... for the substituted materials. The electrical conductivity was measured at T = 900 °C in the oxygen partial pressure range: 1⋅10-17≤po2≤0.209 atm. The electrical conductivity and charge carrier mobility decrease upon 20% substitution of Fe roughly by a factor of 2, but do not show a significant dependence......) is observed to decrease with B-site substitution of Fe. The data can be well fitted with simple defect chemistry models. At low oxygen non-stoichiometry all compositions show a deviation from a localized electrons defect model. The standard and partial molar thermodynamic quantities were obtained...

  14. Mutation detection in cholestatic patients using microarray resequencing of ATP8B1 and ABCB11 [v2; ref status: indexed, http://f1000r.es/yv

    Directory of Open Access Journals (Sweden)

    Kirsten E McKay

    2013-03-01

    Full Text Available Background: Neonatal cholestasis is a common presentation of childhood liver diseases and can be a feature of various conditions including disorders of bile acid biogenesis and transport, various inborn errors of metabolism and perinatal infections. Some inherited metabolic diseases can be easily screened using biochemical assays, however many can only be accurately diagnosed by DNA sequencing. Fluorescent capillary Sanger sequencing (FS is the gold standard method used by clinical laboratories for genetic diagnosis of many inherited conditions; however, it does have limitations. Recently microarray resequencing (MR has been introduced into research and clinical practice as an alternative method for genetic diagnosis of heterogeneous conditions. In this report we compared the accuracy of mutation detection for MR with FS in a group of patients with ‘low-normal’ gamma glutamyl transpeptidase (gGT cholestasis without known molecular diagnoses. Methods: 29 patient DNA samples were tested for mutations in the ATP8B1 and ABCB11 genes using both FS and MR. Other known causes of “low gGT cholestasis” such as ARC syndrome and bile acid biosynthesis disorders were excluded. Results: Mutations were identified in 13/29 samples. In 3/29 samples FS and MR gave discordant results: MR had a false positive rate of 3.4% and a false negative rate of 7%. Conclusions: The major advantage of MR over FS is that multiple genes can be screened in one experiment, allowing rapid and cost-effective diagnoses.  However, we have demonstrated that MR technology is limited in sensitivity. We therefore recommend that MR be used as an initial evaluation, with FS deployed when genetic and clinical or histopathological findings are discordant.

  15. 36 CFR 7.43 - Natchez Trace Parkway.

    Science.gov (United States)

    2010-07-01

    ...) Trailers. Trailers are permitted when used non-commercially to transport baggage, camping equipment, horses... written permission when transporting people for special recreational or educational purposes. (7) Towed... exceed 55 feet in length. (d) Beer and alcoholic beverages. The possession of beer or any alcoholic...

  16. FEMA DFIRM Cross Sections

    Data.gov (United States)

    Minnesota Department of Natural Resources — FEMA Cross Sections are required for any Digital Flood Insurance Rate Map database where cross sections are shown on the Flood Insurance Rate Map (FIRM). Normally...

  17. Solar fusion cross sections II: the pp chain and CNO cycles

    Energy Technology Data Exchange (ETDEWEB)

    Adelberger, E G; Bemmerer, D; Bertulani, C A; Chen, J -W; Costantini, H; Couder, M; Cyburt, R; Davids, B; Freedman, S J; Gai, M; Garcia, A; Gazit, D; Gialanella, L; Greife, U; Hass, M; Heeger, K; Haxton, W C; Imbriani, G; Itahashi, T; Junghans, A; Kubodera, K; Langanke, K; Leitner, D; Leitner, M; Marcucci, L E; Motobayashi, T; Mukhamedzhanov, A; Nollett, Kenneth M; Nunes, F M; Park, T -S; Parker, P D; Prati, P; Ramsey-Musolf, M J; Hamish Robertson, R G; Schiavilla, R; Simpson, E C; Snover, K A; Spitaleri, C; Strieder, F; Suemmerer, K; Trautvetter, R E; Tribble, R E; Typel, S; Uberseder, E; Vetter, P; Wiescher, M

    2011-04-01

    The available data on nuclear fusion cross sections important to energy generation in the Sun and other hydrogen-burning stars and to solar neutrino production are summarized and critically evaluated. Recommended values and uncertainties are provided for key cross sections, and a recommended spectrum is given for 8B solar neutrinos. Opportunities for further increasing the precision of key rates are also discussed, including new facilities, new experimental techniques, and improvements in theory. This review, which summarizes the conclusions of a workshop held at the Institute for Nuclear Theory, Seattle, in January 2009, is intended as a 10-year update and supplement to 1998, Rev. Mod. Phys. 70, 1265.

  18. Growth and Characterization of Organic Marine Dye Compound: 6-Amino-8α-methoxy-5-methyl-4,7-dioxo-1,1a, 2,4,7,8,8a,8b-octahydroazireno[2',3':3,4] pyrrolo[1,2-α]indol- 8-yl]methyl Carbamate

    OpenAIRE

    Jayandran, M.; Balasubramanian, V.

    2011-01-01

    Single crystals of 6-amino-8α-methoxy-5-methyl-4,7-dioxo-1,1a, 2,4,7,8,8a,8b-octahydroazireno[2',3':3,4]pyrrolo[1,2-α]indol-8-yl]methyl carbamate (Mitomycin), an organic marine dye material has been grown from solution by slow evaporation at ambient temperature. The growth of crystals has been carried out at various pH values and the growth was confirmed at pH 6. The chemical composition of the grown crystals was determined by the FTIR spectra. The crystalline nature and its various planes of...

  19. 15 CFR 8b.20 - Admission and recruitment.

    Science.gov (United States)

    2010-01-01

    ... predictor of success in the education program or activity in question; and (ii) Alternate tests or criteria... exception. When a recipient is taking remedial action to correct the effects of past discrimination pursuant... first year grades, but shall conduct periodic validity studies against the criterion of overall success...

  20. Evaluated cross section libraries

    International Nuclear Information System (INIS)

    Maqurno, B.A.

    1976-01-01

    The dosimetry tape (ENDF/B-IV tape 412) was issued in a general CSEWG distribution, August 1974. The pointwise cross section data file was tested with specified reference spectra. A group averaged cross section data file (620 groups based on tape 412) was tested with the above spectra and the results are presented in this report

  1. Jet inclusive cross sections

    International Nuclear Information System (INIS)

    Del Duca, V.

    1992-11-01

    Minijet production in jet inclusive cross sections at hadron colliders, with large rapidity intervals between the tagged jets, is evaluated by using the BFKL pomeron. We describe the jet inclusive cross section for an arbitrary number of tagged jets, and show that it behaves like a system of coupled pomerons

  2. Flow Cytometry Section

    Data.gov (United States)

    Federal Laboratory Consortium — The primary goal of the Flow Cytometry Section is to provide the services of state-of-the-art multi-parameter cellular analysis and cell sorting for researchers and...

  3. Floodplain Cross Section Lines

    Data.gov (United States)

    Department of Homeland Security — This table is required for any Digital Flood Insurance Rate Map database where cross sections are shown on the Flood Insurance Rate Map (FIRM). Normally any FIRM...

  4. Combustor Section Acoustic Test

    National Research Council Canada - National Science Library

    Swanson, Andrew

    2003-01-01

    .... Following successful coupon and subelement tests on laser welding of Inco 625 heat exchangers, a full-scale scramjet flowpath section was fabricated to more realistically demonstrate the viability of the design concept...

  5. Multitrajectory eikonal cross sections

    International Nuclear Information System (INIS)

    Turner, R.E.

    1983-01-01

    With the use of reference and distorted transition operators, a time-correlation-function representation of the inelastic differential cross section has recently been used to obtain distorted eikonal cross sections. These cross sections involve straight-line and reference classical translational trajectories that are unaffected by any internal-state changes which have occurred during the collision. This distorted eikonal theory is now extended to include effects of internal-state changes on the translational motion. In particular, a different classical trajectory is associated with each pair of internal states. Expressions for these inelastic cross sections are obtained in terms of time-ordered cosine and sine memory functions using the Zwanzig-Feshbach projection-operator method. Explicit formulas are obtained in the time-disordered perturbation approximation

  6. Light Imaging Section

    Data.gov (United States)

    Federal Laboratory Consortium — The mission of the Light Imaging Section is to give NIAMS scientists access to state-of-the-art light imaging equipment and to offer training and assistance at all...

  7. Dosimetry and Calibration Section

    International Nuclear Information System (INIS)

    Otto, T.

    1998-01-01

    The two tasks of the Dosimetry and Calibration Section at CERN are the Individual Dosimetry Service which assures the personal monitoring of about 5000 persons potentially exposed to ionizing radiation at CERN, and the Calibration Laboratory which verifies all the instruments and monitors. This equipment is used by the sections of the RP Group for assuring radiation protection around CERN's accelerators, and by the Environmental Section of TISTE. In addition, nearly 250 electronic and 300 quartz fibre dosimeters, employed in operational dosimetry, are calibrated at least once a year. The Individual Dosimetry Service uses an extended database (INDOS) which contains information about all the individual doses ever received at CERN. For most of 1997 it was operated without the support of a database administrator as the technician who had assured this work retired. The Software Support Section of TIS-TE took over the technical responsibility of the database, but in view of the many other tasks of this Section and the lack of personnel, only a few interventions for solving immediate problems were possible

  8. The Golden Section.

    Science.gov (United States)

    Runion, Garth E.

    The Golden Section, also known as the "Golden Mean" and the "Divine Proportion," is a ratio found in art and nature that has mathematical properties. This book explores these geometric and algebraic properties in a variety of activities. Construction problems, designs using the pentagon and pentagram, and opportunities to work…

  9. ACHP | Section 3

    Science.gov (United States)

    . EO 13287 includes a number of actions that are intended to encourage better accounting, use Section 7 of the EO, the applicable definition of "historic properties" is the one found in the NHPA. Under that definition a "historic property" is "any prehistoric or historic

  10. Operationsteknikker ved section

    DEFF Research Database (Denmark)

    Aabakke, Anna J M; Secher, Niels Jørgen; Krebs, Lone

    2014-01-01

    Caesarean section (CS) is a common surgical procedure, and in Denmark 21% of deliveries is by CS. There is an increasing amount of scientific evidence to support the different surgical techniques used at CS. This article reviews the literature regarding CS techniques. There is still a lack of evi...

  11. 77 FR 60731 - Notice of Applications for Deregistration Under Section 8(f) of the Investment Company Act of 1940

    Science.gov (United States)

    2012-10-04

    .... [File No. 811-802]; Mairs & Power Balanced Fund Inc. [File No. 811-1048] Summary: Each applicant seeks... Parkway, Wilmington, DE 19809. ASGI Mesirow Insight TEI Fund I, LLC [File No. 811-22219]; ASGI Mesirow Insight Fund I, LLC [File No. 811-22220]; ASGI Mesirow Insight Fund A, LLC [File No. 811-22418]; ASGI...

  12. PRES 2012 special section

    DEFF Research Database (Denmark)

    Klemeš, Jiří Jaromír; Varbanov, Petar Sabev; Wang, Qiuwang

    2013-01-01

    This Special Section provides introduction to the 15th Conference Process Integration, Modelling and Optimisation for Energy Saving and Pollution Reduction (PRES 2012). In this editorial introduction, the editors are highlighting the individual articles included in this issue and discussing...... the main points. The main areas of this issue can be summarised as: Process Integration for Energy Saving, Integrating Renewable Energy Sources and Energy Optimisation issues....

  13. Section of mechanized timbering

    Energy Technology Data Exchange (ETDEWEB)

    Balaganskiy, S Ye; Aksanov, Sh I; Ardashev, K A; Mednik, L Ye; Mikhaylov, P G

    1980-09-05

    A section of mechanized timbering is claimed which contains a base, roof timber, hydraulic stand, hydraulic packing cylinders, packing telescopic shield hinged to the roof timber by means of guides. To improve the reliability of forming the filling massif, the packing telescopic shield is made in the form of individual telescopic beams with guards which are interconnected by means of cross beams, while the gaps between the telescopic beams are covered with elasic plates.

  14. Section of LHC beampipe

    CERN Multimedia

    2009-01-01

    A short section of the LHC beampipe including beam screen. Particle beams circulate for around 10 hours in the Large Hadron Collider (LHC). During this time, the particles make four hundred million revolutions of the machine, travelling a distance equivalent to the diameter of the solar system. The beams must travel in a pipe which is emptied of air, to avoid collisions between the particles and air molecules (which are considerably bigger than protons). The beam pipes are pumped down to an air pressure similar to that on the surface of the moon. Emptying the air from the two 27 km long Large Hadron Collider beam-pipes is equivalent in volume to emptying the nave of the Notre Dame cathedral in Paris. Initially, the air pressure is reduced by pumping. Then, cold sections of the beam-pipe are further emptied using the temperature gradient across special beam-screens inside the tube where particles travel. The warm sections are emptied using a coating called a getter that works like molecular fly-paper. This va...

  15. Radar cross section

    CERN Document Server

    Knott, Gene; Tuley, Michael

    2004-01-01

    This is the second edition of the first and foremost book on this subject for self-study, training, and course work. Radar cross section (RCS) is a comparison of two radar signal strengths. One is the strength of the radar beam sweeping over a target, the other is the strength of the reflected echo sensed by the receiver. This book shows how the RCS ?gauge? can be predicted for theoretical objects and how it can be measured for real targets. Predicting RCS is not easy, even for simple objects like spheres or cylinders, but this book explains the two ?exact? forms of theory so well that even a

  16. LEP beampipe section

    CERN Multimedia

    1989-01-01

    Short section of beampipe from the Large Electron Positron collider (LEP, for short). With its 27-kilometre circumference, LEP was the largest electron-positron accelerator ever built and ran from 1989 to 2000 at CERN. During 11 years of research, LEP's experiments provided a detailed study of the electroweak interaction. Measurements performed at LEP also proved that there are three – and only three – generations of particles of matter. LEP was closed down on 2 November 2000 to make way for the construction of the Large Hadron Collider in the same tunnel.

  17. Dosimetry and Calibration Section

    International Nuclear Information System (INIS)

    Otto, T.

    1999-01-01

    The Dosimetry and Calibration Section fulfils two tasks within CERN's Radiation Protection Group: the Individual Dosimetry Service monitors more than 5000 persons potentially exposed to ionizing radiation on the CERN sites, and the Calibration Laboratory verifies throughout the year, at regular intervals, over 1000 instruments, monitors, and electronic dosimeters used by RP Group. The establishment of a Quality Assurance System for the Individual Dosimetry Service, a requirement of the new Swiss Ordinance for personal dosimetry, put a considerable workload on the section. Together with an external consultant it was decided to identify and then describe the different 'processes' of the routine work performed in the dosimetry service. The resulting Quality Manual was submitted to the Federal Office for Public Health in Bern in autumn. The CERN Individual Dosimetry Service will eventually be officially endorsed after a successful technical test in March 1999. On the technical side, the introduction of an automatic development machine for gamma films was very successful. It processes the dosimetric films without an operator being present, and its built-in regeneration mechanism keeps the concentration of the processing chemicals at a constant level

  18. Environmental Impact Section

    International Nuclear Information System (INIS)

    Anon.

    1977-01-01

    The Section is concerned with preparation of environmental statements and assessments and development of assessment methodologies for energy technologies. During 1976, activities involved nuclear, fossil, and geothermal energy; this work was supported by the U.S.Army, HUD, US ERDA, and US NRC. Two special studies--one on the effects of power plant intake structures on fish impingement and another on multiple uses of cooling lakes--were completed and should serve as references for future analyses. Two research projects sponsored by NRC--the Unified Transport Approach (UTA) to Power Plant Assessment and the Environmental Monitoring Data Evaluation Study--were continued. The purpose of the UA program is to develop fast-transient, one- and two-dimensional transport models for estimating thermal, radiological, chemical, and biological impacts in complicated water bodies. The impact of public use of various products that contain radioactive isotope is being evaluated. The Environmental Impact Sections assistance to NRC expanded to include assessments of fuel-fabrication facilities being considered for relicensing and two uranium in-situ solution mining facility proposals. The work for HUD comprises an assessment of the first application of MIUS in a new town development. A generic environmental statement was prepared and an environmental monitoring program for the facility was designed

  19. Section of Atomic Collisions

    International Nuclear Information System (INIS)

    Berenyi, D.; Biri, S.; Gulyas, L.; Juhasz, Z.; Kover, A.; Orban, A.; Palinkas, J.; Papp, T.; Racz, R.; Ricz, S.

    2009-01-01

    The Section of Atomic Collisions is a research unit with extended activity in the field of atomic and molecular physics. Starting from the study of atomic processes at the beamlines of nuclear physics accelerators in the seventies, our research community became one of the centers of fundamental research in Atomki. We also have a strong connection to materials sciences especially along the line of electron and ion spectroscopy methods. Our present activity covers a wide range of topics from atomic collision mechanisms of fundamental interest, to the complex interactions of electrons, ions, photons and antiparticles with atoms, molecules, surfaces, and specific nanostructures. In the last few years, an increasing fraction of our present topics has become relevant for applications, e.g., molecular collision studies for the radiation therapy methods of tumors, or ion-nanostructure interactions for the future construction of small ion-focusing elements. Our section belongs to the Division of Atomic Physics. The other unit of the Division is the Section of Electron Spectroscopy and Materials Sciences. There are traditionally good connections and a strong collaboration between the groups of the two sections in many fields. From the very beginning of our research work in atomic collisions, external collaborations were of vital importance for us. We regularly organize international workshops in the field of fast ion-atom collisions and related small conferences in Debrecen from 1981. Recently, we organized the Conference on Radiation Damage in Biomolecular Systems (RADAM 2008, Debrecen), and coorganized the Conference on Elementary Processes in Atomic Systems (CEPAS 2008, Cluj). We have access to several large scale facilities in Europe within the framework of formal and informal collaborations. The next themes are in this article: Forward electron emission from energetic atomic collisions; Positron-atom collisions; Photon-atom interactions; Interference effects in electron

  20. Heterocycles [h]-Fused Onto 4-Oxoquinoline-3-Carboxylic Acid, Part VIII [1]. Convenient Synthesis and Antimicrobial Properties of Substituted Hexahydro[1,4]diazepino[2,3-h]quinoline-9-carboxylic acid and Its Tetrahydroquino[7,8-b]benzodiazepine Analog

    Directory of Open Access Journals (Sweden)

    Yusuf M. Al-Hiari

    2008-11-01

    Full Text Available [1,4]Diazepino[2,3-h]quinolone carboxylic acid 3 and its benzo-homolog tetrahydroquino[7,8-b]benzodiazepine-3-carboxylic acid 5 were prepared via PPAcatalyzed thermal lactamization of the respective 8-amino-7-substituted-1,4-dihydroquinoline-3-carboxylic acid derivatives 8, 10. The latter compounds were obtained by reduction of their 8-nitro-7-substituted-1,4-dihydroquinoline-3-carboxylic acid precursors 7, 9 which, in turn, were prepared by reaction of 7-chloro-1-cyclopropyl-6-fluoro-8-nitro-1,4-dihydroquinoline-3-carboxylic acid (6 with each of β-alanine and anthranilic acid. All intermediates and target compounds were characterized using elemental analysis, NMR, IR and MS spectral data. The prepared targets and the intermediates have shown interesting antibacterial activity mainly against Gram positive strains. In particular, compound 8 showed good activity against S. aureus (MIC = 0.39 μg/mL and B. subtilis (MIC = 0.78 μg/mL. Compounds 5a and 9 have also displayed good antifungal activity against C. albicans (MIC = 1.56 μg/mL and 0.78 μg/mL, respectively. None of the compounds tested showed any anticancer activity against solid breast cancer cell line MCF-7 cells or a human breast adenocarcinoma cell line.

  1. Radionuclide transverse section imager

    International Nuclear Information System (INIS)

    Stoddart, H.F.

    1980-01-01

    A radioisotope scanning apparatus for use in nuclear medicine is described in detail. The apparatus enables the quantification and spatial location of the radioactivity in a body section of a patient to be determined with high sensitivity. It consists of an array of highly focussed collimators arranged such that adjacent collimators move in the same circumferential but opposite radial directions. The explicit movements of the gantry are described in detail and may be controlled by a general purpose computer. The use of highly focussed collimators allows both a reasonable solid angle of acceptance and also high target to background images; additionally, dual radionuclide pharmaceutical studies can be performed simultaneously. It is claimed that the high sensitivity of the system permits the early diagnosis of pathological changes and the images obtained show accurately the location and shape of physiological abnormalities. (UK)

  2. Radiation and photochemistry section

    International Nuclear Information System (INIS)

    1991-01-01

    The highlights of this past year in the Radiation and Photochemistry Section at Argonne include: (1) picosecond optical studies of radical cations and excited states produced in hydrocarbon radiolysis provided the first kinetic measurements of ion transformation and production of triplet and singlet excited states by ion recombination. (2) studies of radical cations of alkyl-substituted amines and sulfides provided insights into ion-molecule reactions of radical cations in the condensed phase. (3) studies of the behavior of strained alkane radical cations, such as cubane + ·, revealed new rearrangements and remarkable, medium-dependent differences in their structures. (4) H·atom reactions yielding e aq - provided the first reliable measurements of hydrated-electron enthalpy and entropy and forced the revision of some previous thinking about the driving force in aq - reactions

  3. LHC beampipe section

    CERN Multimedia

    A short section of the LHC beam-pipe including beam screen. In the LHC, particles circulate under vacuum. The vacuum chamber can be at room temperature (for example, in the experimental areas), or at cryogenic temperature, in the superconductive magnets. This piece is located in the superconductive magnets. The outer pipe is the vacuum chamber, which is in contact with the magnets, at cryogenic temperature (1.9K). It is called the “cold bore”. The inner tube is the beam screen. Its main goal is to protect the magnets from the heat load coming from the synchrotron radiation. Indeed, when high energy protons’ trajectory is bent, photons are emitted by the beam. They are intercepted by the beam screen. The temperature of the beam screen is kept between 5 and 20K by a circulation of gaseous helium in the small pipes on both sides of the beam screen. As those surfaces are at cryogenic temperature. The residual gas present in the accelerator is sticking on the surfaces. This phenomenon called “adsorption”...

  4. Cancer and Toxicology Section

    International Nuclear Information System (INIS)

    Anon.

    1980-01-01

    The Cancer and Toxicology Section is concerned with the investigation of the mechanisms by which chemicals, radiation, and viruses cause the changes broadly identified as cancer. In addition, the study of mechanisms has been extended to include the nontumorigenic effects of various agents associated with fossil energy and fuels. Research in molecular genetics of carcinogenesis focuses largely on the transposon properties of the genomes of retroviruses. The transposon structure of the DNA genomes of endogenous murine N-tropic and B-tropic type C retroviruses is being elucidated, and their chromosomal location mapped in hamster-mouse cell hybrids. A model of the mechanism of retrovirus induction by radiation and chemicals is being developed, and experiments have established that compounds such as hydroxyurea act as inducer. There is the possibility that transposition of sequences of this endogenous virus may be linked to leukemogenesis. Research in regulation of gene expression aims at defining in molecular terms the mechanisms determining expression of specific genes, how these are regulated by hormones, and the events responsible for dysfunction of gene expression in cancer. In corollary work, a library of cloned cDNAs specific for products of genes of special interest to regulation is being developed. Improvement of reversed-phase chromatography as a means of isolating bacterial plasmids and restriction fragments of DNA is underway. Newly developed techniques permit the isolation of supercoiled plasmid DNA directly from bacterial extracts. The technology has been developed recently for the photosynthetic growth of the chemo-autotrophic organism Rhodospirillum rubrum and the enzyme ribulosebisphosphate carboxylase has been produced in quantity

  5. Section for qualitative methods (Letter)

    OpenAIRE

    Todd, Z.; Madill, A.

    2004-01-01

    Qualitative research methods are increasingly used in all areas of psychology. We have proposed a new Section – the Qualitative Methods in Psychology Section – for anyone with an interest in using these research methods.

  6. NDS multigroup cross section libraries

    International Nuclear Information System (INIS)

    DayDay, N.

    1981-12-01

    A summary description and documentation of the multigroup cross section libraries which exist at the IAEA Nuclear Data Section are given in this report. The libraries listed are available either on tape or in printed form. (author)

  7. 14 CFR Section 4 - General

    Science.gov (United States)

    2010-01-01

    ... UNIFORM SYSTEM OF ACCOUNTS AND REPORTS FOR LARGE CERTIFICATED AIR CARRIERS Balance Sheet Classifications Section 4 General (a) The balance sheet accounts are designed to show the financial condition of the air... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false General Section 4 Section 4 Aeronautics and...

  8. Standard cross-section data

    International Nuclear Information System (INIS)

    Carlson, A.D.

    1984-01-01

    The accuracy of neutron cross-section measurement is limited by the uncertainty in the standard cross-section and the errors associated with using it. Any improvement in the standard immediately improves all cross-section measurements which have been made relative to that standard. Light element, capture and fission standards are discussed. (U.K.)

  9. Cross sections for atmospheric corrections

    International Nuclear Information System (INIS)

    Meyer, J.P.; Casse, M.; Westergaard, N.

    1975-01-01

    A set of cross sections for spallation of relativistic nuclei is proposed based on (i) the best available proton cross sections, (ii) an extrapolation to heavier nuclei of the dependence on the number of nucleons lost of the 'target factor' observed for C 12 and O 16 by Lindstrom et al. (1975), in analogy with Rudstam's formalism, and (iii) on a normalization of all cross sections to the total cross sections for production of fragments with Asub(f) >= 6. The obtained cross sections for peripheral interactions are not inconsistent with simple geometrical considerations. (orig.) [de

  10. Rising rates of Caesarean sections: an audit of Caesarean sections ...

    African Journals Online (AJOL)

    Most of the caesarean sections were carried out because of a previous CS; maternal request and HIV status also contributed to the high rate. Conclusion: The high CS rate in private practice is probably a window to the increased rates of Caesarean section being performed worldwide. This high rate is in keeping with trends ...

  11. Vivitron dead section pumping tests

    International Nuclear Information System (INIS)

    Heugel, J.; Bayet, J.P.; Brandt, C.; Delhomme, C.; Krieg, C.; Kustner, F.; Meiss, R.; Riehl, R.; Roth, C.; Schlewer, B.; Six, P.; Weber, A.

    1990-10-01

    Pumping tests have been conducted on a simulated accelerator dead section. The behavior of different pump types are compared and analyzed. Vacuum conditions to be expected in the Vivitron are reached and several parameters are verified. Selection of a pump for the Vivitron dead section is confirmed

  12. XCOM: Photon Cross Sections Database

    Science.gov (United States)

    SRD 8 XCOM: Photon Cross Sections Database (Web, free access)   A web database is provided which can be used to calculate photon cross sections for scattering, photoelectric absorption and pair production, as well as total attenuation coefficients, for any element, compound or mixture (Z <= 100) at energies from 1 keV to 100 GeV.

  13. Particle sizes from sectional data

    DEFF Research Database (Denmark)

    Pawlas, Zbynek; Nyengaard, Jens Randel; Jensen, Eva Bjørn Vedel

    2009-01-01

    We propose a new statistical method for obtaining information about particle size distributions from sectional data without specific assumptions about particle shape. The method utilizes recent advances in local stereology. We show how to estimate separately from sectional data the variance due t...

  14. Doppler broadening of cross sections

    International Nuclear Information System (INIS)

    Buckler, P.A.C.; Pull, I.C.

    1962-12-01

    Expressions for temperature dependent cross-sections in terms of resonance parameters are obtained, involving generalisations of the conventional Doppler functions, ψ and φ. Descriptions of Fortran sub-routines, which calculate broadened cross-sections in accordance with the derived formulae, are included. (author)

  15. Photon-splitting cross sections

    International Nuclear Information System (INIS)

    Johannessen, A.M.; Mork, K.J.; Overbo, I.

    1980-01-01

    The differential cross section for photon splitting (scattering of one photon into two photons) in a Coulomb field, obtained earlier by Shima, has been integrated numerically to yield various differential cross sections. Energy spectra differential with respect to the energy of one of the outgoing photons are presented for several values of the primary photon energy. Selected examples of recoil momentum distributions and some interesting doubly or multiply differential cross sections are also given. Values for the total cross section are obtained essentially for all energies. The screening effect caused by atomic electrons is also taken into account, and is found to be important for high energies, as in e + e - pair production. Comparisons with various approximate results obtained by previous authors mostly show fair agreement. We also discuss the possibilities for experimental detection and find the most promising candidate to be a measurement of both photons, and their energies, at a moderately high energy

  16. Scar Endometriosis Following Cesarean Section

    Directory of Open Access Journals (Sweden)

    Rüya Deveer

    2012-04-01

    CONCLUSION: Abdominal wall endometriosis frequently presents with cyclical pain during menstruation which is localised to a palpable mass in the abdominal wall especially in those who have had previous cesarean section. Complete surgical excision is curative.

  17. Multifamily Assistance Section 8 Contracts

    Data.gov (United States)

    Department of Housing and Urban Development — he information regarding the Multifamily Assistance and Section 8 contracts, and properties is being furnished for the convenience of interested parties. The...

  18. Low Energy Neutrino Cross Sections

    International Nuclear Information System (INIS)

    Zeller, G.P.

    2004-01-01

    Present atmospheric and accelerator based neutrino oscillation experiments operate at low neutrino energies (Ev ∼ 1 GeV) to access the relevant regions of oscillation parameter space. As such, they require precise knowledge of the cross sections for neutrino-nucleon interactions in the sub-to-few GeV range. At these energies, neutrinos predominantly interact via quasi-elastic (QE) or single pion production processes, which historically have not been as well studied as the deep inelastic scattering reactions that dominate at higher energies.Data on low energy neutrino cross sections come mainly from bubble chamber, spark chamber, and emulsion experiments that collected their data decades ago. Despite relatively poor statistics and large neutrino flux uncertainties, these measurements provide an important and necessary constraint on Monte Carlo models in present use. The following sections discuss the current status of QE, resonant single pion, coherent pion, and single kaon production cross section measurements at low energy

  19. Neutron Cross Sections for Aluminium

    Energy Technology Data Exchange (ETDEWEB)

    Forsberg, Leif

    1963-08-15

    Total, elastic, inelastic, (n, 2n), (n, {alpha}), (n, p), and (n, {gamma}) cross sections for aluminium have been compiled from thermal to 100 MeV based upon literature search and theoretical interpolations and estimates. Differential elastic cross sections in the centre of mass system are represented by the Legendre coefficients. This method was chosen in order to obtain the best description of the energy dependence of the anisotropy.

  20. Accurate Cross Sections for Microanalysis

    OpenAIRE

    Rez, Peter

    2002-01-01

    To calculate the intensity of x-ray emission in electron beam microanalysis requires a knowledge of the energy distribution of the electrons in the solid, the energy variation of the ionization cross section of the relevant subshell, the fraction of ionizations events producing x rays of interest and the absorption coefficient of the x rays on the path to the detector. The theoretical predictions and experimental data available for ionization cross sections are limited mainly to K shells of a...

  1. VBAC (Vaginal Birth After C-Section)

    Science.gov (United States)

    Vaginal birth after C-section (VBAC) Overview If you've delivered a baby by C-section and ... between scheduling a repeat C-section or attempting vaginal birth after C-section (VBAC). For many women, ...

  2. The Levy sections theorem revisited

    International Nuclear Information System (INIS)

    Figueiredo, Annibal; Gleria, Iram; Matsushita, Raul; Silva, Sergio Da

    2007-01-01

    This paper revisits the Levy sections theorem. We extend the scope of the theorem to time series and apply it to historical daily returns of selected dollar exchange rates. The elevated kurtosis usually observed in such series is then explained by their volatility patterns. And the duration of exchange rate pegs explains the extra elevated kurtosis in the exchange rates of emerging markets. In the end, our extension of the theorem provides an approach that is simpler than the more common explicit modelling of fat tails and dependence. Our main purpose is to build up a technique based on the sections that allows one to artificially remove the fat tails and dependence present in a data set. By analysing data through the lenses of the Levy sections theorem one can find common patterns in otherwise very different data sets

  3. The Levy sections theorem revisited

    Science.gov (United States)

    Figueiredo, Annibal; Gleria, Iram; Matsushita, Raul; Da Silva, Sergio

    2007-06-01

    This paper revisits the Levy sections theorem. We extend the scope of the theorem to time series and apply it to historical daily returns of selected dollar exchange rates. The elevated kurtosis usually observed in such series is then explained by their volatility patterns. And the duration of exchange rate pegs explains the extra elevated kurtosis in the exchange rates of emerging markets. In the end, our extension of the theorem provides an approach that is simpler than the more common explicit modelling of fat tails and dependence. Our main purpose is to build up a technique based on the sections that allows one to artificially remove the fat tails and dependence present in a data set. By analysing data through the lenses of the Levy sections theorem one can find common patterns in otherwise very different data sets.

  4. Transition section for acoustic waveguides

    International Nuclear Information System (INIS)

    Karplus, H.H.B.

    1975-01-01

    A means of facilitating the transmission of acoustic waves with minimal reflection between two regions having different specific acoustic impedances is described comprising a region exhibiting a constant product of cross-sectional area and specific acoustic impedance at each cross-sectional plane along the axis of the transition region. A variety of structures that exhibit this feature is disclosed, the preferred embodiment comprising a nested structure of doubly reentrant cones. This structure is useful for monitoring the operation of nuclear reactors in which random acoustic signals are generated in the course of operation

  5. Three-section expiratory CT

    DEFF Research Database (Denmark)

    Loeve, Martine; de Bruijne, Marleen; Hartmann, Ieneke C. J.

    2012-01-01

    . Longitudinal follow-up was performed with three sections. All images were deidentified and randomized, and TA was scored with the Brody II system and a new quantitative system. Statistical analysis included the Wilcoxon signed rank test, calculation of Spearman and intraclass correlation coefficients, and use......Purpose: To estimate the effect of the number of computed tomography (CT) sections on trapped air (TA) assessment in patients with cystic fibrosis (CF) by using an established scoring system and a new quantitative scoring system and to compare CT and pulmonary function test (PFT) estimates of TA...

  6. Terahertz radar cross section measurements

    DEFF Research Database (Denmark)

    Iwaszczuk, Krzysztof; Heiselberg, Henning; Jepsen, Peter Uhd

    2010-01-01

    We perform angle- and frequency-resolved radar cross section (RCS) measurements on objects at terahertz frequencies. Our RCS measurements are performed on a scale model aircraft of size 5-10 cm in polar and azimuthal configurations, and correspond closely to RCS measurements with conventional radar...

  7. Pion-nucleus cross sections

    International Nuclear Information System (INIS)

    Barashenkov, V.S.

    1990-01-01

    The tables of inelastic and total cross sections of π ± mesons interactions with nuclei 4 He- 238 U are presented. The tables are obtained by theoretical analysis of known experimental data for energies higher some tens of MeV. 1 ref.; 1 tab

  8. PLANNING VESSEL BODY SECTION PRODUCTION

    Directory of Open Access Journals (Sweden)

    A. G. Grivachevsky

    2015-01-01

    Full Text Available A problem of planning production of a vessel body section is considered. The problem is reduced to the classic Johnson’s tree-machine flow-shop scheduling problem. A genetic algorithm and computer experiment to compare efficiency of this algorithm and the algorithm of full enumeration are described.

  9. Caesarean section and anaesthetic mortality

    African Journals Online (AJOL)

    Southern African Journal of Anaesthesia and Analgesia is co-published by Medpharm Publications, NISC (Pty) Ltd and Cogent, Taylor & Francis Group. LETTER TO THE EDITOR. Caesarean section and ... births there are 3.1 maternal deaths,2 13 neonatal deaths, 28 infantile deaths and 40 deaths under the age of 5 ...

  10. 24 CFR 882.123 - Conversion of Section 23 Units to Section 8 and Section 23 monitoring.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Conversion of Section 23 Units to... Applicability, Scope and Basic Policies § 882.123 Conversion of Section 23 Units to Section 8 and Section 23 monitoring. (a)-(d) [Reserved] (e) Section 23 policies for units planned for conversion on or before...

  11. Neutron cross sections for fusion

    International Nuclear Information System (INIS)

    Haight, R.C.

    1979-10-01

    First generation fusion reactors will most likely be based on the 3 H(d,n) 4 He reaction, which produces 14-MeV neutrons. In these reactors, both the number of neutrons and the average neutron energy will be significantly higher than for fission reactors of the same power. Accurate neutron cross section data are therefore of great importance. They are needed in present conceptual designs to calculate neutron transport, energy deposition, nuclear transmutation including tritium breeding and activation, and radiation damage. They are also needed for the interpretation of radiation damage experiments, some of which use neutrons up to 40 MeV. In addition, certain diagnostic measurements of plasma experiments require nuclear cross sections. The quality of currently available data for these applications will be reviewed and current experimental programs will be outlined. The utility of nuclear models to provide these data also will be discussed. 65 references

  12. Maternal mortality following caesarean sections.

    Science.gov (United States)

    Sikdar, K; Kundu, S; Mandal, G S

    1979-08-01

    A study of 26 maternal deaths following 3647 caesarean sections was conducted in Eden Hospital from 1974-1977. During the time period there were 35,544 births and 308 total maternal deaths (8.74/1000). Indications for Caesarean sections included: 1) abnormal presentation; 2) cephalopelvic disproportion; 3) toxemia; 4) prolonged labor; 5) fetal distress; and 6) post-caesarean pregnancies. Highest mortality rates were among cephalopelvic disproportion, toxemia, and prolonged labor patients. 38.4% of the patients died due to septicaemia and peritonitis, but other deaths were due to preclampsia, shock, and hemorrhage. Proper antenatal care may have prevented anemia and preclampsia and treated other pre-existing or superimposed diseases.

  13. Transverse section radionuclide scanning system

    International Nuclear Information System (INIS)

    Kuhl, D.E.; Edwards, R.Q.

    1976-01-01

    This invention provides a transverse section radionuclide scanning system for high-sensitivity quantification of brain radioactivity in cross-section picture format in order to permit accurate assessment of regional brain function localized in three dimensions. High sensitivity crucially depends on overcoming the heretofore known raster type scanning, which requires back and forth detector movement involving dead-time or partial enclosure of the scan field. Accordingly, this invention provides a detector array having no back and forth movement by interlaced detectors that enclose the scan field and rotate as an integral unit around one axis of rotation in a slip ring that continuously transmits the detector data by means of laser emitting diodes, with the advantages that increased amounts of data can be continuously collected, processed and displayed with increased sensitivity according to a suitable computer program. 5 claims, 11 figures

  14. [Caesarean section and anal incontinence].

    Science.gov (United States)

    Kalis, V; Stipán, J; Chaloupka, P; Karbanová, J; Rokyta, Z

    2008-04-01

    Summary of the impact of Caesarean section on anal incontinence. Review. Department of Gynaecology and Obstetrics, Charles University and University Hospital Plzen. Review of the current international literature. Currently, Caesarean section is not considered to reduce symptoms of anal incontinence. If there is any reduction of symptoms, that remains only for a short term (40% in 3 months after the delivery in the largest trial). In a long term, virtually in no trial has been observed any difference, and others, non-obstetrical factors (particularly aging) prevail. Current knowledge does not allow to assess sufficiently pros and cons of Caesarean compared to vaginal delivery. High risk groups, that would profit from elective Ceasarean, have not been clearly identified yet.

  15. Reactor-vessel-sectioning demonstration

    International Nuclear Information System (INIS)

    Lundgren, R.A.

    1981-07-01

    A successful technical demonstration of simulated reactor vessel sectioning was completed using the combined techniques of air arc gouging and flame cutting. A 4-ft x 3-ft x 9-in. thick sample was fabricated of A36 carbon steel to simulate a reactor vessel wall. A 1/4-in layer of stainless steel (SS) was tungsten inert gas (TIG)-welded to the carbon steel. Several techniques were considered to section the simulated reactor vessel: an air arc gouger was chosen to penetrate the stainless steel, and flame cutting was selected to sever the carbon steel. After the simulated vessel was successfully cut from the SS side, another cut was made, starting from the carbon steel side. This cut was also successful. Cutting from the carbon steel side has the advantages of cost reduction since the air arc gouging step is eliminated and contamination controlled because the molten metal is blown inward

  16. Negative ion detachment cross sections

    International Nuclear Information System (INIS)

    Champion, R.L.; Doverspike, L.D.

    1992-10-01

    The authors have measured absolute cross sections for electron detachment and charge exchange for collision of O and S with atomic hydrogen, have investigated the sputtering and photodesorption of negative ions from gas covered surfaces, and have begun an investigation of photon-induced field emission of electrons from exotic structures. Brief descriptions of these activities as well as future plans for these projects are given below

  17. Microscopic cross sections: An utopia?

    Energy Technology Data Exchange (ETDEWEB)

    Hilaire, S. [CEA Bruyeres-le-Chatel, DIF 91 (France); Koning, A.J. [Nuclear Research and Consultancy Group, PO Box 25, 1755 ZG Petten (Netherlands); Goriely, S. [Institut d' Astronomie et d' Astrophysique, Universite Libre de Bruxelles, Campus de la Plaine, CP 226, 1050 Brussels (Belgium)

    2010-07-01

    The increasing need for cross sections far from the valley of stability poses a challenge for nuclear reaction models. So far, predictions of cross sections have relied on more or less phenomenological approaches, depending on parameters adjusted to available experimental data or deduced from systematical relations. While such predictions are expected to be reliable for nuclei not too far from the experimentally known regions, it is clearly preferable to use more fundamental approaches, based on sound physical bases, when dealing with very exotic nuclei. Thanks to the high computer power available today, all major ingredients required to model a nuclear reaction can now be (and have been) microscopically (or semi-microscopically) determined starting from the information provided by a nucleon-nucleon effective interaction. We have implemented all these microscopic ingredients in the TALYS nuclear reaction code, and we are now almost able to perform fully microscopic cross section calculations. The quality of these ingredients and the impact of using them instead of the usually adopted phenomenological parameters will be discussed. (authors)

  18. Microscopic cross sections: An utopia?

    International Nuclear Information System (INIS)

    Hilaire, S.; Koning, A.J.; Goriely, S.

    2010-01-01

    The increasing need for cross sections far from the valley of stability poses a challenge for nuclear reaction models. So far, predictions of cross sections have relied on more or less phenomenological approaches, depending on parameters adjusted to available experimental data or deduced from systematical relations.While such predictions are expected to be reliable for nuclei not too far from the experimentally known regions, it is clearly preferable to use more fundamental approaches, based on sound physical bases, when dealing with very exotic nuclei. Thanks to the high computer power available today, all major ingredients required to model a nuclear reaction can now be (and have been) microscopically (or semi-microscopically) determined starting from the information provided by a nucleon-nucleon effective interaction. We have implemented all these microscopic ingredients in the TALYS nuclear reaction code, and we are now almost able to perform fully microscopic cross section calculations. The quality of these ingredients and the impact of using them instead of the usually adopted phenomenological parameters will be discussed. (authors)

  19. Progress report : Plasma Physics Section

    International Nuclear Information System (INIS)

    Iyyengar, S.K.; Rohatgi, V.K.

    1975-08-01

    The activities of the plasma physics section of the Bhabha Atomic Research Centre, India over the last five years (1970-75) are reported. The R and D programme of the section has been divided into four cells mainly i.e., (i) Thermal plasma (ii) Relativistic Electron Beam (iii) Energetics and (iv) Electron beam technology. The salient features of the development activities carried out in these cells are outlined. In the Thermal plasma group, considerable research work has been done in (a) fundamental plasma studies, (b) industrial plasma technology and (c) open cycle MHD power generation project. The relativistic electron beam group is engaged in improving the technology to realize high power lasers, and pulsed thermonuclear fusion. The energetics programme is oriented to develop high voltage d.c. generators and pulse generators. The electron beam techniques developed here are routinely used for melting refractory and reactive metals. The technical know-how of the welding machines developed has been transfered to industries. Equipment developed by this section, such as, (1) electron beam furnace, (2) plasma cutting torch, (3) impulse magnet charger etc. are listed. (A.K.)

  20. Reactor-vessel-sectioning demonstration

    International Nuclear Information System (INIS)

    Lundgren, R.A.

    1981-09-01

    A technical demonstration was successfully completed of simulated reactor vessel sectioning using the combined techniques of air arc gouging and flame cutting. A 4-ft x 3-ft x 9-in. thick sample was fabricated of A36 carbon steel to simulate a reactor vessel wall. A 1/4-in. layer of stainless steel (SS) was tungsten inert gas (TIG)-welded to the carbon steel. Several techniques were considered to section the simulated reactor vessel; air arc gouging was selected to penetrate the stainless steel, and flame cutting was selected to sever the carbon steel. Three sectioning operations were demonstrated. For all three, the operating parameters were the same; but the position of the sample was varied. For the first cut, the sample was placed in a horizontal position, and it was successfully severed from the SS side. For the second cut, the sample was turned over and cut from the carbon steel side. Cutting from the carbon steel side has the advantages of cost reduction

  1. Turbine airfoil having outboard and inboard sections

    Science.gov (United States)

    Mazzola, Stefan; Marra, John J

    2015-03-17

    A turbine airfoil usable in a turbine engine and formed from at least an outboard section and an inboard section such that an inner end of the outboard section is attached to an outer end of the inboard section. The outboard section may be configured to provide a tip having adequate thickness and may extend radially inward from the tip with a generally constant cross-sectional area. The inboard section may be configured with a tapered cross-sectional area to support the outboard section.

  2. 14 CFR Section 2 - General Accounting Policies

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false General Accounting Policies Section 2 Section 2 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION... General Accounting Provisions Section 2 General Accounting Policies ...

  3. [Fast neutron cross section measurements

    International Nuclear Information System (INIS)

    1991-01-01

    In the 14 MeV Neutron Laboratory, we have continued the development of a facility that is now the only one of its kind in operation in the United States. We have refined the klystron bunching system described in last year's report to the point that 1.2 nanosecond pulses have been directly measured. We have tested the pulse shape discrimination capability of our primary NE 213 neutron detector. We have converted the RF sweeper section of the beamline to a frequency of 1 MHz to replace the function of the high voltage pulser described in last year's report which proved to be difficult to maintain and unreliable in its operation. We have also overcome several other significant experimental difficulties, including a major problem with a vacuum leak in the main accelerator column. We have completed additional testing to prove the remainder of the generation and measurement systems, but overcoming some of these experimental difficulties has delayed the start of actual data taking. We are now in a position to begin our first series of ring geometry elastic scattering measurements, and these will be underway before the end of the current contract year. As part of our longer term planning, we are continuing the conceptual analysis of several schemes to improve the intensity of our current pulsed beam. These include the provision of a duoplasmatron ion source and/or the provision of preacceleration bunching. Additional details are given later in this report. A series of measurements were carried out at the Tandem Dynamatron Facility involving the irradiation of a series of yttrium foils and the determination of activation cross sections using absolute counting techniques. The experimental work has been completed, and final analysis of the cross section data will be completed within several months

  4. Vacuum Chambers for LEP sections

    CERN Multimedia

    1983-01-01

    The picture shows sections of the LEP vacuum chambers to be installed in the dipole magnets (left) and in the quadrupoles (right). The dipole chamber has three channels: the beam chamber, the pumping duct where the NEG (non-evaporabe getter) is installed and the water channel for cooling (on top in the picture). The pumping duct is connected to the beam chamber through holes in the separating wall. The thick lead lining to shield radiation can also be seen. These chambers were manufactured as extruded aluminium alloy profiles.

  5. Ultrathin sectioning for electron microscopy

    DEFF Research Database (Denmark)

    Rostgaard, Jørgen; Qvortrup, K

    1989-01-01

    During an electron microscopical study of the localization of the nucleoside diphosphatase IDPase in Reissner's membrane of the inner ear, it was discovered that the distilled water in the knife trough produced an annoying artefact. It dissolved all the lead phosphate reaction product from...... the sections, and thus converted a positive phosphatase reactivity to a false negative one. The water in the knife trough had a pH of approximately 5.4. Calculations showed that this is an expected acidity, if CO2 in the air equilibrates with distilled water, and that there is 200,000 times more acid...

  6. Activities of Radiation Standard Section

    International Nuclear Information System (INIS)

    Kannan, A.; Rao, P.S.; Sachadev, R.N.; Shaha, V.V.; Sharma, D.; Srivastava, P.K.

    1992-01-01

    A brief account of the various facilities and services provided by the Radiation Standards Section (RSS) of the Bhabha Atomic Research Centre, Bombay is given. RSS maintains the primary and secondary standards of various parameters of radiation measurements. It ensures accurate radiological measurements as per international requirements, through periodic international intercomparisons of national standards. It also provides calibration services to various users of radiation sources and instruments. The activities of RSS are described under the headings: (1) Radiological Metrology Standards, (2) Radionuclide Standards, Neutron Metrology, (4) Instruments Calibration, (5) Non-ionizing Radiations, and (6) Instrumentation. (author). figs., tabs

  7. Nuclear Data Section status report

    International Nuclear Information System (INIS)

    Muir, D.; Pronyaev, V.G.

    2001-01-01

    This report summarises the Nuclear Structure and Decay Data (NSDD) related activity of the IAEA Nuclear Data Section (NDS) for the period October 1998 to September 2000. It covers both online NSDD user service either Telnet or Web services, and offline NSDD service. The NSDD development programs and projects are related to NDS contribution to the IAEA Analytical Quality Control Services program, Coordinated Research Project on nuclear model parameter testing for nuclear data evaluation, Coordinated Research Project on updating of x-ray and gamma-ray decay data standards for detector calibration, and Coordinated Research Project on development of database for prompt gamma-neutron activation analysis

  8. Wind Turbine Radar Cross Section

    Directory of Open Access Journals (Sweden)

    David Jenn

    2012-01-01

    Full Text Available The radar cross section (RCS of a wind turbine is a figure of merit for assessing its effect on the performance of electronic systems. In this paper, the fundamental equations for estimating the wind turbine clutter signal in radar and communication systems are presented. Methods of RCS prediction are summarized, citing their advantages and disadvantages. Bistatic and monostatic RCS patterns for two wind turbine configurations, a horizontal axis three-blade design and a vertical axis helical design, are shown. The unique electromagnetic scattering features, the effect of materials, and methods of mitigating wind turbine clutter are also discussed.

  9. Entropy and transverse section reconstruction

    International Nuclear Information System (INIS)

    Gullberg, G.T.

    1976-01-01

    A new approach to the reconstruction of a transverse section using projection data from multiple views incorporates the concept of maximum entropy. The principle of maximizing information entropy embodies the assurance of minimizing bias or prejudice in the reconstruction. Using maximum entropy is a necessary condition for the reconstructed image. This entropy criterion is most appropriate for 3-D reconstruction of objects from projections where the system is underdetermined or the data are limited statistically. This is the case in nuclear medicine time limitations in patient studies do not yield sufficient projections

  10. Parkways und Freeways in der Bestimmung der Landschaft der Amerikanischen Grossstaedte. Der Fall Boston.

    Directory of Open Access Journals (Sweden)

    Massimo Maria Brignoli

    2012-08-01

    Full Text Available Die Tradition der amerikanischen Landschaftarchitektur hatt aus Boston ein Planungsexperiment gemacht. Das Emerald Necklace, eine echte Ikone der Landschaftsarchitektur, bezeugt immer noch wirkungsvoll, wie die Landschaftsplanung die Struktur moderner Grossstaedte mit Raum zum wohnen staerken kann. Heute muss die Stadt mit ihren von der Central Artery hervorgerufenen Wunden fertigwerden, mit Risultaten, die wahrscheinlich nicht der Groesse ihrer Geschichte entsprechen. Der teilweise Erfolg der Rose Kennedy Greenway macht die Notwendigkeit klar, die Regelung fuer die Planung der offenen Gebiete neu zu bestimmen.

  11. K+ nucleus total cross sections

    International Nuclear Information System (INIS)

    Sawafta, R.

    1990-01-01

    The scattering of K + mesons from nuclei has attracted considerable interest in the last few years. The K + holds a very special position as the weakest of all strongly interaction probes. The average cross section is not larger than about 10 mb at lab momenta below 800 MeV/c, corresponding to a mean free path in the nucleus larger than 5 fm. Thus the K + is capable of probing the entire volume of the nucleus. Single scattering of the K + with a nucleon in the nucleus dominates the nuclear scattering, and only small and calculable higher order corrections are needed. The nucleon is a dynamical entity and its internal structure can, in principle, be altered by its surrounding nuclear environment. This work reports an experiment in which the K + is used to compare the nucleon in the nucleus with a free nucleon

  12. Terahertz radar cross section measurements.

    Science.gov (United States)

    Iwaszczuk, Krzysztof; Heiselberg, Henning; Jepsen, Peter Uhd

    2010-12-06

    We perform angle- and frequency-resolved radar cross section (RCS) measurements on objects at terahertz frequencies. Our RCS measurements are performed on a scale model aircraft of size 5-10 cm in polar and azimuthal configurations, and correspond closely to RCS measurements with conventional radar on full-size objects. The measurements are performed in a terahertz time-domain system with freely propagating terahertz pulses generated by tilted pulse front excitation of lithium niobate crystals and measured with sub-picosecond time resolution. The application of a time domain system provides ranging information and also allows for identification of scattering points such as weaponry attached to the aircraft. The shapes of the models and positions of reflecting parts are retrieved by the filtered back projection algorithm.

  13. [Fast neutron cross section measurements

    International Nuclear Information System (INIS)

    Knoll, G.F.

    1992-01-01

    From its inception, the Nuclear Data Project at the University of Michigan has concentrated on two major objectives: (1) to carry out carefully controlled nuclear measurements of the highest possible reliability in support of the national nuclear data program, and (2) to provide an educational opportunity for students with interests in experimental nuclear science. The project has undergone a successful transition from a primary dependence on our photoneutron laboratory to one in which our current research is entirely based on a unique pulsed 14 MeV fast neutron facility. The new experimental facility is unique in its ability to provide nanosecond bursts of 14 MeV neutrons under conditions that are ''clean'' and as scatter-free as possible, and is the only one of its type currently in operation in the United States. It has been designed and put into operation primarily by graduate students, and has met or exceeded all of its important initial performance goals. We have reached the point of its routine operation, and most of the data are now in hand that will serve as the basis for the first two doctoral dissertations to be written by participating graduate students. Our initial results on double differential neutron cross sections will be presented at the May 1993 Fusion Reactor Technology Workshop. We are pleased to report that, after investing several years in equipment assembly and optimization, the project has now entered its ''data production'' phase

  14. Accelerator Physics Section progress report

    International Nuclear Information System (INIS)

    Coote, G.E.

    1986-05-01

    This report summarizes the work of the Accelerator Physics Section of the Institute of Nuclear Sciences during the period January-December 1985. Applications of the EN-tandem accelerator included 13 N production for tracer experiments in plants and animals, hydrogen profiling with a 19 F beam and direct detection of heavy ions with a surface barrier detector. Preparations for accelerator mass spectrometry continued steadily, with the commissioning of the pulsed EHT supply which selects the isotope to be accelerated, routine detection of 14 C ions, and completion of a sputter ion source with an eight position target wheel. It was shown that the hydrogen content of a material could be derived from a simultaneous measurement of the transmission of neutrons and gamma rays from a neutron source or accelerator target. The 11 CO 2 produced at the 3 MV accelerator was used in two studies of translocation in a large number of plant species: the effects of small quantities of SO 2 in the air, and the effect of cooling a short length of the stem. The nuclear microprobe was applied to studies of carbon pickup during welding of stainless steel, determination of trace elements in soil and vegetation and the measurement of sodium depth profiles in obsidian - in particular the effect of rastering the incident proton beams

  15. Mammalian Genetics and Teratology Section

    International Nuclear Information System (INIS)

    Anon.

    1980-01-01

    The work of the Mammalian Genetics and Teratology Section includes research in mutagenesis, basic genetics, reproductive biology, and teratogenesis involving basic studies, method development, including exploration of the biological material, and testing. The basic studies make good use of the genetic material accumulated in mutagenesis experiments of various kinds, or of the findings of mutagenesis experiments themselves. In the latter category is the finding of a repair system in the fertilized egg. The genetics of repair competency or deficiency are now under study. A linear relationship between gene dosage and level of expression of an enzyme has been demonstrated. Opportunities for the study of gene action are provided by a number of X-autosome translocations which continue to be discovered in the course of mutagenesis experiments. In these rearrangements, X-chromosome inactivation extends to neighboring autosomal loci. Considerable progress has been made in developing the skeletal mutation system, which provides information on dominants that is highly useful for risk assessment. A sensitive-indicator test is now under development which will make the screening for skeletal mutations much faster and easier. Method development has also progressed on the in vivo somatic-mutation test now being widely used as an in vivo screen for mutagens. Another method developed here is the numerical sex-chromosome anomaly (NSA) test for nondisjunction. The NSA method is being used to explore the effects of female age on chromosome loss and nondisjunction. A model for estimating the misclassification error was experimentally established for the heritable translocation test. A rapid, easy, and sensitive in vivo screening test for teratogenesis was developed. An in vitro teratogenic prescreen being developed makes use of teratocarcinoma-derived cell lines

  16. Introduction to the Special Section

    Directory of Open Access Journals (Sweden)

    Terry-Ann Jones

    2015-08-01

    Full Text Available Several theories of international migration have emerged to explain and predict the patterns created by the international flows of people. While used as an explanatory tool for other sociological phenomena, world-systems analysis has also emerged as a dominant paradigm through which international migration may be explored. In April 2008 Fairfield University in Fairfield, CT hosted the thirty-second annual conference of the Political Economy of the World-System section of the American Sociological Association. The theme was Flow of People and Money across the World-System: Past, Present and Future. The collection of papers presented at this conference was academically rich and produced a wealth of scholarship, some of which is presented in this issue. Vernengo and Bradbury examine the risks associated with dollarization in Ecuador, arguing that although these risks are minimized by the influx of migrant remittances into the country, the trend remains unstable and unsustainable, as was evident in Argentina. Rocha deconstructs the optimistic visions that present remittances as an opportunity for developing countries, instead arguing that they are part and parcel of a process of economic imperialism. Dick and Jorgenson focus on environmental consequences of foreign investment dependence for less-developed countries and how various types of ecological degradation can contribute to mass migration. Kentor, Sobel and Timberlake discuss the hierarchy of global cities through which so much money flows back and forth, and specifically the spatiality of inter-corporate integration in the global economy such as the spatial distribution of intra-firm corporate headquarter-subsidiary networks operations and centrality in transportation networks. Lastly, Degirmen presents a case study of globalization of capital in Turkey and how interest and exchange rate shocks produced particularly interesting effects on capital and liquidity structures.

  17. Vaginal birth after C-section

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/patientinstructions/000589.htm Vaginal birth after C-section To use the sharing ... the same way again. Many women can have vaginal deliveries after having a C-section in the ...

  18. Section Level Public Land Survey - polygons

    Data.gov (United States)

    Minnesota Department of Natural Resources — Public Land Survey line delineations to the section level. Data are derived primarily from Section corner locations captured from paper USGS seven and one-half...

  19. Special Section on Coloured Petri Nets

    DEFF Research Database (Denmark)

    1998-01-01

    Special section on coloured Petri nets, their basic concepts, analysis methods, tool support and industrial applications.......Special section on coloured Petri nets, their basic concepts, analysis methods, tool support and industrial applications....

  20. Section Level Public Land Survey - lines

    Data.gov (United States)

    Minnesota Department of Natural Resources — Public Land Survey line delineations to the section level. Developed from manually digitized section corners captured from paper USGS seven and one-half map sources.

  1. Neutron cross sections: Book of curves

    International Nuclear Information System (INIS)

    McLane, V.; Dunford, C.L.; Rose, P.F.

    1988-01-01

    Neuton Cross Sections: Book of Curves represents the fourth edition of what was previously known as BNL-325, Neutron Cross Sections, Volume 2, CURVES. Data is presented only for (i.e., intergrated) reaction cross sections (and related fission parameters) as a function of incident-neutron energy for the energy range 0.01 eV to 200 MeV. For the first time, isometric state production cross sections have been included. 11 refs., 4 figs

  2. Nuclear Forensics and Radiochemistry: Cross Sections

    Energy Technology Data Exchange (ETDEWEB)

    Rundberg, Robert S. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-11-08

    The neutron activation of components in a nuclear device can provide useful signatures of weapon design or sophistication. This lecture will cover some of the basics of neutron reaction cross sections. Nuclear reactor cross sections will also be presented to illustrate the complexity of convolving neutron energy spectra with nuclear excitation functions to calculate useful effective reactor cross sections. Deficiencies in the nuclear database will be discussed along with tools available at Los Alamos to provide new neutron cross section data.

  3. JENDL gas-production cross section file

    International Nuclear Information System (INIS)

    Nakagawa, Tsuneo; Narita, Tsutomu

    1992-05-01

    The JENDL gas-production cross section file was compiled by taking cross-section data from JENDL-3 and by using the ENDF-5 format. The data were given to 23 nuclei or elements in light nuclei and structural materials. Graphs of the cross sections and brief description on their evaluation methods are given in this report. (author)

  4. 46 CFR Section 1 - Books of account.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Books of account. Section 1 Section 1 Shipping MARITIME... TRANSACTIONS UNDER AGENCY AGREEMENTS Accounts Section 1 Books of account. A separate set of books of account... agreement. The books of original entry and ledgers may be similar in design to those heretofore employed by...

  5. Integral nucleus-nucleus cross sections

    International Nuclear Information System (INIS)

    Barashenkov, V.S.; Kumawat, H.

    2003-01-01

    Expressions approximating the experimental integral cross sections for elastic and inelastic interactions of light and heavy nuclei at the energies up to several GeV/nucleon are presented. The calculated cross sections are inside the corridor of experimental errors or very close to it. Described in detail FORTRAN code and a numerical example of the cross section approximation are also presented

  6. 17 CFR 270.8b-12 - Requirements as to paper, printing and language.

    Science.gov (United States)

    2010-04-01

    ... and font, bold-face type, italics and red ink, by presenting all required information in a format... and other tabular data included therein shall be in roman type at least as large as 10-point modern type. However, to the extent necessary for convenient presentation, financial statements and other...

  7. Electronic structure, Fermi surface and optical properties of metallic compound Be8(B48)B2

    International Nuclear Information System (INIS)

    Reshak, A.H.; Azam, Sikander; Alahmed, Z.A.; Chyský, Jan

    2014-01-01

    The band structure, density of states, electronic charge density, Fermi surface and optical properties for B 8 (Be 48 )B 2 compound has been investigated in the support of density functional theory (DFT). The atomic positions of B 8 (Be 48 )B 2 compound were optimized by minimization of the forces acting on the atoms using the full potential linear augmented plane wave (FPLAPW) method. We have employed the local density approximation (LDA), generalized gradient approximation (GGA) and Engal-Vosko GGA (EVGGA) to indulgence the exchange correlation potential by solving Kohn–Sham equations. The result shows that the compound is metallic with sturdy hybridization near the Fermi energy level (E F ). The density of states at Fermi energy, N(E F ), is determined by the overlaping between B-p, B-s and Be-s states. This overlaping is strong enough indicating metallic origin with different values of N(E F ). These values are 16.4, 16.27 and 14.89 states/eV, and the corresponding bare linear low-temperature electronic specific heat coefficient (γ) is found to be 2.84, 2.82 and 2.58 mJ/mol K 2 for EVGGA, GGA and LDA respectively. There exists a strong hybridization between B-s and B-p states, also between B-s and Be-p states around the Fermi level. The Fermi surface is composed of three sheets. These sheets consist of set of holes and electrons. The bonding features of the compounds are analyzed using the electronic charge density in the (101 and −101) crystallographic planes and also the analyzing of charge density shows covalent bonding between B and B. The linear optical properties are also deliberated and discussed in particulars. - Highlights: • The compound is metallic. • The density of states at the Fermi energy is calculated. • The bare linear low-temperature electronic specific heat coefficient is obtained. • Fermi surface is composed of three sheets. • The bonding features are analyzed using the electronic charge density

  8. A new wire chamber front-end system, based on the ASD-8 B chip

    NARCIS (Netherlands)

    Krusemann, BAM; Bassini, R; Ellinghaus, F; Frekers, D; Hagemann, M; Hannen, VM; von Heynitz, H; Heyse, J; Sohlbach, H; Wortche, HJ

    1999-01-01

    The Focal-Plane Polarimeter (FPP) for the Big-Bite Spectrometer van den Berg (Nucl Instr. and Meth. B 99 (1995) 637ff) at the KVI requires the read-out of four large-area MWPCs and two VDCs with 3872 wires in-total. The EUROSUPERNOVA collaboration (SNOVA) developed a digital 16 channel preamplifier

  9. Double thyroid ectopia (with incidental papillary thyroid microcarcinoma) (2010: 8b)

    Energy Technology Data Exchange (ETDEWEB)

    Borges, Alexandra [Instituto Portugues de Oncologia de Francisco Gentil-Centro de Lisboa, Department of Radiology, Lisbon (Portugal); Martins, Mariluz [Instituto Portugues de Oncologia de Francisco Gentil-Centro de Lisboa, Department of Head and Neck Surgery, Lisbon (Portugal); Andre, Saudade [Instituto Portugues de Oncologia de Francisco Gentil-Centro de Lisboa, Department of Pathology, Lisbon (Portugal)

    2010-11-15

    We present the case of a 45-year-old man with a long-standing history of a slow-growing left submandibular mass. Imaging was diagnostic as it disclosed an absent orthotopic thyroid gland and heterogeneous masses, with both solid and cystic components, as well as calcifications in the left sublingual/submandibular space and in the left paramedian aspect of the tongue base, consistent with double thyroid ectopia, originating from central and lateral thyroid anlages, respectively. Pathology confirmed an ectopic thyroid goiter in the left submandibular space with an incidental papillary microcarcinoma. Scintigraphy also demonstrated ectopic thyroid tissue in the left tongue base. (orig.)

  10. Review of progress in quantitative nondestructive evaluation. Volume 8A and Volume 8B

    International Nuclear Information System (INIS)

    Thompson, D.O.; Chimenti, D.E.

    1989-01-01

    Volume 8 contains the edited papers presented at the 1988 Review of Progress in Quantitative Nondestructive Evaluation meeting. The 288 papers discuss such topics as fundamental techniques as acoustic testing, eddy current testing, and x-ray radiography; advanced techniques using x-ray computed tomography and laser ultrasonics; interpretive signal and image processing using expert systems and adaptive analysis; NDE probes and sensors and NDE systems and instrumentation; materials process control and inspection reliability including human factors. Materials discussed range from electronic circuit materials, coatings, adhesive bonds, smart structures, composite materials, welded joints, ferrous materials, and steels and alloys. Stress, texture, structural and fracture properties of materials are characterized using various NDE techniques. Applications to reactor, aircraft, and space vehicle components are investigated

  11. W8...b4 IM, how did u rite??! Digital Writing in the Composition Classroom

    Science.gov (United States)

    Partridge, Bryan

    2011-01-01

    From word processing computers, to mobile telephones, to the advent of the Internet, and finally to online communication venues like Instant Messenger (IM), the past four decades have brought an increasing prevalence of technology into our culture that is altering the English language. While decried by parents and lamented by teachers, these…

  12. Estrogens increase expression of bone morphogenetic protein 8b in brown adipose tissue of mice

    NARCIS (Netherlands)

    A. Grefhorst (Aldo); J.C. van den Beukel (Anneke); A.F. van Houten (A.); J. Steenbergen (Jacobie); J.A. Visser (Jenny); A.P.N. Themmen (Axel)

    2015-01-01

    textabstractBackground: In mammals, white adipose tissue (WAT) stores fat and brown adipose tissue (BAT) dissipates fat to produce heat. Several studies showed that females have more active BAT. Members of the bone morphogenetic protein (BMP) and fibroblast growth factor (FGF) families are expressed

  13. Relativistic photon-Maxwellian electron cross sections

    International Nuclear Information System (INIS)

    Wienke, B.R.; Lathrop, B.L.; Devaney, J.J.

    1986-01-01

    Temperature corrected cross sections, complementing the Klein-Nishina set, are developed for astrophysical, plasma, and transport applications. The set is obtained from a nonlinear least squares fit to the exact photon-Maxwellian electron cross sections, using the static formula as the asymptotic basis. Two parameters are sufficient (two decimal places) to fit the exact cross sections over a range of 0-100 keV in electron temperature, and 0-1 MeV in incident photon energy. The fit is made to the total cross sections, yet the parameters predict both total and differential scattering cross sections well. Corresponding differential energy cross sections are less accurate. An extended fit to (just) the total cross sections, over the temperature and energy range 0-5 MeV, is also described. (author)

  14. Partial cross sections near the higher resonances

    International Nuclear Information System (INIS)

    Falk-Vairant, P.; Valladas, G.

    1961-07-01

    As a continuation of the report given at the 10. Rochester Conference, recent measurements of charge-exchange cross section and π 0 production in π - -p interactions are presented here. Section 1 gives a summary of the known results for the elastic, inelastic, and charge-exchange cross sections. Section 2 presents the behavior of the cross sections in the T=1/2 state, in order to discuss the resonances at 600 and 890 MeV. Section 3 discusses the charge-exchange scattering and the interference term between the T=1/2 and T=3/2 states. Section 4 presents some comments on inelastic processes. This report is reprinted from 'Reviews of Modern Physics', Vol. 33, No. 3, 362-367, July, 1961

  15. Background-cross-section-dependent subgroup parameters

    International Nuclear Information System (INIS)

    Yamamoto, Toshihisa

    2003-01-01

    A new set of subgroup parameters was derived that can reproduce the self-shielded cross section against a wide range of background cross sections. The subgroup parameters are expressed with a rational equation which numerator and denominator are expressed as the expansion series of background cross section, so that the background cross section dependence is exactly taken into account in the parameters. The advantage of the new subgroup parameters is that they can reproduce the self-shielded effect not only by group basis but also by subgroup basis. Then an adaptive method is also proposed which uses fitting procedure to evaluate the background-cross-section-dependence of the parameters. One of the simple fitting formula was able to reproduce the self-shielded subgroup cross section by less than 1% error from the precise evaluation. (author)

  16. Scattering cross section for various potential systems

    Directory of Open Access Journals (Sweden)

    Myagmarjav Odsuren

    2017-08-01

    Full Text Available We discuss the problems of scattering in this framework, and show that the applied method is very useful in the investigation of the effect of the resonance in the observed scattering cross sections. In this study, not only the scattering cross sections but also the decomposition of the scattering cross sections was computed for the α–α system. To obtain the decomposition of scattering cross sections into resonance and residual continuum terms, the complex scaled orthogonality condition model and the extended completeness relation are used. Applying the present method to the α–α and α–n systems, we obtained good reproduction of the observed phase shifts and cross sections. The decomposition into resonance and continuum terms makes clear that resonance contributions are dominant but continuum terms and their interference are not negligible. To understand the behavior of observed phase shifts and the shape of the cross sections, both resonance and continuum terms are calculated.

  17. Scattering cross section for various potential systems

    Energy Technology Data Exchange (ETDEWEB)

    Odsuren, Myagmarjav; Khuukhenkhuu, Gonchigdorj; Davaa, Suren [Nuclear Research Center, School of Engineering and Applied Sciences, National University of Mongolia, Ulaanbaatar (Mongolia); Kato, Kiyoshi [Nuclear Reaction Data Centre, Faculty of Science, Hokkaido University, Sapporo (Japan)

    2017-08-15

    We discuss the problems of scattering in this framework, and show that the applied method is very useful in the investigation of the effect of the resonance in the observed scattering cross sections. In this study, not only the scattering cross sections but also the decomposition of the scattering cross sections was computed for the α–α system. To obtain the decomposition of scattering cross sections into resonance and residual continuum terms, the complex scaled orthogonality condition model and the extended completeness relation are used. Applying the present method to the α–α and α–n systems, we obtained good reproduction of the observed phase shifts and cross sections. The decomposition into resonance and continuum terms makes clear that resonance contributions are dominant but continuum terms and their interference are not negligible. To understand the behavior of observed phase shifts and the shape of the cross sections, both resonance and continuum terms are calculated.

  18. Cross-section methodology in SIMMER

    International Nuclear Information System (INIS)

    Soran, P.D.

    1975-11-01

    The cross-section methodology incorporated in the SIMMER code is described. Data base for all cross sections is the ENDF/B system with various progressing computer codes to group collapse and modify the group constants which are used in SIMMER. Either infinitely dilute cross sections or the Bondarenko formalism can be used in SIMMER. Presently only a microscopic treatment is considered, but preliminary macroscopic algorithms have been investigated

  19. Cross-section methodology in SIMMER

    International Nuclear Information System (INIS)

    Soran, P.D.

    1976-05-01

    The cross-section methodology incorporated in the SIMMER code is described. Data base for all cross sections is the ENDF/B system with various progressing computer codes to group collapse and modify the group constants which are used in SIMMER. Either infinitely dilute cross sections or the Bondarenko formalism can be used in SIMMER. Presently only a microscopic treatment is considered, but preliminary macroscopic algorithms have been investigated

  20. High ET jet cross sections at CDF

    International Nuclear Information System (INIS)

    Flaugher, B.

    1996-08-01

    The inclusive jet cross section for p anti p collisions at √s = 1.8 TeV as measured by the CDF collaboration will be presented. Preliminary CDF measurements of the Σ E T cross section at √s = 1.8 TeV and the central inclusive jet cross section at √s = 0.630 TeV will also be shown

  1. Measurements of neutron capture cross sections

    International Nuclear Information System (INIS)

    Nakajima, Yutaka

    1984-01-01

    A review of measurement techniques for the neutron capture cross sections is presented. Sell transmission method, activation method, and prompt gamma-ray detection method are described using examples of capture cross section measurements. The capture cross section of 238 U measured by three different prompt gamma-ray detection methods (large liquid scintillator, Moxon-Rae detector, and pulse height weighting method) are compared and their discrepancies are resolved. A method how to derive the covariance is described. (author)

  2. Recommended activation detector cross sections (RNDL-82)

    International Nuclear Information System (INIS)

    Bondars, Kh.Ya.; Lapenas, A.A.

    1984-01-01

    The results of the comparison between measured and calculated average cross sections in 5 benchmark experiments are presented. Calculations have been based on the data from 10 libraries of evaluated cross sections. The recommended library (RNDL-82) of the activation detector cross sections has been created on the basis of the comparison. RNDL-82, including 26 reactions, and the basic characteristics of the detectors are presented. (author)

  3. Cross-sectional anatomy for computed tomography

    International Nuclear Information System (INIS)

    Farkas, M.L.

    1988-01-01

    This self-study guide recognizes that evaluation and interpretation of CT-images demands a firm understanding of both cross-sectional anatomy and the principles of computed tomography. The objectives of this book are: to discuss the basic principles of CT, to stress the importance of cross-sectional anatomy to CT through study of selected cardinal transverse sections of head, neck, and trunk, to explain orientation and interpretation of CT-images with the aid of corresponding cross-sectional preparations

  4. Cesarean Section: MedlinePlus Health Topic

    Science.gov (United States)

    ... Foundation) Cesarean Section: The Operation (March of Dimes Birth Defects Foundation) Statistics and Research Changes in Cesarean Delivery Rates by Gestational Age: United States, 1996-2011 (National ...

  5. Total neutron cross section of lead

    International Nuclear Information System (INIS)

    Kanda, K.; Aizawa, O.

    1976-01-01

    The total thermal-neutron cross section of natural lead under various physical conditions was measured by the transmission method. It became clear that the total cross section at room temperature previously reported is lower than the present data. The total cross section at 400, 500, and 600 0 C, above the melting point of lead, 327 0 C, was also measured, and the changes in the cross section as a function of temperature were examined, especially near and below the melting point. The data obtained for the randomly oriented polycrystalline state at room temperature were in reasonable agreement with the theoretical values calculated by the THRUSH and UNCLE-TOM codes

  6. Curves and tables of neutron cross sections

    International Nuclear Information System (INIS)

    Nakagawa, Tsuneo; Asami, Tetsuo; Yoshida, Tadashi

    1990-07-01

    Neutron cross-section curves from the Japanese Evaluated Nuclear Data Library version 3, JENDL-3, are presented in both graphical and tabular form for users in a wide range of application areas in the nuclear energy field. The contents cover cross sections for all the main reactions induced by neutrons with an energy below 20 MeV including; total, elastic scattering, capture, and fission, (n,n'), (n,2n), (n,3n), (n,α), (n,p) reactions. The 2200 m/s cross-section values, resonance integrals, and Maxwellian- and fission-spectrum averaged cross sections are also tabulated. (author)

  7. The Golden Section as Optical Limitation.

    Science.gov (United States)

    Elliott, Mark A; Kelly, Joy; Friedel, Jonas; Brodsky, Jennifer; Mulcahy, Paul

    2015-01-01

    The golden section, ϕ = (1 + √5)/2 = 1.618... and its companion ϕ = 1/ϕ = ϕ -1 = 0.618..., are irrational numbers which for centuries were believed to confer aesthetic appeal. In line with the presence of golden sectioning in natural growth patterns, recent EEG recordings show an absence of coherence between brain frequencies related by the golden ratio, suggesting the potential relevance of the golden section to brain dynamics. Using Mondrian-type patterns comprising a number of paired sections in a range of five section-section areal ratios (including golden-sectioned pairs), participants were asked to indicate as rapidly and accurately as possible the polarity (light or dark) of the smallest section in the patterns. They were also asked to independently assess the aesthetic appeal of the patterns. No preference was found for golden-sectioned patterns, while reaction times (RTs) tended to decrease overall with increasing ratio independently of each pattern's fractal dimensionality. (Fractal dimensionality was unrelated to ratio and measured in terms of the Minkowski-Bouligand box-counting dimension). The ease of detecting the smallest section also decreased with increasing ratio, although RTs were found to be substantially slower for golden-sectioned patterns under 8-paired sectioned conditions. This was confirmed by a significant linear relationship between RT and ratio (p < .001) only when the golden-sectioned RTs were excluded [the relationship was non-significant for the full complement of ratios (p = .217)]. Image analysis revealed an absence of spatial frequencies between 4 and 8 cycles-per-degree that was exclusive to the 8-paired (golden)-sectioned patterns. The significance of this was demonstrated in a subsequent experiment by addition of uniformly distributed random noise to the patterns. This provided a uniform spatial-frequency profile for all patterns, which did not influence the decrease in RT with increasing ratio but abolished the elevated

  8. Director, Laboratory Animal Care and Use Section

    Data.gov (United States)

    Federal Laboratory Consortium — The NIAMS Laboratory Animal Care and Use Section (LACU) provides support to all NIAMS Intramural Research Program (IRP) Branches and Laboratories using animals. The...

  9. The Golden Section as Optical Limitation.

    Directory of Open Access Journals (Sweden)

    Mark A Elliott

    Full Text Available The golden section, ϕ = (1 + √5/2 = 1.618... and its companion ϕ = 1/ϕ = ϕ -1 = 0.618..., are irrational numbers which for centuries were believed to confer aesthetic appeal. In line with the presence of golden sectioning in natural growth patterns, recent EEG recordings show an absence of coherence between brain frequencies related by the golden ratio, suggesting the potential relevance of the golden section to brain dynamics. Using Mondrian-type patterns comprising a number of paired sections in a range of five section-section areal ratios (including golden-sectioned pairs, participants were asked to indicate as rapidly and accurately as possible the polarity (light or dark of the smallest section in the patterns. They were also asked to independently assess the aesthetic appeal of the patterns. No preference was found for golden-sectioned patterns, while reaction times (RTs tended to decrease overall with increasing ratio independently of each pattern's fractal dimensionality. (Fractal dimensionality was unrelated to ratio and measured in terms of the Minkowski-Bouligand box-counting dimension. The ease of detecting the smallest section also decreased with increasing ratio, although RTs were found to be substantially slower for golden-sectioned patterns under 8-paired sectioned conditions. This was confirmed by a significant linear relationship between RT and ratio (p < .001 only when the golden-sectioned RTs were excluded [the relationship was non-significant for the full complement of ratios (p = .217]. Image analysis revealed an absence of spatial frequencies between 4 and 8 cycles-per-degree that was exclusive to the 8-paired (golden-sectioned patterns. The significance of this was demonstrated in a subsequent experiment by addition of uniformly distributed random noise to the patterns. This provided a uniform spatial-frequency profile for all patterns, which did not influence the decrease in RT with increasing ratio but abolished

  10. Section on High Resolution Optical Imaging (HROI)

    Data.gov (United States)

    Federal Laboratory Consortium — The Section on High Resolution Optical Imaging (HROI) develops novel technologies for studying biological processes at unprecedented speed and resolution. Research...

  11. Neutron accelerator tube having improved ionization section

    International Nuclear Information System (INIS)

    Givens, W.W.

    1982-01-01

    A neutron accelerator tube is described having a target section, an ionization section, and a replenisher section for supplying accelerator gas to the ionization section. The ionization section is located between the target and the replenisher section and includes an ionization chamber adapted to receive accelerator gas from the replenisher section. The ionization section further includes spaced cathodes having opposed active surfaces exposed to the interior of the ionization chamber. An anode is located intermediate the cathodes whereby in response to an applied positive voltage, electrons created by field emission are transmitted between the opposed active surfaces of the cathodes and produce the emission of secondary electrons. The active surface of at least one of the cathodes is formulated of a material having a secondary electron emission factor of at least one cathode member located in the tube adjacent to th replenisher section may have a protuberant portion extending axially into the ionization chamber. The other cathode spaced from the first cathode member in the direction of the target has an aperture therein along the axis of the protuberant portion. An annular magnet extends around the exterior of the ionization chamber and envelops the anode member. Means are provided to establish a high permeability magnetic flux path extending outwardly from the opposed poles from the magnet to the active surfaces of the cathode members

  12. Neutron accelerator tube having improved ionization section

    International Nuclear Information System (INIS)

    Givens, W.W.

    1981-01-01

    A neutron accelerator tube having a target section, an ionization section, and a replenisher section for supplying accelerator gas to the ionization section. The ionization section is located between the target and the replenisher section and includes an ionization chamber adapted to receive accelerator gas from the replenisher section. The ionization section further includes spaced cathodes having opposed active surfaces exposed to the interior of the ionization chamber. An anode is located intermediate the cathodes whereby in response to an applied positive voltage, electrons created by field emmission are transmitted between the opposed active surfaces of the cathodes and produce the emission of secondary electrons. The active surface of at least one of the cathodes is formulated of a material having a secondary electron emission factor of at least 2. One cathode member located in the tube adjacent to the replenisher section may have a protuberant portion extending axially into the ioization chamber. The other cathode spaced from the first cathode member in the direction of the target has an aperture therein along the axis of the protuberant portion. An annular magnet extends around the exterior of the ionization chamber and envelops the anode member. Means are provided to establish a high permeability magnetic flux path extending outwardly from the opposed poles from the magnet to the active surfaces of the cathode members

  13. Electron collision cross sections of mercury

    International Nuclear Information System (INIS)

    Suzuki, Susumu; Kuzuma, Kiyotaka; Itoh, Haruo

    2006-01-01

    In this paper, we propose a new collision cross section set for mercury which revises the original set summarized by Hayashi in 1989. Hanne reported three excitation collision cross sections (6 3 P 0 , 6 3 P 1 , 6 3 P 2 ) determined from an electron beam experiment in 1988. As a matter for regret, no attentive consideration was given to combining these three excitation cross sections with the cross section set of Hayashi. Therefore we propose a new set where these three excitation cross sections are included. In this study, other two excitation cross sections (6 1 P 1 , 6 3 D 3 ) except for the three excitation collision cross sections (6 3 P 0 , 6 3 P 1 , 6 3 P 2 ) are taken from the original set of Hayashi. The momentum transfer cross section and the ionization collision cross section are also taken from Hayashi. A Monte Carlo Simulation (MCS) technique is applied for evaluating our new cross section set. The present results of the electron drift velocity and the ionization coefficient are compared to experimental values. Agreement is secured in relation to the electron drift velocity for 1.5 Td 2 ) is the reduced electric field, E (V/cm) is the electric field, N (1/cm 3 ) is the number density of mercury atoms at 0degC, 1 Torr, E/N is also equal to 2.828 x 10 -17 E/p 0 from the relation of the ideal gas equation, p 0 (Torr) is gas pressure at 0degC, 1 Torr=1.33322 x 10 -2 N/cm -2 and 10 -17 V/cm 2 is called 1 Td. Thus it is ensured that our new cross section set is reasonable enough to be used up to 100 eV when considering with the electron drift velocity and the ionization coefficient. (author)

  14. First measurement of the Rayleigh cross section

    NARCIS (Netherlands)

    Naus, H.; Ubachs, W.

    2000-01-01

    Rayleigh cross section for N2, Ar and SF6 was performed using the technique of cavity ring-down spectroscopy (CRDS). The experiment was based on the assumption that scattering cross section is equal to the extinction in the absence of absorption. The theory explains the molecular origin of

  15. Total cross section of highly excited strings

    International Nuclear Information System (INIS)

    Lizzi, F.; Senda, I.

    1990-01-01

    The unpolarized total cross section for the joining of two highly excited strings is calculated. The calculation is performed by taking the average overall states in the given excitation levels of the initial strings. We find that the total cross section grows with the energy and momentum of the initial states. (author). 8 refs, 1 fig

  16. Compilation of cross-sections. Pt. 1

    International Nuclear Information System (INIS)

    Flaminio, V.; Moorhead, W.G.; Morrison, D.R.O.; Rivoire, N.

    1983-01-01

    A compilation of integral cross-sections for hadronic reactions is presented. This is an updated version of CERN/HERA 79-1, 79-2, 79-3. It contains all data published up to the beginning of 1982, but some more recent data have also been included. Plots of the cross-sections versus incident laboratory momentum are also given. (orig.)

  17. Total cross section results for deuterium electrodisintegration

    International Nuclear Information System (INIS)

    Skopik, D.M.; Murphy, J.J. II; Shin, Y.M.

    1976-01-01

    Theoretical total cross sections for deuterium electrodisintegration are presented as a function of incident electron energy. The cross section has been calculated using virtual photon theory with Partovi's photodisintegration calculation for E/subx/ > 10 MeV and effective range theory for E/subx/ 2 H(e, n) reaction in Tokamak reactors

  18. Model cross section calculations using LAHET

    International Nuclear Information System (INIS)

    Prael, R.E.

    1992-01-01

    The current status of LAHET is discussed. The effect of a multistage preequilibrium exciton model following the INC is examined for neutron emission benchmark calculations, as is the use of a Fermi breakup model for light nuclei rather than an evaporation model. Comparisons are made also for recent fission cross section experiments, and a discussion of helium production cross sections is presented

  19. 29 CFR Section 1607.16 - Definitions.

    Science.gov (United States)

    2010-07-01

    .... Job analysis. A detailed statement of work behaviors and other information relevant to the job. L. Job description. A general statement of job duties and responsibilities. M. Knowledge. A body of information... of performance on the job. See section 5B and section 14C. E. Construct validity. Demonstrated by...

  20. H. W. Laboratory manual: 100 Area section

    Energy Technology Data Exchange (ETDEWEB)

    1950-07-01

    The purpose of this manual is to present a Hazard Breakdown of all jobs normally encountered in the laboratory work of the three sections comprising the Analytic Section, Metallurgy and Control Division of the Technical Department. A Hazard Breakdown is a careful analysis of any job in which the source of possible dangers is clearly indicated for each particular step. The analysis is prepared by individuals who are thoroughly familiar with the specific job or procedure. It is felt that if the hazards herein outlined are recognized by the Laboratory personnel and the suggested safety cautions followed, the chance for injury will be minimized and the worker will become generally more safety conscious. The manual, which is prefaced by the general safety rules applying to all the laboratories, is divided into three main sections, one for each of the three sections into which the Laboratories Division is divided. These sections are as follows: Section 1 -- 200 Area Control; Section 2 -- 100 Area Control; Section 3 -- 300 Area Control, Essential Materials, and Methods Improvement.

  1. Instrument ampersand controls section (IA) improvements

    International Nuclear Information System (INIS)

    Kramer, C.; Paul, J.

    1993-01-01

    This portion of the panel session briefly delineates improvements in the Instrument and Controls (IA) Section over the past few years. These improvements are listed briefly in summary form. The status of publication of the IA Section of AG-1 is reviewed

  2. Convex bodies with many elliptic sections

    OpenAIRE

    Arelio, Isaac; Montejano, Luis

    2014-01-01

    {We show in this paper that two normal elliptic sections through every point of the boundary of a smooth convex body essentially characterize an ellipsoid and furthermore, that four different pairwise non-tangent elliptic sections through every point of the $C^2$-differentiable boundary of a convex body also essentially characterize an ellipsoid.

  3. Vibrational enhancement of total breakup cross sections

    International Nuclear Information System (INIS)

    Haftel, M.I.; Lim, T.K.

    1984-01-01

    This paper considers the role of multi-two-body bound states, namely vibrational excitations, on total three-body breakup cross-sections. Total cross-sections are usually easy to measure, and they play a fundamental role in chemical kinetics. (orig.)

  4. Radiation Protection Section (SC/SL/RP)

    CERN Document Server

    2006-01-01

    We should like to inform you that the Radiation Protection Section (SC/SL/RP) located on the Prévessin site has moved from Building 865 (ground floor) to new premises in Wing A of Building 892 (second floor). Telephone numbers remain the same. SC/SL/RP section

  5. Interference analysis of fission cross section

    International Nuclear Information System (INIS)

    Toshkov, S.A.; Yaneva, N.B.

    1976-01-01

    The formula for the reaction cross-section based on the R-matrix formalism considering the interference between the two neighbouring resonances, referred to the same value of total momentum was used for the analysis of the cross-section of resonance neutron induced fission of 230Pu. The experimental resolution and thermal motion of the target nuclei were accounted for numerical integration

  6. Compilation of cross-sections. Pt. 4

    International Nuclear Information System (INIS)

    Alekhin, S.I.; Ezhela, V.V.; Lugovsky, S.B.; Tolstenkov, A.N.; Yushchenko, O.P.; Baldini, A.; Cobal, M.; Flaminio, V.; Capiluppi, P.; Giacomelli, G.; Mandrioli, G.; Rossi, A.M.; Serra, P.; Moorhead, W.G.; Morrison, D.R.O.; Rivoire, N.

    1987-01-01

    This is the fourth volume in our series of data compilations on integrated cross-sections for weak, electromagnetic, and strong interaction processes. This volume covers data on reactions induced by photons, neutrinos, hyperons, and K L 0 . It contains all data published up to June 1986. Plots of the cross-sections versus incident laboratory momentum are also given. (orig.)

  7. Polyphasic taxonomy of Aspergillus section Cervini

    DEFF Research Database (Denmark)

    Chen, A.J.; Varga, J.; Frisvad, Jens Christian

    2016-01-01

    Species belonging to Aspergillus section Cervini are characterised by radiate or short columnar, fawn coloured, uniseriate conidial heads. The morphology of the taxa in this section is very similar and isolates assigned to these species are frequently misidentified. In this study, a polyphasic...

  8. Assembling the LHC short straight sections

    CERN Document Server

    Maximilien Brice

    2005-01-01

    The building where the short straight sections are being assembled, was often called ‘Lego Land’ by the workers because of the wide variety of sets of magnets and cryostats. Short straight sections contain magnets for manipulating the beam inside cryostats with liquid helium to keep the magnets at a cool 1.9 K (-271.3°C).

  9. New species in Aspergillus section Terrei

    DEFF Research Database (Denmark)

    Samson, R. A.; Peterson, S. W.; Frisvad, Jens Christian

    2011-01-01

    . clade including the type isolate of A. niveus (CBS 115.27) constitutes a lineage closely related to A. carneus. Fennellia nivea, the hypothesized teleomorph is not related to this clade. Aspergillus allahabadii, A. niveus var. indicus, and two species originally placed in section Versicolores, A......Section Terrei of Aspergillus was studied using a polyphasic approach including sequence analysis of parts of the beta-tubulin and calmodulin genes and the ITS region, macro- and micromorphological analyses and examination of extrolite profiles to describe three new species in this section. Based....... floccosus, A. terreus var. africanus, A. terreus var. aureus, while Aspergillus hortai is recognised at species level. Aspergillus terreus NRRL 4017 is described as the new species A. pseudoterreus. Also included in section Terrei are some species formerly placed in sections Flavipedes and Versicolores. A...

  10. Recommended evaluation procedure for photonuclear cross section

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Young-Ouk; Chang, Jonghwa; Fukahori, Tokio [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1998-03-01

    In order to generate photonuclear cross section library for the necessary applications, data evaluation is combined with theoretical evaluation, since photonuclear cross sections measured cannot provide all necessary data. This report recommends a procedure consisting of four steps: (1) analysis of experimental data, (2) data evaluation, (3) theoretical evaluation and, if necessary, (4) modification of results. In the stage of analysis, data obtained by different measurements are reprocessed through the analysis of their discrepancies to a representative data set. In the data evaluation, photonuclear absorption cross sections are evaluated via giant dipole resonance and quasi-deutron mechanism. With photoabsorption cross sections from the data evaluation, theoretical evaluation is applied to determine various decay channel cross sections and emission spectra using equilibrium and preequilibrium mechanism. After this, the calculated results are compared with measured data, and in some cases the results are modified to better describe measurements. (author)

  11. Comparative analysis among several cross section sets

    International Nuclear Information System (INIS)

    Caldeira, A.D.

    1983-01-01

    Critical parameters were calculated using the one dimensional multigroup transport theory for several cross section sets. Calculations have been performed for water mixtures of uranium metal, plutonium metal and uranium-thorium oxide, and for metallics systems, to determine the critical dimensions of geometries (sphere and cylinder). For this aim, the following cross section sets were employed: 1) multigroup cross section sets obtained from the GAMTEC-II code; 2) the HANSEN-ROACH cross section sets; 3) cross section sets from the ENDF/B-IV, processed by the NJOY code. Finally, we have also calculated the corresponding critical radius using the one dimensional multigroup transport DTF-IV code. The numerical results agree within a few percent with the critical values obtained in the literature (where the greatest discrepancy occured in the critical dimensions of water mixtures calculated with the values generated by the NJOY code), a very good results in comparison with similar works. (Author) [pt

  12. Activation cross section data file, (1)

    International Nuclear Information System (INIS)

    Yamamuro, Nobuhiro; Iijima, Shungo.

    1989-09-01

    To evaluate the radioisotope productions due to the neutron irradiation in fission of fusion reactors, the data for the activation cross sections ought to be provided. It is planning to file more than 2000 activation cross sections at final. In the current year, the neutron cross sections for 14 elements from Ni to W have been calculated and evaluated in the energy range 10 -5 to 20 MeV. The calculations with a simplified-input nuclear cross section calculation system SINCROS were described, and another method of evaluation which is consistent with the JENDL-3 were also mentioned. The results of cross section calculation are in good agreement with experimental data and they were stored in the file 8, 9 and 10 of ENDF/B format. (author)

  13. Electron-impact cross sections of Ne

    International Nuclear Information System (INIS)

    Tsurubuchi, S.; Arakawa, K.; Kinokuni, S.; Motohashi, K.

    2000-01-01

    Electron-impact absolute emission cross sections were measured for the 3p→3s transitions of Ne. Excitation functions of the 3s→2p first resonance lines were measured in the energy range from the threshold to 1000 eV by a polarization-free optical method and relative cross sections were normalized to the absolute values, (41.0±5.4)x10 -19 cm 2 for the 73.6 nm line and (7.1±1.0)x10 -19 cm 2 for the 74.4 nm line, which were determined at 500 eV. The integrated level-excitation cross sections of Suzuki et al for the 1s 2 and 1s 4 levels were combined with the corresponding 3p→3s cascade cross sections obtained in this paper to give absolute emission cross sections for the resonance lines. The level-excitation cross sections of the 1s 2 and 1s 4 states in Paschen notation were determined from the threshold to 1000 eV by subtracting 3p→3s cascade cross sections from the corresponding 3s→2p emission cross sections of the resonance lines. A large cascade contribution is found in the emission cross section of the resonance lines. It is 28.5% for the 73.6 nm line and 49.6% for the 74.4 nm line at 40 eV, and 17.0 and 61.8%, respectively, at 300 eV. (author)

  14. New airfoil sections for straight bladed turbine

    Science.gov (United States)

    Boumaza, B.

    1987-07-01

    A theoretical investigation of aerodynamic performance for vertical axis Darrieus wind turbine with new airfoils sections is carried out. The blade section aerodynamics characteristics are determined from turbomachines cascade model. The model is also adapted to the vertical Darrieus turbine for the performance prediction of the machine. In order to choose appropriate value of zero-lift-drag coefficient in calculation, an analytical expression is introduced as function of chord-radius ratio and Reynolds numbers. New airfoils sections are proposed and analyzed for straight-bladed turbine.

  15. New airfoil sections for straight bladed turbine

    International Nuclear Information System (INIS)

    Boumaza, B.

    1987-07-01

    A theoretical investigation of aerodynamic performance for vertical axis Darrieus wind turbine with new airfoils sections is carried out. The blade section aerodynamics characteristics are determined from turbomachines cascade model. The model is also adapted to the vertical Darrieus turbine for the performance prediction of the machine. In order to choose appropriate value of zero-lift-drag coefficient in calculation, an analytical expression is introduced as function of chord-radius ratio and Reynolds numbers. New airfoils sections are proposed and analyzed for straight-bladed turbine

  16. NNLO jet cross sections by subtraction

    International Nuclear Information System (INIS)

    Somogyi, G.; Bolzoni, P.; Trocsanyi, Z.

    2010-06-01

    We report on the computation of a class of integrals that appear when integrating the so-called iterated singly-unresolved approximate cross section of an earlier NNLO subtraction scheme over the factorised phase space of unresolved partons. The integrated approximate cross section itself can be written as the product of an insertion operator (in colour space) times the Born cross section. We give selected results for the insertion operator for processes with two and three hard partons in the final state. (orig.)

  17. Differential Top Cross-section Measurements

    CERN Document Server

    Fenton, Michael James; The ATLAS collaboration

    2017-01-01

    The top quark is the heaviest known fundamental particle. The measurement of the differential top-quark pair production cross-section provides a stringent test of advanced perturbative QCD calculations. The ATLAS collaboration has performed detailed measurements of those differential cross sections at a centre-of-mass energy of 13 TeV. This talk focuses on differential cross-section measurements in the lepton+jets final state, including using boosted top quarks to probe our understanding of top quark production in the TeV regime.

  18. Fluoroscopic tomography. [for body section synthesis

    Science.gov (United States)

    Baily, N. A.; Crepeau, R. L.; Lasser, E. C.

    1974-01-01

    A fluoroscopic tomography system capable of synthesizing body sections at a number of levels within the body has been developed. The synthesized body sections may lie either in a range of planes parallel to, tilted with respect to, skewed with respect to, or both tilted and skewed with respect to the plane of motion of the X-ray tube target. In addition, body sections can be presented which are contoured to the patient's anatomy. That is to say, they may even encompass such complex surfaces as a quadratic hyperplane. In addition, tomograms of organs in motion can be imaged.

  19. Hardon cross sections at ultra high energies

    International Nuclear Information System (INIS)

    Yodh, G.B.

    1987-01-01

    A review of results on total hadronic cross sections at ultra high energies obtained from a study of longitudinal development of cosmic ray air showers is given. The experimental observations show that proton-air inelastic cross section increases from 275 mb to over 500 mb as the collision energy in the center of mass increases from 20 GeV to 20 TeV. The proton-air inelastic cross section, obtained from cosmic ray data at √s = 30 TeV, is compared with calculations using various different models for the energy variation of the parameters of the elementary proton-proton interaction. Three conclusions are derived

  20. NNLO jet cross sections by subtraction

    Energy Technology Data Exchange (ETDEWEB)

    Somogyi, G.; Bolzoni, P. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany); Trocsanyi, Z. [CERN, Geneva (Switzerland)

    2010-06-15

    We report on the computation of a class of integrals that appear when integrating the so-called iterated singly-unresolved approximate cross section of an earlier NNLO subtraction scheme over the factorised phase space of unresolved partons. The integrated approximate cross section itself can be written as the product of an insertion operator (in colour space) times the Born cross section. We give selected results for the insertion operator for processes with two and three hard partons in the final state. (orig.)

  1. NNLO jet cross sections by subtraction

    CERN Document Server

    Somogyi, Gabor; Trocsanyi, Zoltan

    2010-01-01

    We report on the computation of a class of integrals that appear when integrating the so-called iterated singly-unresolved approximate cross section of the NNLO subtraction scheme of [1-4], over the factorised phase space of unresolved partons. The integrated approximate cross section itself can be written as the product of an insertion operator (in colour space) times the Born cross section. We give selected results for the insertion operator for processes with two and three hard partons in the final state.

  2. Is the quasielastic pion cross section really bigger than the pion-nucleus reaction cross section

    International Nuclear Information System (INIS)

    Silbar, R.R.

    1979-01-01

    It is shown that soft pion charge exchanges may increase the inclusive (π + ,π 0 ') cross section, relative to the total quasielastic (π + ,π + ') cross section, by as much as a factor of two. 4 references

  3. Cross-section crushing behaviour of hat-sections (Part II: Analytical modelling)

    NARCIS (Netherlands)

    Hofmeyer, H.

    2005-01-01

    Hat-sections are often used to experimentally investigate building sheeting subject to a concentrated load and bending. In car doors, hat-sections are used for side-impact protection. Their crushing behaviour can partly be explained by only observing their cross-sectional behaviour [1]. This

  4. Methodology of failed section location in case of leaks in PGN-200M sectional steam generator

    International Nuclear Information System (INIS)

    Kuznetsov, A.A.; Govorov, P.P.; Nosov, Yu.V.; Karavaev, A.P.

    2009-01-01

    The article considers a way of the failed section location when indications of water-sodium reaction emerge in PGN-200M sectional steam generator of the BN-600 power unit. The selection of diagnostic parameters used to locate the failed section is justified. Various alternative locations of leaks have been simulated [ru

  5. Calculation of the resonance cross section functions

    International Nuclear Information System (INIS)

    Slipicevic, K.F.

    1967-11-01

    This paper includes the procedure for calculating the Doppler broadened line shape functions ψ and χ which are needed for calculation of resonance cross section functions. The obtained values are given in tables

  6. Evolutionary relationships in Vaccinium section Cyanococcus

    Science.gov (United States)

    The North American Vaccinium section Cyanococcus includes the ecologically and economically important blueberry species, Vaccinium corymbosum (highbush blueberry), Vaccinium angustifolium (lowbush blueberry), Vaccinium myrtilloides (velvet-leaf blueberry), and Vaccinium virgatum (rabbiteye blueberry...

  7. Characterization and Modeling of Recycled Pavement Sections

    Science.gov (United States)

    2017-12-01

    Because of its documented cost and environmental benefits, cold central plant recycling (CCPR) has attracted the interest of local and state departments of transportation. In 2015 two test pavement sections with CCPR as base layers were constructed a...

  8. Caesarean section wound infiltration with ropivacaine versus ...

    African Journals Online (AJOL)

    Caesarean section wound infiltration with ropivacaine versus placebo: Survey of chronic pelvic pain after 4 years' follow-up. ... South African Journal of Obstetrics and Gynaecology. Journal Home · ABOUT THIS JOURNAL · Advanced Search ...

  9. Section 608 Technician Certification Test Topics

    Science.gov (United States)

    Identifies some of the topics covered on Section 608 Technician Certification tests such as ozone depletion, the Clean Air Act and Montreal Protocol, Substitute Refrigerants and oils, Refrigeration and Recovery Techniques.

  10. Fission cross section measurements at intermediate energies

    International Nuclear Information System (INIS)

    Laptev, Alexander

    2005-01-01

    The activity in intermediate energy particle induced fission cross-section measurements of Pu, U isotopes, minor actinides and sub-actinides in PNPI of Russia is reviewed. The neutron-induced fission cross-section measurements are under way in the wide energy range of incident neutrons from 0.5 MeV to 200 MeV at the GNEIS facility. In number of experiments at the GNEIS facility, the neutron-induced fission cross sections were obtained for many nuclei. In another group of experiments the proton-induced fission cross-section have been measured for proton energies ranging from 200 to 1000 MeV at 100 MeV intervals using the proton beam of PNPI synchrocyclotron. (author)

  11. Measurement of multinucleon transfer cross-sections

    Indian Academy of Sciences (India)

    Keywords. Ni(C, ), Fe(C, ), =C, C, B, B, Be, Be, Be, Be, Li, Li; = 60 MeV; measured reaction cross-section; elastic scattering angular distribution; deduced transfer probabilities and enhancement factors.

  12. Capture cross sections on unstable nuclei

    Science.gov (United States)

    Tonchev, A. P.; Escher, J. E.; Scielzo, N.; Bedrossian, P.; Ilieva, R. S.; Humby, P.; Cooper, N.; Goddard, P. M.; Werner, V.; Tornow, W.; Rusev, G.; Kelley, J. H.; Pietralla, N.; Scheck, M.; Savran, D.; Löher, B.; Yates, S. W.; Crider, B. P.; Peters, E. E.; Tsoneva, N.; Goriely, S.

    2017-09-01

    Accurate neutron-capture cross sections on unstable nuclei near the line of beta stability are crucial for understanding the s-process nucleosynthesis. However, neutron-capture cross sections for short-lived radionuclides are difficult to measure due to the fact that the measurements require both highly radioactive samples and intense neutron sources. Essential ingredients for describing the γ decays following neutron capture are the γ-ray strength function and level densities. We will compare different indirect approaches for obtaining the most relevant observables that can constrain Hauser-Feshbach statistical-model calculations of capture cross sections. Specifically, we will consider photon scattering using monoenergetic and 100% linearly polarized photon beams. Challenges that exist on the path to obtaining neutron-capture cross sections for reactions on isotopes near and far from stability will be discussed.

  13. Calculation of the resonance cross section functions

    Energy Technology Data Exchange (ETDEWEB)

    Slipicevic, K F [Institute of nuclear sciences Boris Kidric, Vinca, Beograd (Yugoslavia)

    1967-11-15

    This paper includes the procedure for calculating the Doppler broadened line shape functions {psi} and {chi} which are needed for calculation of resonance cross section functions. The obtained values are given in tables.

  14. Pion-nucleus cross sections approximation

    International Nuclear Information System (INIS)

    Barashenkov, V.S.; Polanski, A.; Sosnin, A.N.

    1990-01-01

    Analytical approximation of pion-nucleus elastic and inelastic interaction cross-section is suggested, with could be applied in the energy range exceeding several dozens of MeV for nuclei heavier than beryllium. 3 refs.; 4 tabs

  15. SPS, preassembly of short straight sections

    CERN Multimedia

    1975-01-01

    Short straight sections were preassembled with their vacuum chambers, ready for installation in the SPS. Here we see two, containing sextupoles for chromaticity adjustment. See also 7501017, 7501018, and Annual Report 1976, p.174.

  16. SPS, short straight section with sextupole

    CERN Multimedia

    CERN PhotoLab

    1975-01-01

    Short straight sections were preassembled with their vacuum chambers, ready for installation in the SPS. This one contains a sextupole for chromaticity adjustment. See also 7501017, 7501009X, and Annual Report 1974, p.174.

  17. Status of neutron dosimetry cross sections

    International Nuclear Information System (INIS)

    Griffin, P.J.; Kelly, J.G.

    1992-01-01

    Several new cross section libraries, such as ENDF/B-VI(release 2), IRDF-90,JEF-2.2, and JENDL-3 Dosimetry, have recently been made available to the dosimetry community. the Sandia National Laboratories (SNL) Radiation Metrology Laboratory (RML) has worked with these libraries since pre-release versions were available. this paper summarizes the results of the intercomparison and testing of dosimetry cross sections. As a result of this analysis, a compendium of the best dosimetry cross sections was assembled from the available libraries for use within the SNL RML. this library, referred to as the SNLRML Library, contains 66 general dosimetry sensors and 3 special dosimeters unique to the RML sensor inventory. The SNLRML cross sections have been put into a format compatible with commonly used spectrum determination codes

  18. C-Section Recovery: What to Expect

    Science.gov (United States)

    ... Mood changes. Childbirth triggers a jumble of powerful emotions. Many new moms experience a period of feeling ... labor-and-delivery/in-depth/c-section-recovery/art-20047310 . Mayo Clinic Footer Legal Conditions and Terms ...

  19. Tachyonic ionization cross sections of hydrogenic systems

    Energy Technology Data Exchange (ETDEWEB)

    Tomaschitz, Roman [Department of Physics, Hiroshima University, 1-3-1 Kagami-yama, Higashi-Hiroshima 739-8526 (Japan)

    2005-03-11

    Transition rates for induced and spontaneous tachyon radiation in hydrogenic systems as well as the transversal and longitudinal ionization cross sections are derived. We investigate the interaction of the superluminal radiation field with matter in atomic bound-bound and bound-free transitions. Estimates are given for Ly-{alpha} transitions effected by superluminal quanta in hydrogen-like ions. The tachyonic photoelectric effect is scrutinized, in the Born approximation and at the ionization threshold. The angular maxima occur at different scattering angles in the transversal and longitudinal cross sections, which can be used to sift out longitudinal tachyonic quanta in a photon flux. We calculate the tachyonic ionization and recombination cross sections for Rydberg states and study their asymptotic scaling with respect to the principal quantum number. At the ionization threshold of highly excited states of order n {approx} 10{sup 4}, the longitudinal cross section starts to compete with photoionization, in recombination even at lower levels.

  20. Use of frozen section in genitourinary pathology.

    Science.gov (United States)

    Shen, Steven S; Truong, Luan D; Ro, Jae Y; Ayala, Alberto G

    2012-08-01

    Frozen section diagnosis provides critical information for immediate surgical management decision making. Over the last several years, there have been some significant advances in treatment of genitourinary cancer, particularly with regard to surgical techniques. These changes in turn impact the type and frequency of intraoperative frozen section requests. In this review, we describe the main indications and diagnostic challenges of frozen section diagnosis during surgeries of each genitourinary organ system including prostate, kidney, bladder, testis, and penis. The pitfalls and approaches to different diagnostic situations are discussed. It is also stressed that pathologists must not only be familiar with the histological diagnosis, but also understand the limitations of frozen section diagnosis and communicate with urologists during the intraoperative treatment decision making process.

  1. a cross-sectional analytic study 2014

    African Journals Online (AJOL)

    Assessment of HIV/AIDS comprehensive correct knowledge among Sudanese university: a cross-sectional analytic study 2014. ... There are limited studies on this topic in Sudan. In this study we investigated the Comprehensive correct ...

  2. Capture cross sections on unstable nuclei

    Directory of Open Access Journals (Sweden)

    Tonchev A.P.

    2017-01-01

    Full Text Available Accurate neutron-capture cross sections on unstable nuclei near the line of beta stability are crucial for understanding the s-process nucleosynthesis. However, neutron-capture cross sections for short-lived radionuclides are difficult to measure due to the fact that the measurements require both highly radioactive samples and intense neutron sources. Essential ingredients for describing the γ decays following neutron capture are the γ-ray strength function and level densities. We will compare different indirect approaches for obtaining the most relevant observables that can constrain Hauser-Feshbach statistical-model calculations of capture cross sections. Specifically, we will consider photon scattering using monoenergetic and 100% linearly polarized photon beams. Challenges that exist on the path to obtaining neutron-capture cross sections for reactions on isotopes near and far from stability will be discussed.

  3. Methods for calculating anisotropic transfer cross sections

    International Nuclear Information System (INIS)

    Cai, Shaohui; Zhang, Yixin.

    1985-01-01

    The Legendre moments of the group transfer cross section, which are widely used in the numerical solution of the transport calculation can be efficiently and accurately constructed from low-order (K = 1--2) successive partial range moments. This is convenient for the generation of group constants. In addition, a technique to obtain group-angle correlation transfer cross section without Legendre expansion is presented. (author)

  4. Heisenberg rise of total cross sections

    International Nuclear Information System (INIS)

    Ezhela, V.V.; Yushchenko, O.P.

    1988-01-01

    It is shown that on the basis of the original idea of Heisenberg on the quasiclassical picture of extended particle interactions one can construct a satisfactory description of the total cross sections, elastic cross sections, elastic diffractive slopes and mean charged multiplicities in the cm energy range from 5 to 900 GeV, and produce reasonable extrapolations up to several tens of TeV. 14 refs.; 7 figs.; 2 tabs

  5. Acute parotiditis after cesarean section; case report

    OpenAIRE

    Cristina Moisei; Romina M. Sima; Liana Pleş

    2017-01-01

    The enlargement of the parotid gland develops in inflammatory or stenotic conditions but after Cesarean section the symptomatology is unusual. A 38 year old patient with no obstetrical history referred to our clinic for pregnancy, which followed our national program of prenatal care. The outcome of the pregnancy was favorable for both mother and fetus. During labor the fetus developed bradycardia and the patient delivered by Cesarean section a 3400 g baby-boy with 8 Apgar Score; the anesthesi...

  6. Neutron-induced fission cross sections

    International Nuclear Information System (INIS)

    Weigmann, H.

    1991-01-01

    In the history of fission research, neutron-induced fission has always played the most important role. The practical importance of neutron-induced fission rests upon the fact that additional neutrons are produced in the fission process, and thus a chain reaction becomes possible. The practical applications of neutron-induced fission will not be discussed in this chapter, but only the physical properties of one of its characteristics, namely (n,f) cross sections. The most important early summaries on the subject are the monograph edited by Michaudon which also deals with the practical applications, the earlier review article on fission by Michaudon, and the review by Bjornholm and Lynn, in which neutron-induced fission receives major attention. This chapter will attempt to go an intermediate way between the very detailed theoretical treatment in the latter review and the cited monograph which emphasizes the applied aspects and the techniques of fission cross-section measurements. The more recent investigations in the field will be included. Section II will survey the properties of cross sections for neutron-induced fission and also address some special aspects of the experimental methods applied in their measurement. Section Ill will deal with the formal theory of neutron-induced nuclear reactions for the resolved resonance region and the region of statistical nuclear reactions. In Section IV, the fission width, or fission transmission coefficient, will be discussed in detail. Section V will deal with the broader structures due to incompletely damped vibrational resonances, and in particular will address the special case of thorium and neighboring isotopes. Finally, Section VI will briefly discuss parity violation effects in neutron-induced fission. 74 refs., 14 figs., 3 tabs

  7. WheelerLab: An interactive program for sequence stratigraphic analysis of seismic sections, outcrops and well sections and the generation of chronostratigraphic sections and dynamic chronostratigraphic sections

    OpenAIRE

    Adewale Amosu; Yuefeng Sun

    2017-01-01

    WheelerLab is an interactive program that facilitates the interpretation of stratigraphic data (seismic sections, outcrop data and well sections) within a sequence stratigraphic framework and the subsequent transformation of the data into the chronostratigraphic domain. The transformation enables the identification of significant geological features, particularly erosional and non-depositional features that are not obvious in the original seismic domain. Although there are some software produ...

  8. Evaluation methods for neutron cross section standards

    International Nuclear Information System (INIS)

    Bhat, M.R.

    1980-01-01

    Methods used to evaluate the neutron cross section standards are reviewed and their relative merits, assessed. These include phase-shift analysis, R-matrix fit, and a number of other methods by Poenitz, Bhat, Kon'shin and the Bayesian or generalized least-squares procedures. The problems involved in adopting these methods for future cross section standards evaluations are considered, and the prospects for their use, discussed. 115 references, 5 figures, 3 tables

  9. Rectangular-section mirror light pipes

    Energy Technology Data Exchange (ETDEWEB)

    Swift, P.D.; Lawlor, R. [School of Physical Sciences, Dublin City University, Dublin 9 (Ireland); Smith, G.B.; Gentle, A. [Department of Applied Physics, University of Technology, Sydney, Broadway, NSW 2007 (Australia)

    2008-08-15

    Using an integrated-ray approach an expression for the transmission of rectangular section mirror light pipe (MLP) has been derived for the case of collimated light input. The transmittance and the irradiance distribution at the exit aperture of rectangular-section MLPs have been measured experimentally and calculated theoretically for the case of collimated light input. The results presented extend the description of MLPs from the cylindrical case. Measured and calculated transmittances and irradiance distributions are in good agreement. (author)

  10. CT of the pelvis after cesarean section

    International Nuclear Information System (INIS)

    Twickler, D.; Setiawan, H.; Harrell, R.; Brown, C.E.L.

    1989-01-01

    Febrile morbidity following cesarean section is often evaluated with CT, although the CT appearance of the normal uterus has not been evaluated. This study was undertaken to learn the normal uterine appearance after cesarean section. To date, 15 women who also underwent bilateral tubal ligation have been studied. Six had a vertical uterine incision; nine had a low transverse incision. Contrast-enhanced pelvic CT was performed 1--5 days after surgery. All women were asymptomatic, with a normal postpartum course

  11. Cutting work in thick section cryomicrotomy.

    Science.gov (United States)

    Saubermann, A J; Riley, W D; Beeuwkes, R

    1977-09-01

    The forces during cryosectioning were measured using miniature strain gauges attached to a load cell fitted to the drive arm of the Porter-Blum MT-2 cryomicrotome. Work was calculated and the data normalized to a standard (1 mm X 1 mm X 0.5 micrometer) section. Thermal energy generated was also calculated. Five parameters were studied: cutting angle, thickness, temperature, hardness, and block shape. Force patterns could be divided into three major groups thought to represent cutting (Type I), large fracture planes greater than 10 micrometer in length (Type II), and small fracture planes less than 10 micrometer in length (Type III). Type I and Type II produced satisfactory sections. Work in cutting ranged from an average of 78.4 muJ to 568.8 muJ. Cutting angle and temperature had the greatest effect on sectioning. Heat generated would be sufficient to cause through-section melting for 0.5 micrometer thick sections assuming the worst possible case, namely that all heat went into the section without loss. Presence of a Type II pattern (large fracture pattern) is thought to be presumptive evidence against thawing.

  12. WheelerLab: An interactive program for sequence stratigraphic analysis of seismic sections, outcrops and well sections and the generation of chronostratigraphic sections and dynamic chronostratigraphic sections

    Science.gov (United States)

    Amosu, Adewale; Sun, Yuefeng

    WheelerLab is an interactive program that facilitates the interpretation of stratigraphic data (seismic sections, outcrop data and well sections) within a sequence stratigraphic framework and the subsequent transformation of the data into the chronostratigraphic domain. The transformation enables the identification of significant geological features, particularly erosional and non-depositional features that are not obvious in the original seismic domain. Although there are some software products that contain interactive environments for carrying out chronostratigraphic analysis, none of them are open-source codes. In addition to being open source, WheelerLab adds two important functionalities not present in currently available software: (1) WheelerLab generates a dynamic chronostratigraphic section and (2) WheelerLab enables chronostratigraphic analysis of older seismic data sets that exist only as images and not in the standard seismic file formats; it can also be used for the chronostratigraphic analysis of outcrop images and interpreted well sections. The dynamic chronostratigraphic section sequentially depicts the evolution of the chronostratigraphic chronosomes concurrently with the evolution of identified genetic stratal packages. This facilitates a better communication of the sequence-stratigraphic process. WheelerLab is designed to give the user both interactive and interpretational control over the transformation; this is most useful when determining the correct stratigraphic order for laterally separated genetic stratal packages. The program can also be used to generate synthetic sequence stratigraphic sections for chronostratigraphic analysis.

  13. WheelerLab: An interactive program for sequence stratigraphic analysis of seismic sections, outcrops and well sections and the generation of chronostratigraphic sections and dynamic chronostratigraphic sections

    Directory of Open Access Journals (Sweden)

    Adewale Amosu

    2017-01-01

    Full Text Available WheelerLab is an interactive program that facilitates the interpretation of stratigraphic data (seismic sections, outcrop data and well sections within a sequence stratigraphic framework and the subsequent transformation of the data into the chronostratigraphic domain. The transformation enables the identification of significant geological features, particularly erosional and non-depositional features that are not obvious in the original seismic domain. Although there are some software products that contain interactive environments for carrying out chronostratigraphic analysis, none of them are open-source codes. In addition to being open source, WheelerLab adds two important functionalities not present in currently available software: (1 WheelerLab generates a dynamic chronostratigraphic section and (2 WheelerLab enables chronostratigraphic analysis of older seismic data sets that exist only as images and not in the standard seismic file formats; it can also be used for the chronostratigraphic analysis of outcrop images and interpreted well sections. The dynamic chronostratigraphic section sequentially depicts the evolution of the chronostratigraphic chronosomes concurrently with the evolution of identified genetic stratal packages. This facilitates a better communication of the sequence-stratigraphic process. WheelerLab is designed to give the user both interactive and interpretational control over the transformation; this is most useful when determining the correct stratigraphic order for laterally separated genetic stratal packages. The program can also be used to generate synthetic sequence stratigraphic sections for chronostratigraphic analysis.

  14. 14 CFR Section 19 - Uniform Classification of Operating Statistics

    Science.gov (United States)

    2010-01-01

    ... Statistics Section 19 Section 19 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION... AIR CARRIERS Operating Statistics Classifications Section 19 Uniform Classification of Operating Statistics ...

  15. Obstetrical correlates of the first time cesarean section, compared with the repeated cesarean section

    International Nuclear Information System (INIS)

    Rukh, G.; Akhtar, S.

    2007-01-01

    To determine the clinical and epidemiological characteristics in patients having their first cesarean section (FCS) and compare it with findings in patients with repeated cesarean section (RCS). This study included all the women who gave birth by cesarean sections, 817 of the total 5992 deliveries, at this unit during the study period. Data on potential risk factors for the first cesarean section (FCS) and repeated cesarean section (RCS were extracted from medical records, which were reviewed and compared between these two groups of women. Data were statistically analyzed with student t-test for comparison between means and Chi-square test for comparison between percentages. Crude odds ratio (OR) with 95% confidence interval (95% CI) were calculated. Significance was taken at p 0.05). The frequency of first cesarean section and repeat cesarean section is high in our setup. Adequate following of the programs to diminish the percentage of FCS by curtailing its predisposing factors is needed. (author)

  16. A Pebble Bed Reactor cross section methodology

    International Nuclear Information System (INIS)

    Hudson, Nathanael H.; Ougouag, Abderrafi M.; Rahnema, Farzad; Gougar, Hans

    2009-01-01

    A method is presented for the evaluation of microscopic cross sections for the Pebble Bed Reactor (PBR) neutron diffusion computational models during convergence to an equilibrium (asymptotic) fuel cycle. This method considers the isotopics within a core spectral zone and the leakages from such a zone as they arise during reactor operation. The randomness of the spatial distribution of fuel grains within the fuel pebbles and that of the fuel and moderator pebbles within the core, the double heterogeneity of the fuel, and the indeterminate burnup of the spectral zones all pose a unique challenge for the computation of the local microscopic cross sections. As prior knowledge of the equilibrium composition and leakage is not available, it is necessary to repeatedly re-compute the group constants with updated zone information. A method is presented to account for local spectral zone composition and leakage effects without resorting to frequent spectrum code calls. Fine group data are pre-computed for a range of isotopic states. Microscopic cross sections and zone nuclide number densities are used to construct fine group macroscopic cross sections, which, together with fission spectra, flux modulation factors, and zone buckling, are used in the solution of the slowing down balance to generate a new or updated spectrum. The microscopic cross-sections are then re-collapsed with the new spectrum for the local spectral zone. This technique is named the Spectral History Correction (SHC) method. It is found that this method accurately recalculates local broad group microscopic cross sections. Significant improvement in the core eigenvalue, flux, and power peaking factor is observed when the local cross sections are corrected for the effects of the spectral zone composition and leakage in two-dimensional PBR test problems.

  17. Top quark production cross-section measurements

    CERN Document Server

    Chen, Ye; The ATLAS collaboration

    2017-01-01

    Measurements of the inclusive and differential cross-sections for top-quark pair and single top production cross sections in proton-proton collisions with the ATLAS detector at the Large Hadron Collider are presented at center-of-mass energies of 8 TeV and 13 TeV. The inclusive measurements reach high precision and are compared to the best available theoretical calculations. These measurements, including results using boosted tops, probe our understanding of top-pair production in the TeV regime. The results are compared to Monte Carlo generators implementing LO and NLO matrix elements matched with parton showers and NLO QCD calculations. For the t-channel single top measurement, the single top-quark and anti-top-quark total production cross-sections, their ratio, as well as differential cross sections are also presented. A measurement of the production cross-section of a single top quark in association with a W boson, the second largest single-top production mode, is also presented. Finally, measurements of ...

  18. Homogenized group cross sections by Monte Carlo

    International Nuclear Information System (INIS)

    Van Der Marck, S. C.; Kuijper, J. C.; Oppe, J.

    2006-01-01

    Homogenized group cross sections play a large role in making reactor calculations efficient. Because of this significance, many codes exist that can calculate these cross sections based on certain assumptions. However, the application to the High Flux Reactor (HFR) in Petten, the Netherlands, the limitations of such codes imply that the core calculations would become less accurate when using homogenized group cross sections (HGCS). Therefore we developed a method to calculate HGCS based on a Monte Carlo program, for which we chose MCNP. The implementation involves an addition to MCNP, and a set of small executables to perform suitable averaging after the MCNP run(s) have completed. Here we briefly describe the details of the method, and we report on two tests we performed to show the accuracy of the method and its implementation. By now, this method is routinely used in preparation of the cycle to cycle core calculations for HFR. (authors)

  19. Youssef’s Syndrome following Cesarean Section

    Directory of Open Access Journals (Sweden)

    Ozer Birge

    2015-01-01

    Full Text Available Youssef’s syndrome is characterized by cyclic hematuria (menouria, absence of vaginal bleeding (amenorrhea, and urinary incontinence due to vesicouterine fistula (VUF, the least common of the urogynecological fistulas. Youssef’s syndrome has a variable clinical presentation. A vesicouterine fistula is an abnormal pathway between the bladder and the uterus. The most common cause is lower segment Cesarean section. Conservative treatment may be appropriate in some cases, but surgery is the definitive treatment. Vesicouterine fistula should be suspected in cases presenting with urinary incontinence even years after Cesarean section. Diagnostic tests as well as necessary appropriate surgery should be performed on cases with suspected vesicouterine fistula. We present a 40-year-old multiparous woman with vesicouterine fistula after primary Cesarean section; she presented with urinary incontinence, hematuria, and amenorrhea 1 year after the birth. Here, we discuss our case with the help of previously published studies found in the literature.

  20. Information section of evolution of new technology

    Directory of Open Access Journals (Sweden)

    Straka Martin

    2001-12-01

    Full Text Available When the new technology is developed, the large amount of information is needed, at the beginning, also through development and there is large amount of data, information at the output, which create a manual, design procedure of the new technology. Evolution the new technology goes out from one primary original idea, or by the help of sectional or piecemeal solution come near into the bargain what we want to achieve research. Attempts and collection of information get in possession to results not only after information section, but also after technical - technological section. Another important of information source is quantity data receives from books, magazines, old planning documentation and nowadays also from Internet. This article contains the information gaining and the sources, which we have in disposal and which are necessary for developing the new technology from primary data at the beginning to data, which are gathered through development.

  1. Radioecological state of the Czechoslovakian Danube section

    International Nuclear Information System (INIS)

    Kortus, J.; Mayer, J.; Kopuncova, T.; Vondra, M.

    1984-01-01

    As to be able to determine the radioactivity of the Czechoslovak section of the Danube river monthly water sampling and quarterly sediment, aquatic flora, and fauna sampling was performed. The results of this investigation have shown that the radioactivity level of our Danube section is low, consisting mostly of natural radionuclides. No relationships among respective seasons and radioactivity level were observed, neither any significant dependencies between flow rate and radionuclide level. In spite of the low radioactivity of the Czechoslovak Danube section we assume it necessary to continue in carrying out radiological analyses of water and sediment samples, as well as aquatic flora and fauna, since there are some nuclear power plants already in operation in the Danube basin and further are to be constructed or are already under construction. (author)

  2. Photoproton cross section for /sup 19/F

    Energy Technology Data Exchange (ETDEWEB)

    Tsubota, H [Tohoku Univ., Sendai (Japan). Coll. of General Education; Kawamura, N; Oikawa, S; Uegaki, J I

    1975-02-01

    Proton energy spectra have been measured at 90/sup 0/ for the /sup 19/F(e,e'p)/sup 18/O reaction in the giant resonance region. The (..gamma..,p/sub 0/) and (..gamma..,p/sub 1/) differential cross sections are extracted from the proton energy spectra by using virtual-photon spectra. The integrated differential cross section of the (..gamma..,p/sub 0/) and (..gamma..,p/sub 1/) reactions are 1.80+-0.27 and 0.50+-0.45 MeV-mb/sr, respectively. The results are discussed with the shell model theory by comparing with the (..gamma..,p/sub 0/) cross section of the neighboring 4n-nucleus /sup 20/Ne. A significant increase of the proton yield leaving the non-ground states is found at 25 MeV of the incident electron energy. This is discussed in terms of the core excitation effect.

  3. Prospects for Precision Neutrino Cross Section Measurements

    Energy Technology Data Exchange (ETDEWEB)

    Harris, Deborah A. [Fermilab

    2016-01-28

    The need for precision cross section measurements is more urgent now than ever before, given the central role neutrino oscillation measurements play in the field of particle physics. The definition of precision is something worth considering, however. In order to build the best model for an oscillation experiment, cross section measurements should span a broad range of energies, neutrino interaction channels, and target nuclei. Precision might better be defined not in the final uncertainty associated with any one measurement but rather with the breadth of measurements that are available to constrain models. Current experience shows that models are better constrained by 10 measurements across different processes and energies with 10% uncertainties than by one measurement of one process on one nucleus with a 1% uncertainty. This article describes the current status of and future prospects for the field of precision cross section measurements considering the metric of how many processes, energies, and nuclei have been studied.

  4. NNLO jet cross sections by subtraction

    Energy Technology Data Exchange (ETDEWEB)

    Somogyi, G.; Bolzoni, P. [DESY, Platanenallee 6, D-15738 Zeuthen (Germany); Trocsanyi, Z. [CERN PH-TH, on leave from University of Debrecen and Institute of Nuclear Research of HAS, H-4001 P.O.Box 51 (Hungary)

    2010-08-15

    We report on the computation of a class of integrals that appear when integrating the so-called iterated singly-unresolved approximate cross section of the NNLO subtraction scheme of Refs. [G. Somogyi, Z. Trocsanyi, and V. Del Duca, JHEP 06, 024 (2005), (arXiv:hep-ph/0502226); G. Somogyi and Z. Trocsanyi, (2006), (arXiv:hep-ph/0609041); G. Somogyi, Z. Trocsanyi, and V. Del Duca, JHEP 01, 070 (2007), (arXiv:hep-ph/0609042); G. Somogyi and Z. Trocsanyi, JHEP 01, 052 (2007), (arXiv:hep-ph/0609043)] over the factorised phase space of unresolved partons. The integrated approximate cross section itself can be written as the product of an insertion operator (in colour space) times the Born cross section. We give selected results for the insertion operator for processes with two and three hard partons in the final state.

  5. NNLO jet cross sections by subtraction

    International Nuclear Information System (INIS)

    Somogyi, G.; Bolzoni, P.; Trocsanyi, Z.

    2010-01-01

    We report on the computation of a class of integrals that appear when integrating the so-called iterated singly-unresolved approximate cross section of the NNLO subtraction scheme of Refs. [G. Somogyi, Z. Trocsanyi, and V. Del Duca, JHEP 06, 024 (2005), (arXiv:hep-ph/0502226); G. Somogyi and Z. Trocsanyi, (2006), (arXiv:hep-ph/0609041); G. Somogyi, Z. Trocsanyi, and V. Del Duca, JHEP 01, 070 (2007), (arXiv:hep-ph/0609042); G. Somogyi and Z. Trocsanyi, JHEP 01, 052 (2007), (arXiv:hep-ph/0609043)] over the factorised phase space of unresolved partons. The integrated approximate cross section itself can be written as the product of an insertion operator (in colour space) times the Born cross section. We give selected results for the insertion operator for processes with two and three hard partons in the final state.

  6. Optical Model and Cross Section Uncertainties

    Energy Technology Data Exchange (ETDEWEB)

    Herman,M.W.; Pigni, M.T.; Dietrich, F.S.; Oblozinsky, P.

    2009-10-05

    Distinct minima and maxima in the neutron total cross section uncertainties were observed in model calculations using spherical optical potential. We found this oscillating structure to be a general feature of quantum mechanical wave scattering. Specifically, we analyzed neutron interaction with 56Fe from 1 keV up to 65 MeV, and investigated physical origin of the minima.We discuss their potential importance for practical applications as well as the implications for the uncertainties in total and absorption cross sections.

  7. The method of sections in molecular physics

    International Nuclear Information System (INIS)

    Natarajan, P.; Zygelman, B.

    1993-01-01

    In the standard Born-Oppenheimer theory the nuclear wave-function for a bound, rotating, di-atom system is described by the Wigner functions. Unlike the spherical harmonics, the Wigner functions exhibit cusp singularities at the poles of the space-fixed coordinate system. These singularities are identical to the ones encountered in the quantum mechanics treatment of a charged particle under the influence of a magnetic monopole. In the latter case the method of sectional was introduced to eliminate the singularities. The method of sections was also introduced in molecular physics. We discuss here, in detail, their properties and advantage of using this construction in molecular physics

  8. Introduction to the Volume's Two Thematic Sections

    Directory of Open Access Journals (Sweden)

    Christopher Chase-Dunn

    2015-08-01

    Full Text Available The first batch contains an article by Political Scientist Daniel Whitcncck on epistemic communities and global leadership and a special thematic section focussing around the ideas ofW. Warren Wagar regarding the future of the world-system and global politics. The second batch of papers in Volume 2 has been edited by P. Nick Kardulias of the Department of Anthropology and Sociology at Kenyon College. This special thematic section focusses on anthropological and archaeological approaches to the study of world systems.

  9. Cross sections for charm production by neutrinos

    Energy Technology Data Exchange (ETDEWEB)

    Ushida, N [Aichi Univ. of Education, Kariya (Japan). Dept. of Physics; Kondo, T [Fermi National Accelerator Lab., Batavia, IL (USA); Fujioka, G; Fukushima, J; Takahashi, Y; Tatsumi, S; Yokoyama, C [Kobe Univ. (Japan). Dept. of Physics; Homma, Y; Tsuzuki, Y [Kobe Univ. (Japan). Coll. of Liberal Arts; Bahk, S

    1983-02-03

    The production of charmed particles has been measured using a hybrid emulsion spectrometer in the Fermilab wide-band neutrino beam. The relative cross section for charged current charmed particle production is sigma(v -> ..mu../sup -/c)/sigma(v -> ..mu../sup -/) = 6.5 +- 1.9/1.8%, and the energy dependence of the cross section is presented. One event with charm pair production was observed. A limit of sigma(v -> ..mu..canti c)/sigma(v -> ..mu..c) < 6% (90% CL) is found for the ratio of charged current pair and single charm production.

  10. Route 6, Section Pristina – Skopje

    OpenAIRE

    , F. Isufi; , N. Kelmendi; , F. Humolli; , S. Bulliqi

    2016-01-01

    Republic of Kosovo in the last 3-4 years has improved the road infrastructure, among others, by improving conditions for the needs of citizens of the country and by meeting the requirements of international organizations who are seeking with the right that the region of South-East to have the performance equivalent to EU standards. Section Pristina-Skopje of Route 6 represents one of the most important sections of this road going through important parts of the country and enabling direct link...

  11. Reactor Section standard analytical methods. Part 1

    Energy Technology Data Exchange (ETDEWEB)

    Sowden, D.

    1954-07-01

    the Standard Analytical Methods manual was prepared for the purpose of consolidating and standardizing all current analytical methods and procedures used in the Reactor Section for routine chemical analyses. All procedures are established in accordance with accepted practice and the general analytical methods specified by the Engineering Department. These procedures are specifically adapted to the requirements of the water treatment process and related operations. The methods included in this manual are organized alphabetically within the following five sections which correspond to the various phases of the analytical control program in which these analyses are to be used: water analyses, essential material analyses, cotton plug analyses boiler water analyses, and miscellaneous control analyses.

  12. Cesarean section changes neonatal gut colonization

    DEFF Research Database (Denmark)

    Stokholm, Jakob; Thorsen, Jonathan; Chawes, Bo L

    2016-01-01

    BACKGROUND: Delivery by means of cesarean section has been associated with increased risk of childhood immune-mediated diseases, suggesting a role of early bacterial colonization patterns for immune maturation. OBJECTIVE: We sought to describe the influence of delivery method on gut and airway......-driven partial least squares analyses. The initial airway microbiota was unaffected by birth method. CONCLUSION: Delivery by means of cesarean section was associated with early colonization patterns of the neonatal gut but not of the airways. The differences normalized within the first year of life. We speculate...

  13. Surface tensor estimation from linear sections

    DEFF Research Database (Denmark)

    Kousholt, Astrid; Kiderlen, Markus; Hug, Daniel

    From Crofton's formula for Minkowski tensors we derive stereological estimators of translation invariant surface tensors of convex bodies in the n-dimensional Euclidean space. The estimators are based on one-dimensional linear sections. In a design based setting we suggest three types of estimators....... These are based on isotropic uniform random lines, vertical sections, and non-isotropic random lines, respectively. Further, we derive estimators of the specific surface tensors associated with a stationary process of convex particles in the model based setting....

  14. Surface tensor estimation from linear sections

    DEFF Research Database (Denmark)

    Kousholt, Astrid; Kiderlen, Markus; Hug, Daniel

    2015-01-01

    From Crofton’s formula for Minkowski tensors we derive stereological estimators of translation invariant surface tensors of convex bodies in the n-dimensional Euclidean space. The estimators are based on one-dimensional linear sections. In a design based setting we suggest three types of estimators....... These are based on isotropic uniform random lines, vertical sections, and non-isotropic random lines, respectively. Further, we derive estimators of the specific surface tensors associated with a stationary process of convex particles in the model based setting....

  15. Covariance Evaluation Methodology for Neutron Cross Sections

    Energy Technology Data Exchange (ETDEWEB)

    Herman,M.; Arcilla, R.; Mattoon, C.M.; Mughabghab, S.F.; Oblozinsky, P.; Pigni, M.; Pritychenko, b.; Songzoni, A.A.

    2008-09-01

    We present the NNDC-BNL methodology for estimating neutron cross section covariances in thermal, resolved resonance, unresolved resonance and fast neutron regions. The three key elements of the methodology are Atlas of Neutron Resonances, nuclear reaction code EMPIRE, and the Bayesian code implementing Kalman filter concept. The covariance data processing, visualization and distribution capabilities are integral components of the NNDC methodology. We illustrate its application on examples including relatively detailed evaluation of covariances for two individual nuclei and massive production of simple covariance estimates for 307 materials. Certain peculiarities regarding evaluation of covariances for resolved resonances and the consistency between resonance parameter uncertainties and thermal cross section uncertainties are also discussed.

  16. Broad ion beam serial section tomography

    Energy Technology Data Exchange (ETDEWEB)

    Winiarski, B., E-mail: b.winiarski@manchester.ac.uk [School of Materials, University of Manchester, Manchester M13 9PL (United Kingdom); Materials Division, National Physical Laboratory, Teddington TW11 0LW (United Kingdom); Gholinia, A. [School of Materials, University of Manchester, Manchester M13 9PL (United Kingdom); Mingard, K.; Gee, M. [Materials Division, National Physical Laboratory, Teddington TW11 0LW (United Kingdom); Thompson, G.E.; Withers, P.J. [School of Materials, University of Manchester, Manchester M13 9PL (United Kingdom)

    2017-01-15

    Here we examine the potential of serial Broad Ion Beam (BIB) Ar{sup +} ion polishing as an advanced serial section tomography (SST) technique for destructive 3D material characterisation for collecting data from volumes with lateral dimensions significantly greater than 100 µm and potentially over millimetre sized areas. Further, the associated low level of damage introduced makes BIB milling very well suited to 3D EBSD acquisition with very high indexing rates. Block face serial sectioning data registration schemes usually assume that the data comprises a series of parallel, planar slices. We quantify the variations in slice thickness and parallelity which can arise when using BIB systems comparing Gatan PECS and Ilion BIB systems for large volume serial sectioning and 3D-EBSD data acquisition. As a test case we obtain 3D morphologies and grain orientations for both phases of a WC-11%wt. Co hardmetal. In our case we have carried out the data acquisition through the manual transfer of the sample between SEM and BIB which is a very slow process (1–2 slice per day), however forthcoming automated procedures will markedly speed up the process. We show that irrespective of the sectioning method raw large area 2D-EBSD maps are affected by distortions and artefacts which affect 3D-EBSD such that quantitative analyses and visualisation can give misleading and erroneous results. Addressing and correcting these issues will offer real benefits when large area (millimetre sized) automated serial section BIBS is developed. - Highlights: • In this work we examine how microstructures can be reconstructed in three-dimensions (3D) by serial argon broad ion beam (BIB) milling, enabling much larger volumes (>250×250×100µm{sup 3}) to be acquired than by serial section focused ion beam-scanning electron microscopy (FIB-SEM). • The associated low level of damage introduced makes BIB milling very well suited to 3D-EBSD acquisition with very high indexing rates. • We explore

  17. Optically sectioned imaging by oblique plane microscopy

    Science.gov (United States)

    Kumar, Sunil; Lin, Ziduo; Lyon, Alex R.; MacLeod, Ken T.; Dunsby, Chris

    2011-03-01

    Oblique Plane Microscopy (OPM) is a light sheet microscopy technique that combines oblique illumination with correction optics that tilt the focal plane of the collection system. OPM can be used to image conventionally mounted specimens on coverslips or tissue culture dishes and has low out-of-plane photobleaching and phototoxicity. No moving parts are required to achieve an optically sectioned image and so high speed optically sectioned imaging is possible. The first OPM results obtained using a high NA water immersion lens on a commercially available inverted microscope frame are presented, together with a measurement of the achievable optical resolution.

  18. The second section of Delphos photovoltaic plant

    Energy Technology Data Exchange (ETDEWEB)

    Barra, L; Li Causi, S; Calogero, D; Sarno, A

    1989-03-01

    The 300 kWp photovoltaic (PV) system that will constitute the second section of the Delphos plant is made up by three 100 kWp modular standard units (PLUG), parallel connected to the grid. In this paper, the PV array, the power conditioning unit and the overall architecture of the standard unit are described and the relevant differences with respect to the first Delphos section are discussed. It is explained how the use of modular standardized units allows a substantial reduction of construction, installation and operations costs. Finally, a short evaluation of the expected energy cost is presented.

  19. 2010 ANNUAL MEETING ON NUCLEAR TECHNOLOGY. Pt. 4. Section reports

    International Nuclear Information System (INIS)

    Berlepsch, Thilo v.; Hering, Wolfgang

    2011-01-01

    Summary report on 2 Sessions of Section: - New Build and Innovations (Section 12) of the ANNUAL MEETING On NUCLEAR TECHNOLOGY held in Berlin on May 4 to 6, 2010. The other Sections 'Reactor Physics and Methods of Calculation (Section 1)', 'Thermodynamics and Fluid Dynamics (Section 2)', 'Safety of Nuclear Installations - Methods, Analysis, Results (Section 3)', 'Front End and Back End of the Fuel Cycle, Radioactive Waste, Storage (Section 4)', 'Front End of the Fuel Cycle, Fuel Elements and Core Components (Section 5)', 'Operation of Nuclear Installations (Section 6)', 'Decommissioning of Nuclear Installations (Section 7)', 'Fusion Technology (Section 8)', 'Energy Industry and Economics (Section 10)', 'Radiation Protection (Section 11)', 'New Build and Innovations (Session New Build and Innovations, Section 12)', and 'Education, Expert Knowledge, Know-how-Transfer (Section 13)' have been covered in atw issues 10, 11 and 12 (2010). (orig.)

  20. Note from the Radioactive Waste Section

    CERN Multimedia

    TS Department

    2008-01-01

    The Radioactive Waste Section of the Radiation Protection Group wishes to announce that the radioactive waste treatment centre will be closed on Friday, 19 December. In addition, waste reception will be limited to a strict minimum on Thursday, 18 December. Users of the centre are requested to adjust their plans accordingly. For more information, call 73875.

  1. 76 FR 12760 - Section 302 Report

    Science.gov (United States)

    2011-03-08

    ... LIBRARY OF CONGRESS Copyright Office [Docket No. RM 2010-10] Section 302 Report AGENCY: Copyright Office, Library of Congress. ACTION: Notice of inquiry; correction. SUMMARY: The Copyright Office... a report to Congress addressing possible recommendations for phasing out the statutory licensing...

  2. Ecological Panel Inference from Repeated Cross Sections

    NARCIS (Netherlands)

    Pelzer, Ben; Eisinga, Rob; Franses, Philip Hans

    2004-01-01

    This chapter presents a Markov chain model for the estimation of individual-level binary transitions from a time series of independent repeated cross-sectional (RCS) samples. Although RCS samples lack direct information on individual turnover, it is demonstrated here that it is possible with these

  3. Validation of evaluated neutron standard cross sections

    International Nuclear Information System (INIS)

    Badikov, S.; Golashvili, T.

    2008-01-01

    Some steps of the validation and verification of the new version of the evaluated neutron standard cross sections were carried out. In particular: -) the evaluated covariance data was checked for physical consistency, -) energy-dependent evaluated cross-sections were tested in most important neutron benchmark field - 252 Cf spontaneous fission neutron field, -) a procedure of folding differential standard neutron data in group representation for preparation of specialized libraries of the neutron standards was verified. The results of the validation and verification of the neutron standards can be summarized as follows: a) the covariance data of the evaluated neutron standards is physically consistent since all the covariance matrices of the evaluated cross sections are positive definite, b) the 252 Cf spectrum averaged standard cross-sections are in agreement with the evaluated integral data (except for 197 Au(n,γ) reaction), c) a procedure of folding differential standard neutron data in group representation was tested, as a result a specialized library of neutron standards in the ABBN 28-group structure was prepared for use in reactor applications. (authors)

  4. Integrated two-section discrete mode laser

    NARCIS (Netherlands)

    Anandarajah, P.M.; Latkowski, S.; Browning, C.; Zhou, R.; O'Carroll, J.; Phelan, R.; Kelly, B.; O'Gorman, J.; Barry, L.P.

    2012-01-01

    The authors present the design and characterization of a novel integrated two-section discrete mode index patterned diode laser source. The two slotted regions etched into the laser ridge waveguide are formed in the same fabrication step as the ridge, thus avoiding the requirement for complex

  5. Developments in the Law--Section 1981.

    Science.gov (United States)

    Aguilar, Javier; And Others

    1980-01-01

    Reviews the history and current state of the law under Section 1981 of the Civil Rights Act of 1866. Suggests how it may be interpreted to maintain its vitality as a guarantee of racial equality. Considers actionable discrimination claims, protected interests, prima facie evidence, constitutional defenses, immunities, and procedural issues.…

  6. Stability of tokamaks with elongated cross section

    International Nuclear Information System (INIS)

    An, C.H.; Bateman, G.

    1978-08-01

    Fixed boundary n = 1 MHD instabilities are studied computationally as a function of diamagnetism (β/sub pol/) and current profile in elongated toroidal equilibria (1 2) or a diamagnetic plasma (β/sub pol/ > 1) with only a mildly elongated cross section

  7. Modelisation of the fission cross section

    International Nuclear Information System (INIS)

    Morariu, Claudia

    2013-03-01

    The neutron cross sections of four nuclear systems (n+ 235 U, n+ 233 U, n+ 241 Am and n+ 237 Np) are studied in the present document. The target nuclei of the first case, like 235 U and 239 Pu, have a large fission cross section after the absorption of thermal neutrons. These nuclei are called 'fissile' nuclei. The other type of nuclei, like 237 Np and 241 Am, fission mostly with fast neutrons, which exceed the fission threshold energy. These types of nuclei are called 'fertile'. The compound nuclei of the fertile nuclei have a binding energy higher than the fission barrier, while for the fissile nuclei the binding energy is lower than the fission barrier. In this work, the neutron induced cross sections for both types of nuclei are evaluated in the fast energy range. The total, reaction and shape-elastic cross sections are calculated by the coupled channel method of the optical model code ECIS, while the compound nucleus mechanism are treated by the statistical models implemented in the codes STATIS, GNASH and TALYS. The STATIS code includes a refined model of the fission process. Results from the theoretical calculations are compared with data retrieved from the experimental data base EXFOR. (author) [fr

  8. Sectioning Clay Models Makes Anatomy & Development Tangible

    Science.gov (United States)

    Howell, Carina Endres; Howell, James Endres

    2010-01-01

    Clay models have proved to be useful teaching aids for many topics in biology that depend on three-dimensional reasoning. Students studying embryonic development struggle to mentally reconstruct the three-dimensional structure of embryos and larvae by observing prepared slides of cross-sectional slices. Students who build clay models of embryos…

  9. Photoelectric absorption cross sections with variable abundances

    Science.gov (United States)

    Balucinska-Church, Monika; Mccammon, Dan

    1992-01-01

    Polynomial fit coefficients have been obtained for the energy dependences of the photoelectric absorption cross sections of 17 astrophysically important elements. These results allow the calculation of X-ray absorption in the energy range 0.03-10 keV in material with noncosmic abundances.

  10. Section XI -- 25 years of development

    International Nuclear Information System (INIS)

    Hedden, O.F.

    1996-01-01

    The original concept of nuclear power plant designers was that the higher standards of design and fabrication would make inservice inspections unnecessary, and little attention was given to provisions for access. By 1966 the Atomic Energy Commission recognized that a planned program of periodic inservice inspections would be needed. They began development of criteria, and encouraged industry code-writing organizations to do likewise. These groups joined forces in 1968, and their product was published by ASME in 1970 as part of the Boiler and Pressure Code, Section XI, Rules for Inservice Inspection of Nuclear Reactor Coolant Systems. Section XI, 24 pages in 1970, is now 723 pages. While it originally covered only light water reactor Class 1 components and piping, it now includes Class 2, 3, and containment, and liquid metal cooled reactor plants. Along the way, rules have been developed for gas-cooled and low pressure heavy water reactor plants. The growth in size of Section XI from its modest beginning has been largely because of recognition that the rules governing plant inspection/operation need to be considerably different from the rules provided for the component designer/manufacturer. Rules have been developed in the areas of repair/replacement technology, NDE methodology, NDE acceptance standards, and analytical evaluation methods in the absence of appropriate rules in Section III

  11. Section 609 Technician Training and Certification Programs

    Science.gov (United States)

    EPA-approved programs for technicians who service motor vehicle air conditioning (MVAC) systems. Any person who repairs or services a MVAC system for consideration must be certified under section 609 of the Clean Air Act by an EPA-approved program.

  12. Reestablishment of Pycreus section Tuberculati (Cyperaceae)

    NARCIS (Netherlands)

    Reynders, M.; Goetghebeur, P.

    2010-01-01

    Pycreus sect. Tuberculati was created by Chermezon to contain a single species with derived nutlets: P. divulsus, a Malagasy endemic. Kükenthal transferred this species to his new section Muricati. However, a detailed study of the nutlet epidermis shows P. divulsus is not closely related to the

  13. (, 3) Differential cross section of He

    Indian Academy of Sciences (India)

    The angular distribution of the five-fold differential cross section for the electron impact double ionization of He (21 ) and He (23 ) has been studied. The kinematical conditions for maxima/minima in the angular distribution for the two cases have been compared. The two-step process for the double ionization is found to ...

  14. Post caesarean section anterior abdominal wall endometriosis ...

    African Journals Online (AJOL)

    Abdominal wall endometriosis is a likely sequelae of caesarean section as viable endometrial tissue are deposited in the peritoneal cavity or anterior abdominal wall. One such case to sensitize clinicians of this rare presentation of the disease is presented. The patient was a 48 year old woman who presented with a lesion ...

  15. Precise relative cross sections for np scattering

    International Nuclear Information System (INIS)

    Goetz, J.; Brogli-Gysin, C.; Hammans, M.; Haffter, P.; Henneck, R.; Jourdan, J.; Masson, G.; Qin, L.M.; Robinson, S.; Sick, I.; Tuccillo, M.

    1994-01-01

    We present data on the differential cross section for neutron-proton scattering for an incident neutron energy of 67 MeV. These data allow a precise determination of the 1 P 1 phase which, in phase-shift analyses, is strongly correlated with the S-D amplitude which we are measuring via different observables. ((orig.))

  16. Predicting spinal hypotension during Caesarean section

    African Journals Online (AJOL)

    There is a significant body of recent work which has looked at the haemodynamic changes which occur under spinal anaesthesia and the effects of various treatment regimens on these changes. It has long been held that the dominant mechanism of hypotension in the patient for Caesarean section is caval compression.9.

  17. Educational strategies in performing cesarean section

    DEFF Research Database (Denmark)

    Madsen, Kristine; Grønbeck, Lene; Larsen, Christian Rifbjerg

    2012-01-01

    Cesarean section is a common operation and one of the first surgeries performed independently by trainees/residents in obstetrics and gynecology. Determination of trainees' technical skills level is dependent upon subjective faculty assessment. Based on three studies on learning curves in cesarea...... Acta Obstetricia et Gynecologica Scandinavica © 2012 Nordic Federation of Societies of Obstetrics and Gynecology....

  18. Caesarean section in Eisenmenger's syndrome: anaesthetic ...

    African Journals Online (AJOL)

    pulmonary artery pressures as measured from tricuspid regurgitant jet by transthoracic echocardiography. The postoperative period was uneventful in both patients. A slow induction of epidural anaesthesia can be a safe mode of anaesthesia for Caesarean section in pregnant patients with Eisenmenger's syndrome.

  19. Asia Section. Regional Activities Division. Paper.

    Science.gov (United States)

    International Federation of Library Associations, The Hague (Netherlands).

    Two papers on library and information activities in developing nations, particularly in India and other Asian countries, were presented at the 1983 International Federation of Library Associations (IFLA) conference. In "IFLA in Asia: A Review of the Work of the Regional Section for Asia," Edward Lim Huck Tee (Malaysia) describes the low…

  20. Symmetric charge transfer cross section of uranium

    International Nuclear Information System (INIS)

    Shibata, Takemasa; Ogura, Koichi

    1995-03-01

    Symmetric charge transfer cross section of uranium was calculated under consideration of reaction paths. In the charge transfer reaction a d 3/2 electron in the U atom transfers into the d-electron site of U + ( 4 I 9/2 ) ion. The J value of the U atom produced after the reaction is 6, 5, 4 or 3, at impact energy below several tens eV, only resonant charge transfer in which the product atom is ground state (J=6) takes place. Therefore, the cross section is very small (4-5 x 10 -15 cm 2 ) compared with that considered so far. In the energy range of 100-1000eV the cross section increases with the impact energy because near resonant charge transfer in which an s-electron in the U atom transfers into the d-electron site of U + ion. Charge transfer cross section between U + in the first excited state (289 cm -1 ) and U in the ground state was also obtained. (author)

  1. Section of CMS Beam Pipe Removed

    CERN Multimedia

    2013-01-01

    Seven components of the beam pipe located at the heart of the CMS detector were removed in recent weeks. The delicate operations were performed in several stages as the detector was opened. Video of the extraction of one section: http://youtu.be/arGuFgWM7u0

  2. Thin-section CT of Cushing's disease

    International Nuclear Information System (INIS)

    Takahashi, Tatsuo; Kuwayama, Akio; Katoh, Tetsuo; Ichihara, Kaoru; Kageyama, Naoki; Nakamura, Koji.

    1983-01-01

    Using 1.5 mm contiguous sections with a GE CT/T 8800 scanner, we investigated the sellar regions of 22 cases of Cushing's diseases which had been diagnosed endocrinologically. Each sellar turcica was normal in size, and in only 5 cases were there significant findings on 2 mm-thick sellar-floor polytomography. Nine tumors appeared as regions of a hypodense area, and three tumors were diagnosed by indirect signs, for example, stalk deviation and diaphragmatic plane asymmetry. The other 10 cases, especially those previously operated on or irradiated, were diagnosed as falsely positive or negative. Because it is best of the microadenomas appear hypodense within the strongly contrast-enhanced anterior pituitary glands, it is better for scans to be obtained immediately after rapid intravenous contrast infusion. Hypodense areas of microadenomas are best demonstrated on direct coronal scans or reversed scans of 1.5 mm-thickness thin-slice sections. By these methods, microadenomas, if they are over 5-6 mm in diameter, can appear as hypodense. Sellar floor findings by means of thin-section CT were more sensitive than those of polytomography and had more advantages in local diagnosis. If the tumor were over 4 mm in diameter, local changes in the sellar floor could be demonstrated by thin-section CT, but by polytomography no changes in the sellar floor could be demonstrated until the tumor size reached 6 mm. (author)

  3. LAMBDA p total cross-section measurement

    CERN Multimedia

    CERN PhotoLab

    1970-01-01

    A view of the apparatus used for the LAMBDA p total cross-section measurement at the time of its installation. The hyperons decaying into a proton and a pion in the conical tank in front were detected in the magnet spectrometer in the upper half of the picture. A novel detection technique using exclusively multiwire proportional chambers was employed.

  4. Ga-67 uptake post cesarean section

    Energy Technology Data Exchange (ETDEWEB)

    Lopez, O.L.; Maisano, E.R.

    1984-02-01

    Gallium-67 distribution in normal patients is well known; it is also known that the concentration in some tissues may vary according to an individual physiologic stimulus. In this report, the case of a young woman is presented who was studied 15 days after a cesarean section and showed physiologic and pathologic Ga-67 accumulation.

  5. Ga-67 uptake post cesarean section

    International Nuclear Information System (INIS)

    Lopez, O.L.; Maisano, E.R.

    1984-01-01

    Gallium-67 distribution in normal patients is well known; it is also known that the concentration in some tissues may vary according to an individual physiologic stimulus. In this report, the case of a young woman is presented who was studied 15 days after a cesarean section and showed physiologic and pathologic Ga-67 accumulation

  6. Cesarean section among immigrants in Norway.

    Science.gov (United States)

    Vangen, S; Stoltenberg, C; Skrondal, A; Magnus, P; Stray-Pedersen, B

    2000-07-01

    We studied prevalences and risk factors for cesarean section among different groups of immigrants from countries outside Western Europe and North America in comparison to ethnic Norwegians. The study is population based using data from the Medical Birth Registry of Norway. A total of 553,491 live births during the period 1986-1995 were studied, including 17,891 births to immigrant mothers. The prevalences of cesarean section ranged from 10.1% among women from Vietnam to 25.8% in the group of Filipino origin. The use of abdominal delivery was also high in the groups from Sri Lanka/India (21.3%), Somalia/Eritrea/Ethiopia (20.5%) and Chile/Brazil (24.3%), while the frequency among women from Turkey/Morocco (12.6%) and Pakistan (13.2%) was approximately the same as among ethnic Norwegians (12.4%). Feto-pelvic disproportion, fetal distress and prolonged labor were the most important diagnoses associated with the high prevalences, but the significance of these diagnoses differed among the groups. Other unknown factors come into play, particularly among women from Somalia/Eritrea/Ethiopia and Chile/Brazil. There was substantial variation in the use of cesarean section among ethnic groups in Norway. The diagnoses feto-pelvic disproportion, fetal distress and prolonged labor may be confounded by a number of factors including maternal request for cesarean section and difficulties in handling the delivery. Further research is needed to explain the observed differences.

  7. Beam line from straight-section 16

    CERN Multimedia

    CERN PhotoLab

    1971-01-01

    The start of a long trail. The beam line from straight-section 16, where protons are fast ejected, is seen at the point where it crosses the Linac shielding wall as it leaves the PS en route to the ISR.

  8. Measurement cross sections for radioisotopes production

    International Nuclear Information System (INIS)

    Garrido, E.

    2011-01-01

    New radioactive isotopes for nuclear medicine can be produced using particle accelerators. This is one goal of Arronax, a high energy - 70 MeV - high intensity - 2*350 μA - cyclotron set up in Nantes. A priority list was established containing β - - 47 Sc, 67 Cu - β + - 44 Sc, 64 Cu, 82 Sr/ 82 Rb, 68 Ge/ 68 Ga - and α emitters - 211 At. Among these radioisotopes, the Scandium 47 and the Copper 67 have a strong interest in targeted therapy. The optimization of their productions required a good knowledge of their cross-sections but also of all the contaminants created during irradiation. We launched on Arronax a program to measure these production cross-sections using the Stacked-Foils' technique. It consists in irradiating several groups of foils - target, monitor and degrader foils - and in measuring the produced isotopes by γ-spectrometry. The monitor - nat Cu or nat Ni - is used to correct beam loss whereas degrader foils are used to lower beam energy. We chose to study the nat Ti(p,X) 47 Sc and 68 Zn(p,2p) 67 Cu reactions. Targets are respectively natural Titanium foil - bought from Goodfellow - and enriched Zinc 68 deposited on Silver. In the latter case, Zn targets were prepared in-house - electroplating of 68 Zn - and a chemical separation between Copper and Gallium isotopes has to be made before γ counting. Cross-section values for more than 40 different reactions cross-sections have been obtained from 18 MeV to 68 MeV. A comparison with the Talys code is systematically done. Several parameters of theoretical models have been studied and we found that is not possible to reproduce faithfully all the cross-sections with a given set of parameters. (author)

  9. Rotational averaging of multiphoton absorption cross sections

    Energy Technology Data Exchange (ETDEWEB)

    Friese, Daniel H., E-mail: daniel.h.friese@uit.no; Beerepoot, Maarten T. P.; Ruud, Kenneth [Centre for Theoretical and Computational Chemistry, University of Tromsø — The Arctic University of Norway, N-9037 Tromsø (Norway)

    2014-11-28

    Rotational averaging of tensors is a crucial step in the calculation of molecular properties in isotropic media. We present a scheme for the rotational averaging of multiphoton absorption cross sections. We extend existing literature on rotational averaging to even-rank tensors of arbitrary order and derive equations that require only the number of photons as input. In particular, we derive the first explicit expressions for the rotational average of five-, six-, and seven-photon absorption cross sections. This work is one of the required steps in making the calculation of these higher-order absorption properties possible. The results can be applied to any even-rank tensor provided linearly polarized light is used.

  10. Measurements of neutron spallation cross section. 2

    Energy Technology Data Exchange (ETDEWEB)

    Kim, E.; Nakamura, T. [Tohoku Univ., Sendai (Japan). Cyclotron and Radioisotope Center; Imamura, M.; Nakao, N.; Shibata, S.; Uwamino, Y.; Nakanishi, N.; Tanaka, Su.

    1997-03-01

    Neutron spallation cross section of {sup 59}Co(n,xn){sup 60-x}Co, {sup nat}Cu(n,sp){sup 56}Mn, {sup nat}Cu(n,sp){sup 58}Co, {sup nat}Cu(n,xn){sup 60}Cu, {sup nat}Cu(n,xn){sup 61}Cu and {sup nat}Cu(n,sp){sup 65}Ni was measured in the quasi-monoenergetic p-Li neutron fields in the energy range above 40 MeV which have been established at three AVF cyclotron facilities of (1) INS of Univ. of Tokyo, (2) TIARA of JAERI and (3) RIKEN. Our experimental data were compared with the ENDF/B-VI high energy file data by Fukahori and the calculated cross section data by Odano. (author)

  11. Structured ion impact: Doubly differential cross sections

    International Nuclear Information System (INIS)

    DuBois, R.D.

    1987-01-01

    The electron emission in coincidence with a projectile that has been ionized has been measured, thus making it possible to separate and identify electrons resulting from these various mechanisms. In 1985, coincidence doubly differential cross sections were measured for 400 to 750 keV/atomic mass unit (amu) He + impact on He, Ne, Ar, Kr, and H 2 O. Cross sections were measured for selected angles and for electron energies ranging from 10 to 1000 eV. Because of the coincidence mode of measurement, the total electron emission was subdivided into its target emission and its projectile emission components. The most interesting findings were that target ionization does not account for the electron emission spectrum at lower electron energies. A sizable percentage of these low-energy electrons were shown to originate as a result of simultaneous projectile/target ionizations. Similar features were observed for all targets and impact energies that were studied

  12. Electron-collision cross sections for iodine

    International Nuclear Information System (INIS)

    Zatsarinny, O.; Bartschat, K.; Garcia, G.; Blanco, F.; Hargreaves, L.R.; Jones, D.B.; Murrie, R.; Brunton, J.R.; Brunger, M.J.; Hoshino, M.; Buckman, S.J.

    2011-01-01

    We present results from a joint experimental and theoretical study of elastic electron scattering from atomic iodine. The experimental results were obtained by subtracting known cross sections from the measured data obtained with a pyrolyzed mixed beam containing a variety of atomic and molecular species. The calculations were performed using both a fully relativistic Dirac B-spline R-matrix (close-coupling) method and an optical model potential approach. Given the difficulty of the problem, the agreement between the two sets of theoretical predictions and the experimental data for the angle-differential and the angle-integrated elastic cross sections at 40 eV and 50 eV is satisfactory.

  13. Achondroplasia: anaesthetic challenges for caesarean section.

    Science.gov (United States)

    Dubiel, L; Scott, G A; Agaram, R; McGrady, E; Duncan, A; Litchfield, K N

    2014-08-01

    Pregnancy in women with achondroplasia presents major challenges for anaesthetists and obstetricians. We report the case of a woman with achondroplasia who underwent general anaesthesia for an elective caesarean section. She was 99cm in height and her condition was further complicated by severe kyphoscoliosis and previous back surgery. She was reviewed in the first trimester at the anaesthetic high-risk clinic. A multidisciplinary team was convened to plan her peripartum care. Because of increasing dyspnoea caesarean section was performed at 32weeks of gestation. She received a general anaesthetic using a modified rapid-sequence technique with remifentanil and rocuronium. The intraoperative period was complicated by desaturation and high airway pressures. The woman's postoperative care was complicated by respiratory compromise requiring high dependency care. Copyright © 2014 Elsevier Ltd. All rights reserved.

  14. Absolute partial photoionization cross sections of ethylene

    Science.gov (United States)

    Grimm, F. A.; Whitley, T. A.; Keller, P. R.; Taylor, J. W.

    1991-07-01

    Absolute partial photoionization cross sections for ionization out of the first four valence orbitals to the X 2B 3u, A 2B 3g, B 2A g and C 2B 2u states of the C 2H 4+ ion are presented as a function of photon energy over the energy range from 12 to 26 eV. The experimental results have been compared to previously published relative partial cross sections for the first two bands at 18, 21 and 24 eV. Comparison of the experimental data with continuum multiple scattering Xα calculations provides evidence for extensive autoionization to the X 2B 3u state and confirms the predicted shape resonances in ionization to the A 2B 3g and B 2A g states. Identification of possible transitions for the autoionizing resonances have been made using multiple scattering transition state calculations on Rydberg excited states.

  15. Radar cross section measurements using terahertz waves

    DEFF Research Database (Denmark)

    Iwaszczuk, Krzysztof; Heiselberg, Henning; Jepsen, Peter Uhd

    2010-01-01

    Radar cross sections at terahertz frequencies are measured on scale models of aircrafts. A time domain broadband THz system generates freely propagating THz pulses measured with sub-picosecond time resolution. The THz radiation is generated using fs laser pulses by optical rectification...... in order to measure realistic radar cross sections. RCS polar and azimuthal angle plots of F-16 and F-35 are presented....... in a lithium niobate crystal with application of the tilted wave front method, resulting in high electric field THz pulses with a broad band spectrum from 100 GHz up to 4 THz. The corresponding wave lengths are two orders of magnitude smaller than normal radars and we therefore use scale models of size 5-10 cm...

  16. Electron Capture Cross Sections for Stellar Nucleosynthesis

    Directory of Open Access Journals (Sweden)

    P. G. Giannaka

    2015-01-01

    Full Text Available In the first stage of this work, we perform detailed calculations for the cross sections of the electron capture on nuclei under laboratory conditions. Towards this aim we exploit the advantages of a refined version of the proton-neutron quasiparticle random-phase approximation (pn-QRPA and carry out state-by-state evaluations of the rates of exclusive processes that lead to any of the accessible transitions within the chosen model space. In the second stage of our present study, we translate the abovementioned e--capture cross sections to the stellar environment ones by inserting the temperature dependence through a Maxwell-Boltzmann distribution describing the stellar electron gas. As a concrete nuclear target we use the 66Zn isotope, which belongs to the iron group nuclei and plays prominent role in stellar nucleosynthesis at core collapse supernovae environment.

  17. Hotel Section Management by Using Balanced Scorecard

    Directory of Open Access Journals (Sweden)

    Anna Lysy

    2009-04-01

    Full Text Available The paper presents some problems in using Balanced Scorecard (BSC in a hotel section. Fundamental element, which marks out BSC conception, is consolidation around vision and strategy appointed by the hotel management. Well compiled strategy should join all the targets and indexes, which compose four perspectives in BSC. Hotel section is the main gaining centre in the hotel, because the service quality is the main target of management strategy. BSC is a tool, which should not only measure effectiveness, but also implement changes, as soon as possible, so that the effects and expected results will be quick achieved. Most of the companies, which have used this conception, have treated it as a basic management system that joins strategy and operational activity. Therefore it is necessary to improve, modernize and create new sub perspectives in compiled BSC.

  18. Test of RIPL-2 cross section calculations

    International Nuclear Information System (INIS)

    Herman, M.

    2002-01-01

    The new levels and optical segments and microscopic HF-BCS level densities (part of the density segment) were tested in practical calculations of cross sections for neutron induced reactions on 22 targets (40-Ca, 47-Ti, 52-Cr, 55-Mn, 58-Ni, 63-Cu, 71-Ga, 80-Se, 92-Mo, 93-Nb, 100-Mo, 109-Ag, 114-Cd, 124-Sn, 127-I, 133-Cs, 140-Ce, 153-Eu, 169-Tm, 186-W, 197-Au, 208-Pb). For each target all reactions involving up to 3 neutron, 1 proton and 1 α-particle emissions (subject to actual reaction thresholds) were considered in the incident energy range from 1 keV up to 20 MeV (in some cases up to 27 MeV). In addition, total, elastic, and neutron capture cross sections were calculated

  19. Perimortem caesarean section following maternal gunshot wounds

    Directory of Open Access Journals (Sweden)

    Ozlem Gunevsel

    2011-01-01

    Full Text Available Perimortem caesarean section is an ethically difficult decision for emergency medicine resuscitation teams. A 34-years-old woman was attacked by her husband with a gunshot. At the time arrival to the emergency room, there was no pulse, no spontaneous breath and blood pressure was unobtainable. Although extensive advanced cardiopulmonary resuscita-tion was performed for 7 minutes, no cardiac activity was regained. During the cardiopulmonary resuscitation efforts, an abdominal ultrasonography was performed and revealed a fetal heart rate with bradycardia. Low segment caesarean section was performed by the obstetrician in the resuscitation room and a female newborn was delivered within less than one minute of the skin incision. Decision on terminating the CPR efforts should not be made in maternal cardiac arrests older than 28 weeks′ gestational age, unless the viability of the fetus had been evaluated.

  20. Double differential cross sections of ethane molecule

    Science.gov (United States)

    Kumar, Rajeev

    2018-05-01

    Partial and total double differential cross sections corresponding to various cations C2H6+, C2H4+, C2H5+, C2H3+, C2H2+, CH3+, H+, CH2+, C2H+, H2+, CH+, H3+, C2+ and C+ produced during the direct and dissociative electron ionization of Ethane (C2H6) molecule have been calculated at fixed impinging electron energies 200 and 500eV by using modified Jain-Khare semi empirical approach. The calculation for double differential cross sections is made as a function of energy loss suffered by primary electron and angle of incident. To the best of my knowledge no other data is available for the comparison.

  1. Cross sections required for FMIT dosimetry

    International Nuclear Information System (INIS)

    Gold, R.; McElroy, W.N.; Lippincott, E.P.; Mann, F.M.; Oberg, D.L.; Roberts, J.H.; Ruddy, F.H.

    1980-01-01

    The Fusion Materials Irradiation Test (FMIT) facility, currently under construction, is designed to produce a high flux of high energy neutrons for irradiation effects experiments on fusion reactor materials. Characterization of the flux-fluence-spectrum in this rapidly varying neutron field requires adaptation and extension of currently available dosimetry techniques. This characterization will be carried out by a combination of active, passive, and calculational dosimetry. The goal is to provide the experimenter with accurate neutron flux-fluence-spectra at all positions in the test cell. Plans have been completed for a number of experimental dosimetry stations and provision for these facilities has been incorporated into the FMIT design. Overall needs of the FMIT irradiation damage program delineate goal accuracies for dosimetry that, in turn, create new requirements for high energy neutron cross section data. Recommendations based on these needs have been derived for required cross section data and accuracies

  2. Elliptical cross section fuel rod study II

    International Nuclear Information System (INIS)

    Taboada, H.; Marajofsky, A.

    1996-01-01

    In this paper it is continued the behavior analysis and comparison between cylindrical fuel rods of circular and elliptical cross sections. Taking into account the accepted models in the literature, the fission gas swelling and release were studied. An analytical comparison between both kinds of rod reveals a sensible gas release reduction in the elliptical case, a 50% swelling reduction due to intragranular bubble coalescence mechanism and an important swelling increase due to migration bubble mechanism. From the safety operation point of view, for the same linear power, an elliptical cross section rod is favored by lower central temperatures, lower gas release rates, greater gas store in ceramic matrix and lower stored energy rates. (author). 6 refs., 8 figs., 1 tab

  3. PBFA II energy storage section design

    International Nuclear Information System (INIS)

    Wilson, J.M.

    1983-01-01

    PBFA II will be the second thirty-six module accelerator built at Sandia National Laboratories for particle beam fusion feasibility studies. Each module of the machine will deliver 2.8 terawatts to a central experimental chamber. The total power delivered (100 terawatts) is expected to permit ignition scaling studies beginning in 1986. The PBFA II energy storage system consists of thirty-six 6.0 mv, 400 kj. Marx generators with their high voltage trigger and charging systems, and electromechanical output switching system. The paper describes the current design of this section of the machine. Constraints imposed by the existing tank and building are presented, as they relate to locating support systems in the oil section of PBFA II. The charging system and output switches have been designed and are described. A conceptual design for the Marx triggering system is also presented. Additional hardware (monitors, grounding connections, etc.) is discussed briefly with design details given where available

  4. SSCL RFQ-DTL Matching Section instrumentation

    International Nuclear Information System (INIS)

    Datte, P.; Aielo, R.; Hayworth, M.

    1993-11-01

    A description of the SSCL RFQ-DTL Matching Section instrumentation is presented with emphasis on design issues and early instrumentation commissioning results. The H - beam energy through the RFQ-DTL matching section is 2.5 MeV, the beam current is 27 mA with a pulse width of 35 Its. The typical beam diameter is 3 mm. The instrumentation consists of three beam position monitors (BPM), a wire scanner, beam loss monitors (BLM), a slit and collector emittance measurement unit (EMU), a current toroid, and a Faraday cup. The instruments were designed to accommodate high current densities, have a large dynamic range with moderate bandwidths, and fit congested spaces

  5. What's new with the FHA's Section 242?

    Science.gov (United States)

    Spidel, Alan J

    2008-11-01

    FHA hospital mortgage insurance, also called the Section 242 program, acts as a credit enhancement that allows borrowers to issue bonds up to the equivalent of an "AAA" rating, with the benefits of lower interest rates. Although the program has operated in relative obscurity over its 40 years of existence, the FHA has undertaken a new marketing campaign to raise its profile. Federal backing may make the program an attractive option amid today's financial turmoil in the capital markets.

  6. Activity report of Reactor Physics Section - 1985

    International Nuclear Information System (INIS)

    John, T.M.

    1986-01-01

    This Activity Report contains brief summaries of different studies made in Reactor Physics Section during the year 1985. These are presented under the headings Nuclear Data Processing and Validation, Reactor Design and Analysis, Safety and Noise Analysis, Radiation Transport and Shielding, Reactor Physics Experiments and Statistical Physics. The work on nuclear data during this period comprises primarily of validation of data of 232 Th and 233 U as a part of participation in the Co-ordinated Research Programme (CRP) under IAEA research contract. The most significant event during 1985 at this centre has been the first criticality of FBTR (Fast Breeder Test Reactor), which was achieved on the 18th of October. Reactor Physics Section has played a key role in this event by carrying out the first approach to criticality with fuel loading in a safe manner and conducting some low power reactor physics experiments which are discussed. The studies made in the field reactor safety and shielding are also connected mainly with the FBTR problems in addition to some work on the PFBR (Prototype Fast Breeder Reactor) detailed design of which has been just started. Studies pertaining to the other two Co-ordinated Research Programmes (CRP) under IAEA contract, namely (1) on the comparative assessment of processing techniques for the analysis of sodium boiling noise detection and, (2) on the contribution of advanced reactors to energy supply have been continued during this year. At the end of this report, a list of publications made by the members of the section and also the sectional seminars held during this period is included. (author)

  7. Clean Water Act (excluding Section 404)

    Energy Technology Data Exchange (ETDEWEB)

    1993-01-15

    This Reference Book contains a current copy of the Clean Water Act (excluding Section 404) and those regulations that implement the statutes and appear to be most relevant to US Department of Energy (DOE) activities. The document is provided to DOE and contractor staff for informational purposes only and should not be interpreted as legal guidance. Updates that include important new requirements will be provided periodically. Questions concerning this Reference Book may be directed to Mark Petts, EH-231 (202/586-2609).

  8. Electron collision cross sections and radiation chemistry

    International Nuclear Information System (INIS)

    Hatano, Y.

    1983-01-01

    A survey is given of the cross section data needs in radiation chemistry, and of the recent progress in electron impact studies on dissociative excitation of molecules. In the former some of the important target species, processes, and collision energies are presented, while in the latter it is demonstrated that radiation chemistry is a source of new ideas and information in atomic collision research. 37 references, 4 figures

  9. Absolute photoionization cross sections of atomic oxygen

    Science.gov (United States)

    Samson, J. A. R.; Pareek, P. N.

    1985-01-01

    The absolute values of photoionization cross sections of atomic oxygen were measured from the ionization threshold to 120 A. An auto-ionizing resonance belonging to the 2S2P4(4P)3P(3Do, 3So) transition was observed at 479.43 A and another line at 389.97 A. The experimental data is in excellent agreement with rigorous close-coupling calculations that include electron correlations in both the initial and final states.

  10. Total dissociation cross section of halo nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Formanek, J. [Karlova Univ., Prague (Czech Republic). Fakulta Matematicko-Fyzikalni; Lombard, R.J. [Paris-11 Univ., 91 - Orsay (France). Inst. de Physique Nucleaire

    1996-10-01

    Calculations of the total dissociation cross section is performed in the impact parameter representation. The case of {sup 11}Be and {sup 11}Li loosing one and two neutron(s), respectively, by collision on a {sup 12}C target, which remains in its ground state are discussed. The results are found to depend essentially on the rms radius of the halo wave function. (author). 12 refs.

  11. Measurements of Fission Cross Sections of Actinides

    CERN Multimedia

    Wiescher, M; Cox, J; Dahlfors, M

    2002-01-01

    A measurement of the neutron induced fission cross sections of $^{237}$Np, $^{241},{243}$Am and of $^{245}$Cm is proposed for the n_TOF neutron beam. Two sets of fission detectors will be used: one based on PPAC counters and another based on a fast ionization chamber (FIC). A total of 5x10$^{18}$ protons are requested for the entire fission measurement campaign.

  12. Cross section of the CMS solenoid

    CERN Multimedia

    Tejinder S. Virdee, CERN

    2005-01-01

    The pictures show a cross section of the CMS solenoid. One can see four layers of the superconducting coil, each of which contains the superconductor (central part, copper coloured - niobium-titanium strands in a copper coating, made into a "Rutherford cable"), surrounded by an ultra-pure aluminium as a magnetic stabilizer, then an aluminium alloy as a mechanical stabilizer. Besides the four layers there is an aluminium mechanical piece that includes pipes that transport the liquid helium.

  13. Cross sections for multistep direct reactions

    International Nuclear Information System (INIS)

    Demetriou, Paraskevi; Marcinkowski, Andrzej; Marianski, Bohdan

    2002-01-01

    Inelastic scattering and charge-exchange reactions have been analysed at energies ranging from 14 to 27 MeV using the modified multistep direct reaction theory (MSD) of Feshbach, Kerman and Koonin. The modified theory considers the non-DWBA matrix elements in the MSD cross section formulae and includes both incoherent particle-hole excitations and coherent collective excitations in the continuum, according to the prescriptions. The results show important contributions from multistep processes at all energies considered. (author)

  14. Capture cross sections for very heavy systems

    International Nuclear Information System (INIS)

    Rowley, N.; Grar, N.; Ntshangase, S.S.

    2006-01-01

    In intermediate-mass systems, collective excitations of the target and projectile can greatly enhance the sub-barrier capture cross section σ cap by giving rise to a distribution of Coulomb barriers. For such systems, capture essentially leads directly to fusion (formation of a compound nucleus (CN)), which then decays through the emission of light particles (neutrons, protons, and alpha particles). Thus the evaporation-residue (ER) cross section is essentially equal to σ cap . For heavier systems the experimental situation is significantly more complicated due to the presence of quasifission (QF) (rapid separation into two fragments before the CN is formed) and by fusion-fission (FF) of the CN itself. Thus three cross sections need to be measured in order to evaluate σ cap . Although the ER essentially recoil along the beam direction. QF and FF fragments are scattered to all angles and require the measurement of angular distribution in order to obtain the excitation function and barrier distribution for capture. Two other approaches to this problem exist. If QF is not important, one can still measure just the ER cross section and try to reconstruct the corresponding σ cap through use of an evaporation-model code that takes account of the FF degree of freedom. Some earlier results on σ cap obtained in this way will be re-analyzed with detail coupled-channels calculations, and the extra-push phenomenon discussed. One may also try to obtain σ cap by exploiting unitarity, that is, by measuring instead the flux of particles corresponding to quasielastic (QE) scattering from the Coulomb barrier. Some new QE results obtained for the 86 Kr + 208 Pb system at iThemba LABS in South Africa will be presented [ru

  15. Inclusive jet cross section at D0

    International Nuclear Information System (INIS)

    Bhattacharjee, M.

    1996-09-01

    Preliminary measurement of the central (|η| ≤ 0.5) inclusive jet cross sections for jet cone sizes of 1.0, 0.7, and 0.5 at D null based on the 1992-1993 (13.7 pb -1 ) and 1994-1995 (90 pb -1 ) data samples are presented. Comparisons to Next-to-Leading Order (NLO) Quantum Chromodynamics (QCD) calculations are made

  16. Fully double-logarithm-resummed cross sections

    International Nuclear Information System (INIS)

    Albino, S.; Bolzoni, P.; Kniehl, B.A.; Kotikov, A.

    2011-01-01

    We calculate the complete double logarithmic contribution to cross sections for semi-inclusive hadron production in the modified minimal-subtraction (MS-bar) scheme by applying dimensional regularization to the double logarithm approximation. The full double logarithmic contribution to the coefficient functions for inclusive hadron production in e + e - annihilation is obtained in this scheme for the first time. Our result agrees with all fixed order results in the literature, which extend to next-to-next-to-leading order.

  17. ''NICRO'' microprogramming language for sectional microprocessors

    International Nuclear Information System (INIS)

    Semenov, Yu.A.; Chudakov, V.N.

    1982-01-01

    ''MICRO'' microprogramming input language developed for sectional microprocessors is described. The structure of micromanual, purpose of particular fields, the corresponding mne-- mocodes and requirements they have to meet are considered. Program for integer division with a sign written in the ''MICRO'' language is given as an example. The possibilities of modif ying the translator for its adaptation to different types of processor and microprocessor sets are analyzed

  18. Atomic-process cross section data, 1

    International Nuclear Information System (INIS)

    1974-12-01

    Compiled by the Data Study Group, the data are intended for fusion plasma physics research. Cross sections of the latest experimental and theoretic studies cover the processes involving H,D,T as principal plasma materials as well as photons and electrons: emission and absorption of electromagnetic wave, electron collision, ion collision, recombination, neutral atom mutual collision, etc. Edition is so made to enable the future renewal by users. (J.P.N.)

  19. Studies on Section XI ultrasonic repeatability

    International Nuclear Information System (INIS)

    Jamison, T.D.; McDearman, W.R.

    1981-05-01

    A block representative of a nuclear component has been welded containing intentional defects. Acoustic emission data taken during the welding correlate well with ultrasonic data. Repetitive ultrasonic examinations have been performed by skilled operators using a procedure based on that desribed in ASME Section XI. These examinations were performed by different examination teams using different ultrasonic equipment in such a manner that the effects on the repeatability of the ultrasonic test method caused by the operator and by the use of different equipment could be estimated. It was tentatively concluded that when considering a large number of inspections: (1) there is no significant difference in indication sizing between operators, and (2) there is a significant difference in amplitude and defect sizing when instruments having different, Code acceptable operating characteristics are used. It was determined that the Section XI sizing parameters follow a bivariate normal distribution. Data derived from ultrasonically and physically sizing indications in nuclear components during farication show that the Section XI technique tends to overestimate the size of the reflectors

  20. Neutron capture cross section of ^243Am

    Science.gov (United States)

    Jandel, M.

    2009-10-01

    The Detector for Advanced Neutron Capture Experiments (DANCE) at Los Alamos National Laboratory (LANL) was used for neutron capture cross section measurement on ^243Am. The high granularity of DANCE (160 BaF2 detectors in a 4π geometry) enables the efficient detection of prompt gamma-rays following neutron capture. DANCE is located on the 20.26 m neutron flight path 14 (FP14) at the Manuel Lujan Jr. Neutron Scattering Center at the Los Alamos Neutron Science Center (LANSCE). The methods and techniques established in [1] were used for the determination of the ^243Am neutron capture cross section. The cross sections were obtained in the range of neutron energies from 0.02 eV to 400 keV. The resonance region was analyzed using SAMMY7 and resonance parameters were extracted. The results will be compared to existing evaluations and calculations. Work was performed under the auspices of the U.S. Department of Energy at Los Alamos National Laboratory by the Los Alamos National Security, LLC under Contract No. DE-AC52-06NA25396 and at Lawrence Livermore National Laboratory by the Lawrence Livermore National Security, LLC under Contract No. DE-AC52-07NA27344. [4pt] [1] M. Jandel et al., Phys. Rev. C78, 034609 (2008)

  1. MXS cross-section preprocessor user's manual

    International Nuclear Information System (INIS)

    Parker, F.; Ishikawa, M.; Luck, L.

    1987-03-01

    The MXS preprocessor has been designed to reduce the execution time of programs using isotopic cross-section data and to both reduce the execution time and improve the accuracy of shielding-factor interpolation in the SIMMER-II accident analysis program. MXS is a dual-purpose preprocessing code to: (1) mix isotopes into materials and (2) fit analytic functions to the shelf-shielding data. The program uses the isotope microscopic neutron cross-section data from the CCCC standard interface file ISOTXS and the isotope Bondarenko self-shielding data from the CCCC standard interface file BRKOXS to generate cross-section and self-shielding data for materials. The materials may be a mixture of several isotopes. The self-shielding data for the materials may be the actual shielding factors or a set of coefficients for functions representing the background dependence of the shielding factors. A set of additional data is given to describe the functions necessary to interpolate the shielding factors over temperature

  2. Acute parotiditis after cesarean section; case report

    Directory of Open Access Journals (Sweden)

    Cristina Moisei

    2017-11-01

    Full Text Available The enlargement of the parotid gland develops in inflammatory or stenotic conditions but after Cesarean section the symptomatology is unusual. A 38 year old patient with no obstetrical history referred to our clinic for pregnancy, which followed our national program of prenatal care. The outcome of the pregnancy was favorable for both mother and fetus. During labor the fetus developed bradycardia and the patient delivered by Cesarean section a 3400 g baby-boy with 8 Apgar Score; the anesthesia was spinal. 18 hours after delivery the patient presented mild respiratory distress. The symptomatology was caused by the enlargement of the parotid gland. The treatment was supportive and the remission occurred 10 hours after the onset. The initial discussion that raised this case was caused by the viral, infection and stenotic cause of the parotiditis. All these reasons had no medical argument. It was also debated about the anesthesia but, until now, the medical literature didn’t report any case of association between parotiditis and spinal anesthesia. It is also impossible to correlate the parotiditis with IVF procedure. As a conclusion, this case is unique because it represents the parotiditis without unknown case that appeared after Cesarean section and spinal anesthesia in a healthy woman.

  3. Neutron capture cross sections of Kr

    Directory of Open Access Journals (Sweden)

    Fiebiger Stefan

    2017-01-01

    Full Text Available Neutron capture and β− -decay are competing branches of the s-process nucleosynthesis path at 85Kr [1], which makes it an important branching point. The knowledge of its neutron capture cross section is therefore essential to constrain stellar models of nucleosynthesis. Despite its importance for different fields, no direct measurement of the cross section of 85Kr in the keV-regime has been performed. The currently reported uncertainties are still in the order of 50% [2, 3]. Neutron capture cross section measurements on a 4% enriched 85Kr gas enclosed in a stainless steel cylinder were performed at Los Alamos National Laboratory (LANL using the Detector for Advanced Neutron Capture Experiments (DANCE. 85Kr is radioactive isotope with a half life of 10.8 years. As this was a low-enrichment sample, the main contaminants, the stable krypton isotopes 83Kr and 86Kr, were also investigated. The material was highly enriched and contained in pressurized stainless steel spheres.

  4. Measurement of actinide neutron cross sections

    International Nuclear Information System (INIS)

    Firestone, Richard B.; Nitsche, Heino; Leung, Ka-Ngo; Perry, DaleL.; English, Gerald

    2003-01-01

    The maintenance of strong scientific expertise is critical to the U.S. nuclear attribution community. It is particularly important to train students in actinide chemistry and physics. Neutron cross-section data are vital components to strategies for detecting explosives and fissile materials, and these measurements require expertise in chemical separations, actinide target preparation, nuclear spectroscopy, and analytical chemistry. At the University of California, Berkeley and the Lawrence Berkeley National Laboratory we have trained students in actinide chemistry for many years. LBNL is a leader in nuclear data and has published the Table of Isotopes for over 60 years. Recently, LBNL led an international collaboration to measure thermal neutron capture radiative cross sections and prepared the Evaluated Gamma-ray Activation File (EGAF) in collaboration with the IAEA. This file of 35, 000 prompt and delayed gamma ray cross-sections for all elements from Z=1-92 is essential for the neutron interrogation of nuclear materials. LBNL has also developed new, high flux neutron generators and recently opened a 1010 n/s D+D neutron generator experimental facility

  5. Quality Quantification of Evaluated Cross Section Covariances

    International Nuclear Information System (INIS)

    Varet, S.; Dossantos-Uzarralde, P.; Vayatis, N.

    2015-01-01

    Presently, several methods are used to estimate the covariance matrix of evaluated nuclear cross sections. Because the resulting covariance matrices can be different according to the method used and according to the assumptions of the method, we propose a general and objective approach to quantify the quality of the covariance estimation for evaluated cross sections. The first step consists in defining an objective criterion. The second step is computation of the criterion. In this paper the Kullback-Leibler distance is proposed for the quality quantification of a covariance matrix estimation and its inverse. It is based on the distance to the true covariance matrix. A method based on the bootstrap is presented for the estimation of this criterion, which can be applied with most methods for covariance matrix estimation and without the knowledge of the true covariance matrix. The full approach is illustrated on the 85 Rb nucleus evaluations and the results are then used for a discussion on scoring and Monte Carlo approaches for covariance matrix estimation of the cross section evaluations

  6. Total neutron cross section for 181Ta

    Directory of Open Access Journals (Sweden)

    Schilling K.-D.

    2010-10-01

    Full Text Available The neutron time of flight facility nELBE, produces fast neutrons in the energy range from 0.1 MeV to 10 MeV by impinging a pulsed relativistic electron beam on a liquid lead circuit [1]. The short beam pulses (∼10 ps and a small radiator volume give an energy resolution better than 1% at 1 MeV using a short flight path of about 6 m, for neutron TOF measurements. The present neutron source provides 2 ⋅ 104  n/cm2s at the target position using an electron charge of 77 pC and 100 kHz pulse repetition rate. This neutron intensity enables to measure neutron total cross section with a 2%–5% statistical uncertainty within a few days. In February 2008, neutron radiator, plastic detector [2] and data acquisition system were tested by measurements of the neutron total cross section for 181Ta and 27Al. Measurement of 181Ta was chosen because lack of high quality data in an anergy region below 700 keV. The total neutron cross – section for 27Al was measured as a control target, since there exists data for 27Al with high resolution and low statistical error [3].

  7. NNLO jet cross sections by subtraction

    Science.gov (United States)

    Somogyi, G.; Bolzoni, P.; Trócsányi, Z.

    2010-08-01

    We report on the computation of a class of integrals that appear when integrating the so-called iterated singly-unresolved approximate cross section of the NNLO subtraction scheme of Refs. [G. Somogyi, Z. Trócsányi, and V. Del Duca, JHEP 06, 024 (2005), arXiv:hep-ph/0502226; G. Somogyi and Z. Trócsányi, (2006), arXiv:hep-ph/0609041; G. Somogyi, Z. Trócsányi, and V. Del Duca, JHEP 01, 070 (2007), arXiv:hep-ph/0609042; G. Somogyi and Z. Trócsányi, JHEP 01, 052 (2007), arXiv:hep-ph/0609043] over the factorised phase space of unresolved partons. The integrated approximate cross section itself can be written as the product of an insertion operator (in colour space) times the Born cross section. We give selected results for the insertion operator for processes with two and three hard partons in the final state.

  8. (n,{alpha}) cross section measurement of gaseous sample using gridded ionization chamber. Cross section determination

    Energy Technology Data Exchange (ETDEWEB)

    Sanami, Toshiya; Baba, Mamoru; Saito, Keiichiro; Ibara, Yasutaka; Hirakawa, Naohiro [Tohoku Univ., Sendai (Japan). Faculty of Engineering

    1997-03-01

    We are developing a method of (n,{alpha}) cross section measurement using gaseous samples in a gridded ionization chamber (GIC). This method enables cross section measurements in large solid angle without the distortion by the energy loss in a sample, but requires a method to estimate the detection efficiency. We solve this problem by using GIC signals and a tight neutron collimation. The validity of this method was confirmed through the {sup 12}C(n,{alpha}{sub 0}){sup 9}Be measurement. We applied this method to the {sup 16}O(n,{alpha}){sup 13}C cross section around 14.1 MeV. (author)

  9. Clean Water Act (Section 404) and Rivers and Harbors Act (Sections 9 and 10)

    International Nuclear Information System (INIS)

    1992-01-01

    This Reference Book contains a current copy of the Clean Water Act (Section 404) and the Rivers and Harbors Act (Sections 9 and 10) and those regulations that implement those sections of the statutes and appear to be most relevant to DOE activities. The document is provided to DOE and contractor staff for informational purposes only and should not be interpreted as legal guidance. Updates that include important new requirements will be provided periodically. Questions concerning this Reference Book may be directed to Mark Petts, IH-231 (FTS 896-2609 or Commercial 202/586-2609)

  10. STEM mode in the SEM for the analysis of cellular sections prepared by ultramicrotome sectioning

    International Nuclear Information System (INIS)

    Hondow, N; Harrington, J; Brydson, R; Brown, A

    2012-01-01

    The use of the dual imaging capabilities of a scanning electron microscope fitted with a transmitted electron detector is highlighted in the analysis of samples with importance in the field of nanotoxicology. Cellular uptake of nanomaterials is often examined by transmission electron microscopy of thin sections prepared by ultramicrotome sectioning. Examination by SEM allows for the detection of artefacts caused by sample preparation (eg. nanomaterial pull-out) and the complementary STEM mode permits study of the interaction between nanomaterials and cells. Thin sections of two nanomaterials of importance in nanotoxicology (cadmium selenide quantum dots and single walled carbon nanotubes) are examined using STEM mode in the SEM.

  11. National Variation in Caesarean Section Rates: A Cross Sectional Study in Ireland.

    LENUS (Irish Health Repository)

    Sinnott, Sarah-Jo

    2016-01-01

    Internationally, caesarean section (CS) rates are rising. However, mean rates of CS across providers obscure extremes of CS provision. We aimed to quantify variation between all maternity units in Ireland.

  12. Mechanized evaluation of neutron cross-sections

    International Nuclear Information System (INIS)

    Horsley, A.; Parker, J.B.

    1967-01-01

    The evaluation work to provide accurate and consistent neutron cross-section data for multigroup neutronics calculations is not fully exploiting the available theoretical and experimental results; this has been so particularly since the introduction of on-line data handling techniques enabled experimenters to turn out vast quantities of numbers. This situation can be radically improved only by mechanizing the evaluation processes. Systems such as the SC1SRS tape will not only largely overcome the task of collecting data but will provide speedy access to it; by using computers and graph-plotting machines to tabulate and display this data, the labour of evaluation can be very greatly reduced. With some types of cross-section there is hope that by using modern curve-fitting techniques the actual evaluation and statistical accounting of the data can be performed automatically. Some areas where automatic evaluation would seem likely to succeed are specified and a discussion of the mathematical difficulties incurred, such as the elimination of anomalous data, is given. Particularly promising is the use of splines in the mechanized evaluation of data. Splines are the mathematical analogues of the draughtsman's spline used in drawing smooth curves. Their principal properties are the excellent approximations they give to the derivatives of a function; in contrast to conventional polynomial fitting, this feature ensures good interpolation and, when required, stable extrapolation. Various methods of using splines in data graduation and the problem of marrying these methods to standard statistical procedures are examined. The results of work done at AWRE with cubic splines on the mechanized evaluation of neutron scattering total cross-section and angular distribution data are presented. (author)

  13. Volcanology Section Bulletin. French Geologic Society; Bulletin de la Section de Volcanologie. Societe Geologique de France

    Energy Technology Data Exchange (ETDEWEB)

    Boudon, G [I.P.G.P. - Observatoire Volcanologique, 75 - Paris (France); Gourgaud, A [Universite Blaise Pascal, 63 - Clermont Ferrand (France); Soler, E [Universite Paris 6, Paris (France)

    1997-12-31

    This issue of the Volcanology Section Bulletin is a compilation of abstracts from the meeting the section of April, 2 1996 about the active volcanism of Central America and Mexico. The abstracts selected in this issue report on measurements of uranium, thorium and radium isotopes disequilibrium in lava, and radon fluctuations in volcanic gases. One abstract reports on new {sup 14}C datings on avalanche debris. (J.S.).

  14. Volcanology Section Bulletin. French Geologic Society; Bulletin de la Section de Volcanologie. Societe Geologique de France

    Energy Technology Data Exchange (ETDEWEB)

    Boudon, G. [I.P.G.P. - Observatoire Volcanologique, 75 - Paris (France); Gourgaud, A. [Universite Blaise Pascal, 63 - Clermont Ferrand (France); Soler, E. [Universite Paris 6, Paris (France)

    1996-12-31

    This issue of the Volcanology Section Bulletin is a compilation of abstracts from the meeting the section of April, 2 1996 about the active volcanism of Central America and Mexico. The abstracts selected in this issue report on measurements of uranium, thorium and radium isotopes disequilibrium in lava, and radon fluctuations in volcanic gases. One abstract reports on new {sup 14}C datings on avalanche debris. (J.S.).

  15. Implementing Estimation of Capacity for Freeway Sections

    Directory of Open Access Journals (Sweden)

    Chang-qiao Shao

    2011-01-01

    Full Text Available Based on the stochastic concept for freeway capacity, the procedure of capacity estimation is developed. Due to the fact that it is impossible to observe the value of the capacity and to obtain the probability distribution of the capacity, the product-limit method is used in this paper to estimate the capacity. In order to implement estimation of capacity using this technology, the lifetime table based on statistical methods for lifetime data analysis is introduced and the corresponding procedure is developed. Simulated data based on freeway sections in Beijing, China, were analyzed and the results indicate that the methodology and procedure are applicable and validated.

  16. Thromboprophylaxis for women undergoing caesarean section.

    LENUS (Irish Health Repository)

    Kennedy, C

    2012-02-01

    Thromboprophylaxis for women undergoing caesarean section (CS) was introduced in the hospital in 1995. This study audited the use of tinzaparin prophylaxis in a nested cohort of women who screened negative for diabetes mellitus at 28 weeks gestation. All the women had their weight measured and BMI calculated at the first antenatal visit. Of the 284 women, 68 (24%) had a CS and all received tinzaparin. Of the 68, however, 94% received a dose lower than recommended. Compliance with prophylaxis was complete but compliance with the recommended dosage was suboptimal, which may result in venous thromboembolism after CS despite thromboprophylaxis.

  17. LEP vacuum chamber, cross-section

    CERN Multimedia

    CERN PhotoLab

    1983-01-01

    Cross-section of the final prototype for the LEP vacuum chamber. The elliptic main-opening is for the beam. The small channel to the left is for the cooling water, to carry away the heat deposited by the synchrotron radiation. The square channel to the right houses the Non-Evaporable Getter (NEG) pump. The chamber is made from extruded aluminium. Its outside is clad with lead, to stop the synchrotron radiation emitted by the beam. For good adherence between Pb and Al, the Al chamber was coated with a thin layer of Ni. Ni being slightly magnetic, some resulting problems had to be overcome. See also 8301153.

  18. Heavy-Section Steel Irradiation Program

    Energy Technology Data Exchange (ETDEWEB)

    Rosseel, T.M.

    2000-04-01

    Maintaining the integrity of the reactor pressure vessel (RPV) in a light-water-cooled nuclear power plant is crucial in preventing and controlling severe accidents that have the potential for major contamination release. Because the RPV is the only key safety-related component of the plant for which a redundant backup system does not exist, it is imperative to fully understand the degree of irradiation-induced degradation of the RPV's fracture resistance that occurs during service. For this reason, the Heavy-Section Steel Irradiation (HSSI) Program has been established.

  19. Proceedings 2001. Networks. Section 3. Book 4

    International Nuclear Information System (INIS)

    Shukleva, Eva; Taleski, Rubin

    2001-01-01

    The holding of this Symposium was initiated by MAKO CIGRE - Macedonian Committee on Large High Voltage Systems, in compliance with its determination to raise competent discussions on current issues. The 3 sections of the conference were entitled: (1) power plants facilities, (2) power transmission lines, (3) networks. The forth volume includes the following topics: STK 36 - electromagnetic compatibility; STK 37 - planning and development of the power systems; STK 38 - power systems analysis and STK 39 - power systems control. Papers relevant to INIS are indexed separately

  20. How to extract cross sections from TDHF

    International Nuclear Information System (INIS)

    Le Tourneux, Jean

    1979-01-01

    In spite of all the recent progress in solving numerically TDHF (Time Dependent Hartree-Fock) equations for heavy-ion collisions, this method is still far from lending itself readily to the computation of cross sections, except in the case of fusion. The theory presented here is purely formal so far and would lead to fairly heavy calculations in practice. It solves the problem of channel identification in the outgoing asymptotic region of TDHF solutions. It throws a bridge between TDHF and more traditional theories of nuclear reactions, which are time-independent

  1. Hyperon magnetic moments and total cross sections

    International Nuclear Information System (INIS)

    Lipkin, H.J.

    1982-06-01

    The new data on both total cross sections and magnetic moments are simply described by beginning with the additive quark model in an SU(3) limit where all quarks behave like strange quarks and breaking both additivity and SU(3) simultaneously with an additional non-additive mechanism which affects only nonstrange quark contributions. The suggestion that strange quarks behave more simply than nonstrange may provide clues to underlying structure or dynamics. Small discrepancies in the moments are analyzed and shown to provide serious difficulties for most models if they are statistically significant. (author)

  2. Neutron capture cross section of $^{93}$Zr

    CERN Document Server

    We propose to measure the neutron capture cross section of the radioactive isotope $^{93}$Zr. This project aims at the substantial improvement of existing results for applications in nuclear astrophysics and emerging nuclear technologies. In particular, the superior quality of the data that can be obtained at n_TOF will allow on one side a better characterization of s-process nucleosynthesis and on the other side a more accurate material balance in systems for transmutation of nuclear waste, given that this radioactive isotope is widely present in fission products.

  3. Fission cross section measurements for minor actinides

    Energy Technology Data Exchange (ETDEWEB)

    Fursov, B. [IPPE, Obninsk (Russian Federation)

    1997-03-01

    The main task of this work is the measurement of fast neutron induced fission cross section for minor actinides of {sup 238}Pu, {sup 242m}Am, {sup 243,244,245,246,247,248}Cm. The task of the work is to increase the accuracy of data in MeV energy region. Basic experimental method, fissile samples, fission detectors and electronics, track detectors, alpha counting, neutron generation, fission rate measurement, corrections to the data and error analysis are presented in this paper. (author)

  4. Charge changing cross sections of relativistic uranium

    International Nuclear Information System (INIS)

    Gould, H.; Greiner, D.; Lindstrom, P.; Symons, T.J.M.; Crawford, H.; Thieberger, P.; Wegner, H.

    1984-11-01

    We report equilibrium charge state distributions of uranium at energies of 962 MeV/nucleon, 437 MeV/nucleon and 200 MeV/nucleon in low Z and high Z targets and the cross sections for U 92+ reversible U 91+ and U 91+ reversible U 90+ at 962 MeV/nucleon and 437 MeV/nucleon. Equilibrium thickness Cu targets produce approx. = 5% bare U 92+ at 200 MeV/nucleon and 85% U 92+ at 962 MeV/nucleon. 7 references, 5 figures

  5. Charge changing cross sections of relativistic uranium

    Energy Technology Data Exchange (ETDEWEB)

    Gould, H; Greiner, D; Lindstrom, P; Symons, T J.M.; Crawford, H; Thieberger, P; Wegner, H

    1985-05-15

    We report equilibrium charge state distributions of uranium at energies of 962 MeV/nucleon, 437 MeV/nucleon and 200 MeV/nucleon in low Z and high Z targets and the cross sections for U/sup 92 +/reversibleU/sup 91 +/ and U/sup 91 +/reversibleU/sup 90 +/ at 962 MeV/nucleon and 437 MeV/nucleon. Equilibrium thickness Cu targets produce approx.=5% bare U/sup 92 +/ at 200 MeV/nucleon and 85% U/sup 92 +/ at 962 MeV/nucleon.

  6. Measurement of thermal neutron capture cross section

    International Nuclear Information System (INIS)

    Huang Xiaolong; Han Xiaogang; Yu Weixiang; Lu Hanlin; Zhao Wenrong

    2001-01-01

    The thermal neutron capture cross sections of 71 Ga(n, γ) 72 Ga, 94 Zr(n, γ) 95 Zr and 191 Ir(n, γ) 192 Ir m1+g,m2 reactions were measured by using activation method and compared with other measured data. Meanwhile the half-life of 72 Ga was also measured. The samples were irradiated with the neutron in the thermal column of heavy water reactor of China Institute of Atomic Energy. The activities of the reaction products were measured by well-calibrated Ge(Li) detector

  7. Empirical continuation of the differential cross section

    International Nuclear Information System (INIS)

    Borbely, I.

    1978-12-01

    The theoretical basis as well as the practical methods of empirical continuation of the differential cross section into the nonphysical region of the cos theta variable are discussed. The equivalence of the different methods is proved. A physical applicability condition is given and the published applications are reviewed. In many cases the correctly applied procedure turns out to provide nonsignificant or even incorrect structure information which points to the necessity for careful and statistically complete analysis of the experimental data with a physical understanding of the analysed process. (author)

  8. L-shell photoelectric cross section measurements

    Energy Technology Data Exchange (ETDEWEB)

    Arora, S K; Allawadhi, K L; Sood, B S [Punjabi Univ., Patiala (India). Nuclear Science Labs.

    1981-05-14

    L-shell photoelectric cross sections in Ta, W, Au, Pb, Th and U at 59.5 keV have been determined using three different versions of Sood's method of measuring the absolute yield of fluorescent x-rays when a target is irradiated with a known flux of photons. The results obtained by all the methods agree with one another showing that no hidden systematic errors are involved in the measurements. The present results are found to compare well with the theoretical calculations of Scofield (Lawrence Livermore Laboratory Report No 51326).

  9. The short straight sections for the LHC

    International Nuclear Information System (INIS)

    Bergot, J.B.; Coussy, E.; Dambre, P.; Ollivier, Y.; Reynet, D.; Vincent, D.; Rohmig, P.

    1999-01-01

    In 1995 a close collaboration between CERN, CEA and CNRS has been established for the design, proto-typing and follow-up of industrial series production of a sub-assembly of the Large Hadron Collider (LHC). In this frame, the design office of IPN's Accelerator R and D group has in charge one of these contracts concerning the 386 Short Straight Sections (SSS) and particularly: - the cryostat design; - the study of procedures and tool assembly; - the construction of two prototypes during the year 1999; - the industrialization and the production follow-up for the series SSS. This collaboration will last until the year 2004. (authors)

  10. Rectus Abdominis Endometrioma after Caesarean Section

    Directory of Open Access Journals (Sweden)

    Igor Mishin

    2016-01-01

    Full Text Available Isolated rectus abdominis muscle endometriosis is very uncommon with less than 20 case reports being published to date since its first description in 1984 by Amato and Levitt. We report another case of isolated rectus abdominis endometriosis in a 37-year-old patient with a previous caesarian section. We also discuss the diagnostic and treatment particularities in these patients. In our case, the treatment was only surgical and currently the patient is disease-free during the 24-month follow-up.

  11. Heavy-Section Steel Irradiation Program

    International Nuclear Information System (INIS)

    Rosseel, T.M.

    2000-01-01

    Maintaining the integrity of the reactor pressure vessel (RPV) in a light-water-cooled nuclear power plant is crucial in preventing and controlling severe accidents that have the potential for major contamination release. Because the RPV is the only key safety-related component of the plant for which a redundant backup system does not exist, it is imperative to fully understand the degree of irradiation-induced degradation of the RPV's fracture resistance that occurs during service. For this reason, the Heavy-Section Steel Irradiation (HSSI) Program has been established

  12. Complication of cesarean section: pregnancy on the cicatrix of a previous cesarean section.

    Science.gov (United States)

    Wang, Weimin; Long, Wenqing; Yu, Qunhuan

    2002-02-01

    To probe into the clinical manifestation, diagnosis, as well as treatment of pregnancy on the cicatrix of a previous cesarean section at the uterine isthmus in the first trimester. Analysis of 14 patients with pregnancy on the cicatrix of a previous cesarean section at the uterine isthmus in the first trimester was made after conservative treatment by drugs from January 1996 to December 1999. The 14 patients with a pregnancy on the cicatrix of a previous cesarean section at the uterine isthmus in the first trimester were painless, had slight vaginal bleeding, and concurrently had increased serum beta-subunit human chorionic gonadotropin (beta-HCG). Doppler ultrasonic examination revealed an obvious enlargement of the previous cesarean section cicatrix in the uterine isthmus, and found a gestational sac or mixed mass attached to the cicatrice, with a very thin myometrium between the gestational sac and bladder walls. Among the 14 patients, 12 patients had crystalline trichosanthes injected into the cervix, mifepristone taken orally, or methotrexate in the form of intramuscular injection. Following this procedure, their serum beta-HCG dropped to normal. The other 2 patients had a total hysterectomy. Pregnancy on the cicatrix of a previous cesarean section at the uterine isthmus in the first trimester is a complication of cesarean section. Early diagnosis and effective conservative treatment by drugs are instrumental in decreasing the potential occurrence of uterine rupture, which is also conducive to preserving the patient's future fertility.

  13. Effect of evaporation section and condensation section length on thermal performance of flat plate heat pipe

    International Nuclear Information System (INIS)

    Wang Shuangfeng; Chen Jinjian; Hu Yanxin; Zhang Wei

    2011-01-01

    Flat plate heat pipes (FPHPs) are one of the available technologies to deal with the high density electronic cooling problem due to their high thermal conductivity, reliability, and low weight penalty. A series of experiments were performed to investigate the effect of evaporation and condensation length on thermal performance of flat plate heat pipes. In the experiments, the FPHP had heat transfer length of 255 mm and width of 25 mm, and pure water was used as the working fluid. The results show that comparing to vapor chamber, the FPHP could realize long-distance heat transfer; comparing to the traditional heat pipe, the FPHP has large area contact with heat sources; the thermal resistance decreased and the heat transfer limit increased with the increase of evaporation section length; the FPHP would dry out at a lower heating power with the increase of condensation section length, which indicated that the heat transfer limit decreased, but the evaporator temperature also decreased; when the condensation section length approached to evaporation section length, the FPHP had a better thermal performance. - Highlights: → A strip sintered FPHP is proposed and tested. → The total heat transfer length reaches 255 mm → The efficiency of heat transport reaches 94.4%. → When the condensation section length approached to evaporation section length, the FPHP has better overall performance.

  14. ZZ SNLRML, Dosimetry Cross-Section Recommendations

    International Nuclear Information System (INIS)

    1996-01-01

    Description of program or function: Format: SAND-II; Number of groups: 640 group SAND-II group structure. Nuclides: Cd, B, Au, S, Ni, Li, F, Na, Mg, Al, Si, P, Sc, Ti, Mn, Fe, Co, Cu, Zn, Zr, Nb, Mo, Rh, Ag, In, I, Th, U, Np, Pu, Am. Origin: ENDF/B-VI, ENDF/B-V, IRDF-90, JENDL-3, JEF 2.2 and GLUCS data with special modifications from private communications. Weighting spectrum: flat. SNLRML is a reactor dosimetry library that draws upon all available evaluated cross section libraries and selects the best evaluation for application to research reactor spectrum determinations. Many of the components of the SNLRML come from the ENDF/B-VI and IRDF-90 (DLC-0161) libraries. The library format was selected for easy interface with spectrum determination codes such as SAND-II (CCC-0112 and LSL-M2 (PSR-233) and the new PSR-0345/SNL/SAND-II has been enhanced to interface with SNLRML. The data is recommended for spectrum determination applications and for the prediction of neutron activation of typical radiation sensor materials. The library has been tested for consistency of the cross section in wide variety of neutron environments. The results and cautions from this testing have been documented. The data has been interfaced with radiation transport codes, such as TWODANT-SYS (CCC-0547) and MCNP (CCC-0200), in order to compare calculated and measured activities for benchmark reactor experiments

  15. Pion production cross sections and associated parameters

    International Nuclear Information System (INIS)

    Bradbury, J.N.

    1985-01-01

    Negative pions have been used for radiotherapy at the meson factories LAMPF (USA), SIN (Switzerland), and TRIUMF (Canada) and have been planned for use at new meson facilities under construction (USSR) and at proposed dedicated medical facilities. Providing therapeutically useful dose rates of pions requires a knowledge of the pion production cross sections as a function of primary proton energy (500 to 1000 MeV), pion energy (less than or equal to100 MeV), production angle, and target material. The current status of the data base in this area is presented including theoretical guidelines for extrapolation purposes. The target material and geometry, as well as the proton and pion beam parameters, will affect the electron (and muon) contamination in the beam which may have an important effect on both the LET characteristics of the dose and the dose distribution. In addition to cross-section data, channel characteristics such as length of pion trajectory, solid-angle acceptance, and momentum analysis will affect dose rate, distribution, and quality. Such considerations are briefly addressed in terms of existing facilities and proposed systems. 16 refs., 6 figs

  16. Heavy-Section Steel Irradiation Program

    International Nuclear Information System (INIS)

    Corwin, W.R.

    1990-08-01

    The primary goal of the Heavy-Section Steel Irradiation Program is to provide a thorough, quantitative assessment of the effects of neutron irradiation on the material behavior (particularly the fracture toughness properties) of typical pressure-vessel steels as they relate to light-water-reactor pressure-vessel integrity. The program includes direct continuation of irradiation studies previously conducted by the Heavy-Section Steel Technology Program augmented by enhanced examinations of the accompanying microstructural changes. Effects of specimen size; material chemistry; product form and microstructure; irradiation fluence, flux, temperature, and spectrum; and postirradiation annealing are examined on a wide range of fracture properties. Detailed statistical analyses of the fracture data on K Ic shift of high-copper welds were performed. Analysis of the first phase of irradiated crack-arrest testing on high-copper welds was completed. Final analysis and publication of the results of the second phase of the irradiation studies on stainless steel weld-overlay cladding were completed. Determinations were made of the variations in chemistry and unirradiated RT NDT of low upper-shelf weld metal from the Midland reactor. Final analyses were performed on the Charpy impact and tensile data from the Second and Third Irradiation series on low upper-shelf welds, and the report on the series was drafted. A detailed survey of existing data on microstructural models and data bases of irradiation damage was performed, and initial development of a reaction-rate-based model was completed. 40 refs., 7 figs., 4 tabs

  17. Heavy-Section Steel Technology Program

    International Nuclear Information System (INIS)

    Pennell, W.E.

    1992-11-01

    The Heavy-Section Steel Technology (HSST) Program is conducted for the Nuclear Regulatory Commission (NRC) by Oak Ridge National Laboratory (ORNL). The program focus is on the development and validation of technology for the assessment of fracture-prevention margins in commercial nuclear reactor pressure vessels. The HSST Program is organized in 11 tasks: program management, fracture methodology and analysis, material characterization and properties, special technical assistance, fracture analysis computer programs, cleavage-crack initiation, cladding evaluations, pressurized-thermal-shock technology, analysis methods validation, fracture evaluation tests, and warm prestressing. The program tasks have been structured to place emphasis on the resolution fracture issues with near-term licensing significance. Resources to execute the research tasks are drawn from ORNL with subcontract support from universities and other research laboratories. Close contact is maintained with the sister Heavy-Section Steel Irradiation (HSSI) Program at ORNL and with related research programs both in the United States and abroad. This report provides an overview of principal developments in each of the II program tasks from October 1, 1991 to March 31, 1992

  18. Disgust discussed: introduction to the special section.

    Science.gov (United States)

    Pole, Nnamdi

    2013-03-01

    The author introduces a special section of Psychological Bulletin devoted to the study of disgust. After discussing conflicts between its supposed role as a basic emotion and its more recently understood involvement in responding to moral transgressions, the author summarizes 3 articles contained in the special section. Widen and Russell (2013) present a developmental account of disgust highlighting the ages at which children experience, express, understand, verbalize, and recognize disgust. The article shows that disgust is present early but that recognition of disgust in others is considerably delayed. Chapman and Anderson (2013) review evidence pertaining to the question of whether genuine disgust is elicited by moral transgressions. Their review covers data from self-report, brain imaging, facial behavior, and implicit measures gathered from both experimental and correlational studies. They conclude that moral transgressions elicit genuine disgust. Russell and Giner-Sorolla (2013) ask what types of moral transgressions are most likely to elicit pure disgust. They find that moral transgressions involving body violations are more likely than others to elicit such disgust. Moreover, they suggest that disgust elicited by body violations is likely to be more resistant to modification by context, situation, and efforts at rationalization. Taken together, the reviews support the view that rudiments of disgust to physical objects are present early in life but later become adapted to social influence and new moral purposes. Social implications are discussed. © 2013 American Psychological Association

  19. Placental Chorangiosis: Increased Risk for Cesarean Section

    Directory of Open Access Journals (Sweden)

    Shariska S. Petersen

    2017-01-01

    Full Text Available We describe a patient with Class C diabetes who presented for nonstress testing at 36 weeks and 4 days of gestation with nonreassuring fetal heart tones (NRFHT and oligohydramnios. Upon delivery, thrombosis of the umbilical cord was grossly noted. Pathological analysis of the placenta revealed chorangiosis, vascular congestion, and 40% occlusion of the umbilical vein. Chorangiosis is a vascular change of the placenta that involves the terminal chorionic villi. It has been proposed to result from longstanding, low-grade hypoxia in the placental tissue and has been associated with such conditions such as diabetes, intrauterine growth restriction (IUGR, and hypertensive conditions in pregnancy. To characterize chorangiosis and its associated obstetric outcomes we identified 61 cases of “chorangiosis” on placental pathology at Henry Ford Hospital from 2010 to 2015. Five of these cases were omitted due to lack of complete records. Among the 56 cases, the cesarean section rate was 51%, indicated in most cases for nonreassuring fetal status. Thus, we suggest that chorangiosis, a marker of chronic hypoxia, is associated with increased rates of cesarean sections for nonreassuring fetal status because of long standing hypoxia coupled with the stress of labor.

  20. K sup + nucleus total cross sections

    Energy Technology Data Exchange (ETDEWEB)

    Sawafta, R.

    1990-01-01

    The scattering of K{sup +} mesons from nuclei has attracted considerable interest in the last few years. The K{sup +} holds a very special position as the weakest of all strongly interaction probes. The average cross section is not larger than about 10 mb at lab momenta below 800 MeV/c, corresponding to a mean free path in the nucleus larger than 5 fm. Thus the K{sup +} is capable of probing the entire volume of the nucleus. Single scattering of the K{sup +} with a nucleon in the nucleus dominates the nuclear scattering, and only small and calculable higher order corrections are needed. The nucleon is a dynamical entity and its internal structure can, in principle, be altered by its surrounding nuclear environment. This work reports an experiment in which the K{sup +} is used to compare the nucleon in the nucleus with a free nucleon.

  1. CERN Martial Arts Club - Taekwondo Section

    CERN Multimedia

    CERN Martial Arts Club - Taekwondo Section

    2016-01-01

    Medals, Medals, Medals! Saturday 24th September: 120 people from all over Switzerland traveled to Lausanne to compete in the 19th Swiss Taekwondo Poomsae Championships. Accompanied by their trainer, Pascal Norek (5th Dan Taekwondo Master), six people from the Taekwondo section of the CERN Martial Arts Club competed, through their affiliation with the “IlGi Dojang” club in Geneva. These seven came home with thirteen medals, including seven golds!   Iva Raynova and Ruben Agudo Santos on their way to winning a gold medal in the pairs competition Taekwondo is a martial art that originated in Korea and is now practiced throughout the world. Although the most spectacular aspect of Taekwondo is its acrobatic kicks, it incorporates several activities to workout both body and mind. These include basic fitness (cardio, speed, strength, flexibility), self-defense, fighting and “poomsae”. This latter is a set of choreographed movements, the mastery of which requires th...

  2. Differential cross section of atomic hydrogen photoionization

    International Nuclear Information System (INIS)

    Kondratovich, V.D.; Ostrovskij, V.N.

    1986-01-01

    Differential cross-section of atomic hydrogen photoeffect in external electric field was investigated in semiclassical approximation. Interference was described. It occurred due to the fact that infinite number of photoelectron trajectories leads to any point of classically accessible motion region. Interference picture can reach macroscopic sizes. The picture is determined by location of function nodes, describing finite electron motion along one of parabolic coordinates. The squares of external picture rings are determined only by electric field intensity in the general case at rather high energies. Quantum expression for photocurrent density was obtained using Green function in superposition of Coulomb and uniform field as well as semiclassical approximation. Possible applications of macroscopic interference picture to specification of atom ionization potentials, selective detection of atoms or particular molecules, as well as weak magnetic field and observation of Aaronov-Bom effect are discussed

  3. Angle-averaged Compton cross sections

    International Nuclear Information System (INIS)

    Nickel, G.H.

    1983-01-01

    The scattering of a photon by an individual free electron is characterized by six quantities: α = initial photon energy in units of m 0 c 2 ; α/sub s/ = scattered photon energy in units of m 0 c 2 ; β = initial electron velocity in units of c; phi = angle between photon direction and electron direction in the laboratory frame (LF); theta = polar angle change due to Compton scattering, measured in the electron rest frame (ERF); and tau = azimuthal angle change in the ERF. We present an analytic expression for the average of the Compton cross section over phi, theta, and tau. The lowest order approximation to this equation is reasonably accurate for photons and electrons with energies of many keV

  4. Apparatus for sectioning demountable semiconductor samples

    Science.gov (United States)

    Sopori, B.L.; Wolf, A.

    1984-01-01

    Apparatus for use during polishing and sectioning operations of a ribbon sample is described. The sample holder includes a cylinder having an axially extending sample cavity terminated in a first funnel-shaped opening and a second slot-like opening. A spring-loaded pressure plunger is located adjacent the second opening of the sample cavity for frictional engagement of the sample cavity. A heat softenable molding medium is inserted in the funnel-shaped opening, to surround the sample. After polishing, the heater is energized to allow draining of the molding medium from the sample cavity. During manual polishing, the second end of the sample holder is inserted in a support ring which provides mechanical support as well as alignment of the sample holder during polishing. A gauge block for measuring the protrusion of a sample beyond the second wall of the holder is also disclosed.

  5. Plasma-based radar cross section reduction

    CERN Document Server

    Singh, Hema; Jha, Rakesh Mohan

    2016-01-01

    This book presents a comprehensive review of plasma-based stealth, covering the basics, methods, parametric analysis, and challenges towards the realization of the idea. The concealment of aircraft from radar sources, or stealth, is achieved through shaping, radar absorbing coatings, engineered materials, or plasma, etc. Plasma-based stealth is a radar cross section (RCS) reduction technique associated with the reflection and absorption of incident electromagnetic (EM) waves by the plasma layer surrounding the structure. A plasma cloud covering the aircraft may give rise to other signatures such as thermal, acoustic, infrared, or visual. Thus it is a matter of concern that the RCS reduction by plasma enhances its detectability due to other signatures. This needs a careful approach towards the plasma generation and its EM wave interaction. The book starts with the basics of EM wave interactions with plasma, briefly discuss the methods used to analyze the propagation characteristics of plasma, and its generatio...

  6. Feasibility of abdominoplasty with Cesarean section [Retraction

    Directory of Open Access Journals (Sweden)

    Thabet WN

    2013-01-01

    Full Text Available The Editor-in-Chief and Publisher of the International Journal of Women’s Health have been alerted by Dr Nadine Sherif, the corresponding author, to unacceptable levels of duplication with a previously published paper: Ali A, Essam A. Abdominoplasty Combined with Cesarean Delivery: Evaluation of the Practice. Aesthetic Plastic Surgery. 2011;35(1:80–86.It is worth noting that this paper was peer-reviewed by two peer-reviewers and the Editor-in-Chief of the International Journal of Women’s Health before publication. The paper concerned is: Thabet WN, Hossny AS, Sherif NA. Feasibility of abdominoplasty with Cesarean section. International Journal of Women’s Health. 2012;4:115–121.

  7. ISSUES IN NEUTRON CROSS SECTION COVARIANCES

    Energy Technology Data Exchange (ETDEWEB)

    Mattoon, C.M.; Oblozinsky,P.

    2010-04-30

    We review neutron cross section covariances in both the resonance and fast neutron regions with the goal to identify existing issues in evaluation methods and their impact on covariances. We also outline ideas for suitable covariance quality assurance procedures.We show that the topic of covariance data remains controversial, the evaluation methodologies are not fully established and covariances produced by different approaches have unacceptable spread. The main controversy is in very low uncertainties generated by rigorous evaluation methods and much larger uncertainties based on simple estimates from experimental data. Since the evaluators tend to trust the former, while the users tend to trust the latter, this controversy has considerable practical implications. Dedicated effort is needed to arrive at covariance evaluation methods that would resolve this issue and produce results accepted internationally both by evaluators and users.

  8. Depth sectioning using electron energy loss spectroscopy

    International Nuclear Information System (INIS)

    D'Alfonso, A J; Findlay, S D; Allen, L J; Cosgriff, E C; Kirkland, A I; Nellist, P D; Oxley, M P

    2008-01-01

    The continued development of electron probe aberration correctors for scanning transmission electron microscopy has enabled finer electron probes, allowing atomic resolution column-by-column electron energy loss spectroscopy. Finer electron probes have also led to a decrease in the probe depth of focus, facilitating optical slicing or depth sectioning of samples. The inclusion of post specimen aberration corrected image forming lenses allows for scanning confocal electron microscopy with further improved depth resolution and selectivity. We show that in both scanning transmission electron microscopy and scanning confocal electron microscopy geometries, by performing a three dimensional raster scan through a specimen and detecting electrons scattered with a characteristic energy loss, it will be possible to determine the location of isolated impurities embedded within the bulk.

  9. section of an accelerating cavity from LEP

    CERN Multimedia

    This is a section of an accelerating cavity from LEP, cut in half to show the layer of niobium on the inside. Operating at 4.2 degrees above absolute zero, the niobium is superconducting and carries an accelerating field of 6 million volts per metre with negligible losses. Each cavity has a surface of 6 m2. The niobium layer is only 1.2 microns thick, ten times thinner than a hair. Such a large area had never been coated to such a high accuracy. A speck of dust could ruin the performance of the whole cavity so the work had to be done in an extremely clean environment. These challenging requirements pushed European industry to new achievements. 256 of these cavities are now used in LEP to double the energy of the particle beams.

  10. Partial cross sections in H- photodetachment

    International Nuclear Information System (INIS)

    Halka, M.

    1993-04-01

    This dissertation reports experimental measurements of partial decay cross sections in the H - photodetachment spectrum. Observed decays of the 1 P 0 H -** (n) doubly-excitedresonances to the H(N=2) continuum are reported for n=2,3, and 4 from 1990 runs in which the author participated. A recent analysis of 1989 data revealing effects of static electric fields on the partial decay spectrum above 13.5 eV is also presented. The experiments were performed at the High Resolution Atomic Beam Facility. the Los Alamos Meson Physics Facility, with a relativistic H - beam (β=0.842)intersecting a ND:YAG laser. Variation of the intersection angle amounts to Doppler-shifting the photon energy, allowing continuous tuning of the laser energy as viewed from the moving ions' frame

  11. Nailed timber beams with I composed section

    Directory of Open Access Journals (Sweden)

    Jorge Luís Nunes de Góes

    2003-01-01

    Full Text Available The employment of built-up timber beams, made of commercial dimensions pieces, is becoming increasingly important in timber structures in Brazil, mainly due to the ever-growing scarcity of timber elements in larger sizes. The built-up system has vast application, from beams for residential buildings to girders for small bridges. The objective of this work is the theoretical and experimental study of nailed timber beams with composed cross section I. The design procedure of EUROCODE 5/93 and NBR 7190/97 are shown and evaluated, as well as the theory about the subject matter. The experimental evaluation of the theoretical models was made by means of bending tests in prototypes of built-up timber beams. The obtained results shows that the EUROCODE 5/93 procedure is the most indicated for evaluating effective bending stiffness, normal and shear stresses as well as the load on fasteners.

  12. Angle-averaged Compton cross sections

    Energy Technology Data Exchange (ETDEWEB)

    Nickel, G.H.

    1983-01-01

    The scattering of a photon by an individual free electron is characterized by six quantities: ..cap alpha.. = initial photon energy in units of m/sub 0/c/sup 2/; ..cap alpha../sub s/ = scattered photon energy in units of m/sub 0/c/sup 2/; ..beta.. = initial electron velocity in units of c; phi = angle between photon direction and electron direction in the laboratory frame (LF); theta = polar angle change due to Compton scattering, measured in the electron rest frame (ERF); and tau = azimuthal angle change in the ERF. We present an analytic expression for the average of the Compton cross section over phi, theta, and tau. The lowest order approximation to this equation is reasonably accurate for photons and electrons with energies of many keV.

  13. Sudakov resummation of multiparton QCD cross sections

    CERN Document Server

    Bonciani, R; Mangano, Michelangelo L; Nason, P

    2003-01-01

    We present the general expressions for the resummation, up to next-to-leading logarithmic accuracy, of Sudakov-type logarithms in processes with an arbirtrary number of hard-scattering partons. These results document the formulae used by the authors in several previous phenomenological studies. The resummation formulae presented here, which are valid for phase-space factorizable observables, determine the resummation correction in a process-independent fashion. All process dependence is encoded in the colour and flavour structure of the leading order and virtual one-loop amplitudes, and in Sudakov weights associated to the cross section kinematics. We explicitly illustrate the application to the case of Drell--Yan and prompt-photon production.

  14. Sudakov resummation of multiparton QCD cross sections

    International Nuclear Information System (INIS)

    Bonciani, Roberto; Catani, Stefano; Mangano, Michelangelo L.; Nason, Paolo

    2003-01-01

    We present the general expressions for the resummation, up to next-to-leading logarithmic accuracy, of Sudakov-type logarithms in processes with an arbitrary number of hard-scattering partons. These results document the formulae used by the authors in several previous phenomenological studies. The resummation formulae presented here, which are valid for phase-space factorizable observables, determine the resummation correction in a process-independent fashion. All process dependence is encoded in the colour and flavour structure of the leading order and virtual one-loop amplitudes, and in Sudakov weights associated to the cross section kinematics. We explicitly illustrate the application to the case of Drell-Yan and prompt-photon production

  15. Electroweak Boson Cross-Section Measurements

    CERN Document Server

    The ATLAS collaboration

    2009-01-01

    This report summarises the ATLAS prospects for the measurement of W and Z pro- duction cross-section at the LHC. The electron and muon decay channels are considered. Focusing on the early data taking phase, strategies are presented that allow a fast and robust extraction of the signals. An overall uncertainty of about 5% can be achieved with 50 pb−1 in the W channels, where the background uncertainty dominates (the luminosity measurement uncertainty is not discussed here). In the Z channels, the expected preci- sion is 3%, the main contribution coming from the lepton selection efficiency uncertainty. Extrapolating to 1 fb−1 , the uncertainties shrink to incompressible values of 1-2%, de- pending on the final state. This irreducible uncertainty is essentially driven by strong interaction effects, notably parton distribution uncertainties and non-perturbative effects, affecting the W and Z rapidity and transverse momentum distributions. These effects can be constrained by measuring these distributions. Al...

  16. Reaction cross section for Ne isotopes

    International Nuclear Information System (INIS)

    Panda, R.N.; Sahu, B.K.; Patra, S.K.

    2012-01-01

    In the present contribution, first the bulk properties are calculated, such as binding energy (BE), root mean square charge radius r ch , matter radius r m and quadrupole deformation parameter β 2 for 18-32 Ne isotopes in the Relativistic mean field (RMF) and effective field theory motivated RMF (E-RMF) formalisms . Then the total nuclear reaction cross section σR is analyzes for the scattering of 20 Ne and 28-32 Ne from a 12 C target at 240 MeV/nucleon by using the RMF model. Thus the objective of the present study is to calculate the bulk properties as well as a systematic analysis of σR over a range of neutron rich nuclei in the frame work of Glauber model

  17. Detailed sectional anatomy of the spine

    International Nuclear Information System (INIS)

    Rauschning, W.

    1985-01-01

    Morphologic studies on the human spine constitute a special challenge because of the spine's complex topographic anatomy and the intimate relationship between the supporting skeleton and the contiguous soft tissues (muscles, discs, joint capsules) as well as the neurovascular contents of the spinal canal and intervertebral foramina. The improving resolution and multiplanar image reformatting capabilities of modern CT scanners call for accurate anatomic reference material. Such anatomic images should be available without distortion, in natural colors, and in considerable detail. The images should present the anatomy in the correct axial, sagittal, and coronal planes and should also be sufficiently closely spaced so as to follow the thin cuts of modern CT scanners. This chapter details one of several recent attempts to correlate gross anatomy with the images depicted by high-resolution CT. The methods of specimen preparation, sectioning, and photographing have been documented elsewhere

  18. Topological supersymmetric structure of hadron cross sections

    International Nuclear Information System (INIS)

    Gauron, P.; Nicolescu, B.; Ouvry, S.

    1980-12-01

    Recently a way of fully implementing unitarity in the framework of a Dual Topological Unitarization theory, including not only mesons but also baryons, was found. This theory consists in the topological description of hadron interactions involving confined quarks in terms of two 2-dimensional surfaces (a closed 'quantum' surface and a bounded 'classical' surface). We show that this description directly leads, at the zeroth order of the topological expansion, to certain relations between hadron cross-sections, in nice agreement with experimental data. A new topological suppression mechanism is shown to play an important dynamical role. We also point out a new topological supersymmetry property, which leads to realistic experimental consequences. A possible topological origin of the rho and ω universality relations emerges as a by-product of our study

  19. Neutron scattering cross sections of uranium-238

    International Nuclear Information System (INIS)

    Beghian, L.E.; Kegel, G.H.R.; Marcella, T.V.; Barnes, B.K.; Couchell, G.P.; Egan, J.J.; Mittler, A.; Pullen, D.J.; Schier, W.A.

    1979-01-01

    The University of Lowell high-resolution time-of-flight spectrometer was used to measure angular distributions and 90-deg excitation functions for neutrons scattered from 238 U in the energy range from 0.9 to 3.1 MeV. This study was limited to the elastic and the first two inelastic groups, corresponding to states of 238 U at 45 keV (2 + ) and 148 keV (4 + ). Angular distributions were measured at primary neutron energies of 1.1, 1.9, 2.5, and 3.1 MeV for the same three neutron groups. Whereas the elastic data are in fair agreement with the evaluation in the ENDF/B-IV file, there is substantial disagreement between the inelastic measurements and the evaluated cross sections. 12 figures

  20. Fission cross-section normalization problems

    International Nuclear Information System (INIS)

    Wagemans, C.; Ghent Rijksuniversiteit; Deruytter, A.J.

    1983-01-01

    The present measurements yield σsub(f)-data in the neutron energy from 20 MeV to 30 keV directly normalized in the thermal region. In the keV-region these data are consistent with the absolute σsub(f)-measurements of Szabo and Marquette. For the secondary normalization integral I 2 values have been obtained in agreement with those of Gwin et al. and Czirr et al. which were also directly normalized in the thermal region. For the I 1 integral, however, puzzling low values have been obtained. This was also the case for σsub(f)-bar in neutron energy intervals containing strong resonances. Three additional measurements are planned to further investigate these observations: (i) maintaining the actual approx.2π-geometry but using a 10 B-foil for the neutron flux detection (ii) using a low detection geometry with a 10 B- as well as a 6 Li-flux monitor. Only after these measurements definite conclusions on the I 1 and I 2 integrals can be formulated and final σsub(f)-bar-values can be released. The present study also gives some evidence for a correlation between the integral I 2 and the neutron flux monitor used. The influence of a normalization via I 1 or I 2 on the final cross-section has been shown. The magnitude of possible normalization errors is illustrated. Finally, since 235 U is expected to be an ''easy'' nucleus (low α-activity high σsub(f)-values), there are some indications that the important discrepancies still present in 235 U(n,f) cross-section measurements might partially be due to errors in the neutron flux determination

  1. Effective education to decrease elective caesarean section

    International Nuclear Information System (INIS)

    Sanavi, F. S.; Rakhshani, F.

    2014-01-01

    Objective: To examine the effect of education on deciding about natural delivery in women opting for elective caesarean section. Methods: The quasi-experimental study was carried out between January and March 2012 and comprised a sample of 200 women in their third trimester of pregnancy attending women's clinics of Imam Ali Hospital, Zahedan, Iran, with the intention of having elective caesarean section. The subjects were voluntarily classified into three groups: one group received an educational package; the other had educational package along with group discussion, and the last one without any intervention was considered the control group. Post-test was conducted a month after intervention. Data were analysed using Kruskal Wallis, and logistic regression tests. Results: Group A represented the controls and had 100 (50%) women; Group B with the educational package had 40 (20%), while there were 60 (30%) women in Group C who had exposure to the educational package as well as group discussion. There were significant changes in behaviour in Group B and C (p <0.01) but no change among the controls in Group A. In Group C, 25 (42%) women decided to go for natural delivery, while 1 (2.5%) woman had a change of opinion in Group B. Four (4%) women in the control Group A had ultimately natural delivery, but they were all emergency cases. Conclusion: The two educational methods increased model construct scores, including awareness, attitude, perceived behaviour control, subjective norms and behavioural intention. Nevertheless, educational package in conjunction with group discussion was more effective in influencing the choice towards natural delivery. (author)

  2. PREDICTED SEDIMENTARY SECTION OF SUBGLACIAL LAKE VOSTOK

    Directory of Open Access Journals (Sweden)

    G. I. Leychenkov

    2012-01-01

    Full Text Available In early February 2012, the drill hole at the Vostok Station encountered theLakeVostokwater. This step is important to study the lake composition including possible microbial life and to model subglacial environments however, the next ambitious target of the Vostok Drilling Project is sampling of bottom sediments, which contain the unique record of ice sheet evolution and environmental changes in centralAntarcticafor millions of years. In this connection, the forecast of sedimentary succession based on existing geophysical data, study of mineral inclusions in the accretion ice cores and tectonic models is important task. Interpretation of Airborne geophysical data suggests thatLakeVostokis the part of spacious rift system, which exists at least from Cretaceous. Reflection and refraction seismic experiments conducted in the southern part ofLakeVostokshow very thin (200–300 m stratified sedimentary cover overlying crystalline basement with velocity of 6.0–6.2 km/s. At present, deposition in southernLakeVostokis absent and similar conditions occurred likely at least last3 m.y. when ice sheet aboveLakeVostokchanged insignificantly. It can be also inferred that from the Late Miocene the rate of deposition inLakeVostokwas extremely low and so the most of sedimentary section is older being possibly of Oligocene to early to middle Miocene age when ice sheet oscillated and deposition was more vigorous. If so, the sampling of upper few meters of this condensed section is very informative in terms of history of Antarctic glaciation. Small thickness of sedimentary cover raises a question about existence of lake (rift depression during preglacial and early glacial times.

  3. Heavy-section steel irradiation program summary

    International Nuclear Information System (INIS)

    Corwin, W.R.; Nanstad, R.K.; Iskander, S.K.; Haggag, F.M.

    1992-01-01

    Since a failure of the RPV carries the potential of major contamination release and severe accident, it is imperative to safe reactor operation to understand and be able to accurately predict failure models of the vessel material. For this reason, the Heavy-Section Steel Irradiation (HSSI) Program has been established with its primary goal to provide a thorough, quantitative assessment of the effects of neutron irradiation on the material behavior, and in particular the fracture toughness properties, of typical pressure vessel steels as they relate to light-water RPVs. The program includes the direct continuation of irradiation studies previously conducted within the Heavy-Section Steel Technology Program augmented by enhanced examinations of the accompanying microstructural changes. Effects of specimen size, material chemistry, product form and microstructure, irradiation fluence, flux, temperature and spectrum, and postirradiation annealing are being examined on a wide range of fracture properties including fracture toughness (K Ic and J Ic ), crack-arrest toughness (K Ia ), ductile tearing resistance (dJ/da), Charpy V-notch impact energy, dropweight nil-ductility temperature (NDT), and tensile properties. Models based on observations of radiation-induced microstructural changes using field ion and high-resolution transmission electron microscopy provide a firmer basis for extrapolating the measured changes in fracture properties to wider ranges of irradiation conditions. The principal materials examined within the HSSI Program are highcopper welds since their postirradiation properties are most frequently limiting in the continued safe operation of commercial RPVs. In addition, a limited effort will focus on stainless steel weld overlay cladding, typical of that used on the inner surface of RPVs, since its postirradiation fracture properties have the potential for strongly affecting the extension of small surface flaws during overcooling transients. (orig./GL)

  4. 49 CFR 236.52 - Relayed cut-section.

    Science.gov (United States)

    2010-10-01

    ..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Rules and Instructions: All Systems Track Circuits § 236.52 Relayed cut-section. Where relayed cut-section is used in... 49 Transportation 4 2010-10-01 2010-10-01 false Relayed cut-section. 236.52 Section 236.52...

  5. 40 CFR 52.2465 - Original identification of plan section.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 4 2010-07-01 2010-07-01 false Original identification of plan section. 52.2465 Section 52.2465 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Original identification of plan section. (a) This section identifies the original “Air Implementation Plan...

  6. 40 CFR 52.2186 - Original identification of plan section.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 4 2010-07-01 2010-07-01 false Original identification of plan section. 52.2186 Section 52.2186 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Original identification of plan section. (a) This section identifies the original “Air Implementation Plan...

  7. 40 CFR 52.1100 - Original identification of plan section.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 4 2010-07-01 2010-07-01 false Original identification of plan section. 52.1100 Section 52.1100 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Original identification of plan section. (a) This section identifies the original “Air Implementation Plan...

  8. 40 CFR 52.1281 - Original identification of plan section.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 4 2010-07-01 2010-07-01 false Original identification of plan section. 52.1281 Section 52.1281 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Original identification of plan section. (a) This section identifies the original “Air Implementation Plan...

  9. 40 CFR 52.1640 - Original identification of plan section.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 4 2010-07-01 2010-07-01 false Original identification of plan section. 52.1640 Section 52.1640 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Original identification of plan section. (a) This section identifies the original “State of New Mexico...

  10. 40 CFR 52.1426 - Original identification of plan section.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 4 2010-07-01 2010-07-01 false Original identification of plan section. 52.1426 Section 52.1426 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Original identification of plan section. (a) This section identifies the original “Nebraska Air Quality...

  11. 40 CFR 52.1535 - Original identification of plan section.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 4 2010-07-01 2010-07-01 false Original identification of plan section. 52.1535 Section 52.1535 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Original identification of plan section. (a) This section identifies the original “Air Implementation Plan...

  12. 40 CFR 52.1783 - Original identification of plan section.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 4 2010-07-01 2010-07-01 false Original identification of plan section. 52.1783 Section 52.1783 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Original identification of plan section. (a) This section identifies the original “Air Implementation Plan...

  13. 40 CFR 52.2239 - Original Identification of plan section.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 4 2010-07-01 2010-07-01 false Original Identification of plan section. 52.2239 Section 52.2239 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Original Identification of plan section. (a) This section identifies the original “Tennessee Air Pollution...

  14. PREFACE: Focus section on Hadronic Physics

    Science.gov (United States)

    Roberts, Craig; Swanson, Eric

    2007-07-01

    Hadronic physics is the study of strongly interacting matter and its underlying theory, Quantum Chromodynamics (QCD). The field had its beginnings after World War Two, when hadrons were discovered in ever increasing numbers. Today, it encompasses topics like the quark-gluon structure of hadrons at varying scales, the quark-gluon plasma and hadronic matter at extreme temperature and density; it also underpins nuclear physics and has significant impact on particle physics, astrophysics, and cosmology. Among the goals of hadronic physics are to determine the parameters of QCD, understand the origin and characteristics of confinement, understand the dynamics and consequences of dynamical chiral symmetry breaking, explore the role of quarks and gluons in nuclei and in matter under extreme conditions and understand the quark and gluon structure of hadrons. In general, the process is one of discerning the relevant degrees of freedom and relating these to the fundamental fields of QCD. The emphasis is on understanding QCD, rather than testing it. The papers gathered in this special focus section of Journal of Physics G: Nuclear and Particle Physics attempt to cover this broad range of subjects. Alkofer and Greensite examine the issue of quark and gluon confinement with the focus on models of the QCD vacuum, lattice gauge theory investigations, and the relationship to the AdS/CFT correspondence postulate. Arrington et al. review nucleon form factors and their role in determining quark orbital momentum, the strangeness content of the nucleon, meson cloud effects, and the transition from nonperturbative to perturbative QCD dynamics. The physics associated with hadronic matter at high temperature and density and at low Bjorken-x at the Relativistic Heavy Ion Collider (RHIC), the SPS at CERN, and at the future LHC is summarized by d'Enterria. The article of Lee and Smith examines experiment and theory associated with electromagnetic meson production from nucleons and

  15. Maternal and Fetal Outcome in Elective versus Emergency Cesarean Section

    Directory of Open Access Journals (Sweden)

    Anupama Suwal

    2013-12-01

    Results: The incidence of cesarean section was 254 (22.30% out of which emergency cesarean section accounted for 167 (65.7% and elective cesarean section for 87 (34.3%. The usual indications of emergency cesarean section were fetal distress, previous cesarean section in labour, non progress of labour and prolonged second stage of labour. The usual indications of elective cesarean section were previous cesarean section, breech, cephalopelvic disproportion and cesarean section on demand. There was found to be no significant difference in age, period of gestation, blood loss and blood transfusion in emergency vs. elective cesarean section. There was significant difference seen in the length of hospital stay, fever, urinary tract infection, wound infection and low APGAR in five minutes indicating that these were more common in emergency cesarean section. Significant difference was also seen in the incidence of postpartum haemorrhage indicating that it was seen more in elective cesarean section. Conclusions: The incidence of cesarean section in Nepal Medical College Teaching Hospital is high and the overall complication rate is higher in emergency cesarean section than in elective cesarean section. Keywords: cesarean section; fetal and maternal outcome.

  16. 75 FR 34421 - Notice of Funds Availability for Section 514 Farm Labor Housing Loans and Section 516 Farm Labor...

    Science.gov (United States)

    2010-06-17

    ... DEPARTMENT OF AGRICULTURE Rural Housing Service Notice of Funds Availability for Section 514 Farm Labor Housing Loans and Section 516 Farm Labor Housing Grants for Off-Farm Housing for Fiscal Year (FY... the timeframe to submit pre-applications for section 514 Farm Labor Housing (FLH) loans and section...

  17. 26 CFR 1.1245-6 - Relation of section 1245 to other sections.

    Science.gov (United States)

    2010-04-01

    ... accounting treatment of asset retirements), does not require recognition of such gain. (d) Installment method... 1231 (relating to property used in the trade or business), the gain recognized under section 1245(a)(1...). For limitation on amount of adjustments reflected in adjusted basis of property disposed of by an...

  18. Accurate measurements of neutron activation cross sections

    International Nuclear Information System (INIS)

    Semkova, V.

    1999-01-01

    The applications of some recent achievements of neutron activation method on high intensity neutron sources are considered from the view point of associated errors of cross sections data for neutron induced reaction. The important corrections in -y-spectrometry insuring precise determination of the induced radioactivity, methods for accurate determination of the energy and flux density of neutrons, produced by different sources, and investigations of deuterium beam composition are considered as factors determining the precision of the experimental data. The influence of the ion beam composition on the mean energy of neutrons has been investigated by measurement of the energy of neutrons induced by different magnetically analysed deuterium ion groups. Zr/Nb method for experimental determination of the neutron energy in the 13-15 MeV energy range allows to measure energy of neutrons from D-T reaction with uncertainty of 50 keV. Flux density spectra from D(d,n) E d = 9.53 MeV and Be(d,n) E d = 9.72 MeV are measured by PHRS and foil activation method. Future applications of the activation method on NG-12 are discussed. (author)

  19. [Fast neutron cross section measurements]: Progress report

    International Nuclear Information System (INIS)

    1988-01-01

    As projected in our previous proposal, the past year on the cross section project at the University of Michigan has been one primarily of construction and assembly of our 14 MeV pulsed Neutron Facility. All the components of the system have now been either purchased or fabricated in our shop facilities and have been assembled in their final configuration. We are now in the process of testing the rf components that have been designed to deliver voltage to both the pulser and buncher stages. We expect that the system will be operational by the end of the current contract year. We have also accomplished the design and construction of several other major pieces of equipment that are needed to begin fast neutron time-of-flight measurements. These include the primary proton recoil detector, and a californium fission chamber needed in the efficiency calibration of the primary detector. We have also added considerable concrete shielding designed to lower the neutron background in the experimental area. 10 figs., 5 tabs

  20. Neutron cross section measurements at ORELA

    International Nuclear Information System (INIS)

    Dabbs, J.W.T.

    1979-01-01

    ORELA (Oak Ridge Electron Linear Accelerator) has been for the last decade the most powerful and useful pulsed neutron time-of-flight facility in the world, particularly in the broad midrange of neutron energies (10 eV to 1 MeV). This position will be enhanced with the addition of a pulse narrowing prebuncher, recently installed and now under test. Neutron capture, fission, scattering, and total cross sections are measured by members of the Physics and Engineering Physics Divisions of ORNL, and by numerous guests and visitors. Several fundamental and applied measurements are described, with some emphasis on instrumentation used. The facility comprises the accelerator and its target(s), 10 evacuated neutron flight paths having 18 measurement stations at flight path distances 8.9 to 200 meters, and a complex 4-computer data acquisition system capable of handling some 17,000 32-bit events/s from a total of 12 data input ports. The system provides a total of 2.08 x 10 6 words of data storage on 3 fast disk units. In addition, a dedicated PDP-10 timesharing system with a 250-megabyte disk system and 4 PDP-15 graphic display satellites permits on-site data reduction and analysis. More than 10 man-years of application software development supports the system, which is used directly by individual experiments. 12 figures, 1 table

  1. Overview. Department of Nuclear Radiospectroscopy. Section 8

    Energy Technology Data Exchange (ETDEWEB)

    Hennel, J.W. [Institute of Nuclear Physics, Cracow (Poland)

    1995-12-31

    Research at the Department of Nuclear Radiospectroscopy of thr H. Niewodniczanski Institute of Nuclear Physics covers three areas: magnetic resonance, magnetic resonance imaging and solid state physics by computer simulation. In first of the mentioned above research directions, we apply magnetic resonance method in studies of molecular rotation in solids. Two ways of rotation have been distinguished: tunneling through the potential barriers and random jumps between distinct orientations. In the second one, the magnetic resonance microscope based on a 6.3 T superconducting magnet was completed. Each part of this system was tested and appropriate software has been written in the Laboratory and used for testing, optimization and running the experiment. In the field of solid state physics the work was concentrated around consequences of tetragonal-orthorhombic phase transition, experimentally observed in high temperature superconducting materials. In this section of the Annual Report, the detail descriptions of mentioned activities as well as the information about personnel employed in the Department, papers and reports published in 1994, contribution to conferences and grants are also given.

  2. Resonance capture cross section of 207Pb

    CERN Document Server

    Domingo-Pardo, C.; Aerts, G.; Alvarez-Pol, H.; Alvarez-Velarde, F.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, G.; Baumann, P.; Becvar, F.; Berthoumieux, E.; Bisterzo, S.; Calvino, F.; Cano-Ott, D.; Capote, R.; Carrapico, C.; Cennini, P.; Chepel, V.; Chiaveri, E.; Colonna, N.; Cortes, G.; Couture, A.; Cox, J.; Dahlfors, M.; David, S.; Dillman, I.; Dolfini, R.; Dridi, W.; Duran, I.; Eleftheriadis, C.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Fitzpatrick, L.; Frais-Koelbl, H.; Fujii, K.; Furman, W.; Gallino, R.; Goncalves, I.; Gonzalez-Romero, E.; Goverdovski, A.; Gramegna, F.; Griesmayer, E.; Guerrero, C.; Gunsing, F.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Isaev, S.; Jericha, E.; Kadi, Y.; Kappeler, F.; Karamanis, D.; Karadimos, D.; Kerveno, M.; Ketlerov, V.; Koehler, P.; Konovalov, V.; Kossionides, E.; Krticka, M.; Lamboudis, C.; Leeb, H.; Lindote, A.; Lopes, I.; Lozano, M.; Lukic, S.; Marganiec, J.; Marrone, S.; Mastinu, P.; Mengoni, A.; Milazzo, P.M.; Moreau, C.; Mosconi, M.; Neves, F.; Oberhummer, H.; Oshima, M.; O'Brien, S.; Pancin, J.; Papachristodoulou, C.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rosetti, M.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Sarchiapone, L.; Savvidis, I.; Stephan, C.; Tagliente, G.; Tain, J.L.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vincente, M.C.; Vlachoudis, V.; Vlastou, R.; Voss, F.; Walter, S.; Wendler, H.; Wiescher, M.; Wisshak, K.

    2006-01-01

    The radiative neutron capture cross section of 207Pb has been measured at the CERN neutron time of flight installation n_TOF using the pulse height weighting technique in the resolved energy region. The measurement has been performed with an optimized setup of two C6D6 scintillation detectors, which allowed us to reduce scattered neutron backgrounds down to a negligible level. Resonance parameters and radiative kernels have been determined for 16 resonances by means of an R-matrix analysis in the neutron energy range from 3 keV to 320 keV. Good agreement with previous measurements was found at low neutron energies, whereas substantial discrepancies appear beyond 45 keV. With the present results, we obtain an s-process contribution of 77(8)% to the solar abundance of 207Pb. This corresponds to an r-process component of 23(8)%, which is important for deriving the U/Th ages of metal poor halo stars.

  3. Overview. Department of Nuclear Radiospectroscopy. Section 8

    International Nuclear Information System (INIS)

    Hennel, J.W.

    1995-01-01

    Research at the Department of Nuclear Radiospectroscopy of thr H. Niewodniczanski Institute of Nuclear Physics covers three areas: magnetic resonance, magnetic resonance imaging and solid state physics by computer simulation. In first of the mentioned above research directions, we apply magnetic resonance method in studies of molecular rotation in solids. Two ways of rotation have been distinguished: tunneling through the potential barriers and random jumps between distinct orientations. In the second one, the magnetic resonance microscope based on a 6.3 T superconducting magnet was completed. Each part of this system was tested and appropriate software has been written in the Laboratory and used for testing, optimization and running the experiment. In the field of solid state physics the work was concentrated around consequences of tetragonal-orthorhombic phase transition, experimentally observed in high temperature superconducting materials. In this section of the Annual Report, the detail descriptions of mentioned activities as well as the information about personnel employed in the Department, papers and reports published in 1994, contribution to conferences and grants are also given

  4. Josephson cross-sectional model experiment

    International Nuclear Information System (INIS)

    Ketchen, M.B.; Herrell, D.J.; Anderson, C.J.

    1985-01-01

    This paper describes the electrical design and evaluation of the Josephson cross-sectional model (CSM) experiment. The experiment served as a test vehicle to verify the operation at liquid-helium temperatures of Josephson circuits integrated in a package environment suitable for high-performance digital applications. The CSM consisted of four circuit chips assembled on two cards in a three-dimensional card-on-board package. The chips (package) were fabricated in a 2.5-μm (5-μm) minimum linewidth Pb-alloy technology. A hierarchy of solder and pluggable connectors was used to attach the parts together and to provide electrical interconnections between parts. A data path which simulated a jump control sequence and a cache access in each machine cycle was successfully operated with cycle times down to 3.7 ns. The CSM incorporated the key components of the logic, power, and package of a prototype Josephson signal processor and demonstrated the feasibility of making such a processor with a sub-4-ns cycle time

  5. HVAC system optimisation-in-building section

    Energy Technology Data Exchange (ETDEWEB)

    Lu, L.; Cai, W.; Xie, L.; Li, S.; Soh, Y.C. [School of Electrical and Electronic Engineering, Nanyang Technological University, Singapore (Singapore)

    2004-07-01

    This paper presents a practical method to optimise in-building section of centralised Heating, Ventilation and Air-Conditioning (HVAC) systems which consist of indoor air loops and chilled water loops. First, through component characteristic analysis, mathematical models associated with cooling loads and energy consumption for heat exchangers and energy consuming devices are established. By considering variation of cooling load of each end user, adaptive neuro-fuzzy inference system (ANFIS) is employed to model duct and pipe networks and obtain optimal differential pressure (DP) set points based on limited sensor information. A mix-integer nonlinear constraint optimization of system energy is formulated and solved by a modified genetic algorithm. The main feature of our paper is a systematic approach in optimizing the overall system energy consumption rather than that of individual component. A simulation study for a typical centralized HVAC system is provided to compare the proposed optimisation method with traditional ones. The results show that the proposed method indeed improves the system performance significantly. (author)

  6. HVAC system optimization - in-building section

    Energy Technology Data Exchange (ETDEWEB)

    Lu Lu; Wenjian Cai; Lihua Xie; Shujiang Li; Yeng Chai Soh [Nanyang Technological Univ., Singapore (Singapore). School of Electrical and Electronic Engineering

    2005-01-01

    This paper presents a practical method to optimize in-building section of centralized Heating, Ventilation and Air-conditioning (HVAC) systems which consist of indoor air loops and chilled water loops. First, through component characteristic analysis, mathematical models associated with cooling loads and energy consumption for heat exchangers and energy consuming devices are established. By considering variation of cooling load of each end user, adaptive neuro-fuzzy inference system (ANFIS) is employed to model duct and pipe networks and obtain optimal differential pressure (DP) set points based on limited sensor information. A mix-integer nonlinear constraint optimization of system energy is formulated and solved by a modified genetic algorithm. The main feature of our paper is a systematic approach in optimizing the overall system energy consumption rather than that of individual component. A simulation study for a typical centralized HVAC system is provided to compare the proposed optimization method with traditional ones. The results show that the proposed method indeed improves the system performance significantly. (author)

  7. Problems With Section Two ITP TOEFL Test

    Directory of Open Access Journals (Sweden)

    Rizki Ananda

    2016-03-01

    Full Text Available This study was designed to investigate (1 the difficulties faced by EFL university students with section two of the ITP, and (2 whether part A or part B was more difficult for them and why. A number of 26 students from two different universities, Syiah Kuala University and the State Islamic University Ar-Raniry were the samples for the test. The data was obtained from a multiple choice questionnaire test consisting of 46 questions, each with 4 answers to choose from. The results showed that inversions (12%, subject-verb agreements (10%, adverb clause connectors (7%, passives (6%, reduced adjective clauses (5%, parallel structures (5% and use of verbs (5% were the most difficult questions for the students. Furthermore, they felt that part B was more difficult than part A, as finding an error in a sentence was harder than completing a sentence from a multiple choice. Furthermore, the length of questions in part A did not affect the amount of time the students spent to complete part A and did not cause them to panic. Also, unfamiliar words in part A were not regarded as a problem by the students. Hence, TOEFL teachers and trainers are highly encouraged to pay more attention to doing study exercises for the seven topics with the highest percentages above in part A and also to more practice for part B.

  8. Female medical leadership: cross sectional study.

    Science.gov (United States)

    Kvaerner, K J; Aasland, O G; Botten, G S

    1999-01-09

    To assess the relation between male and female medical leadership. Cross sectional study on predictive factors for female medical leadership with data on sex, age, specialty, and occupational status of Norwegian physicians. Oslo, Norway. 13 844 non-retired Norwegian physicians. Medical leaders, defined as physicians holding a leading position in hospital medicine, public health, academic medicine, or private health care. 14.6% (95% confidence interval 14.0% to 15.4%) of the men were leaders compared with 5.1% (4.4% to 5.9%) of the women. Adjusted for age men had a higher estimated probability of leadership in all categories of age and job, the highest being in academic medicine with 0.57 (0.42 to 0.72) for men aged over 54 years compared with 0.39 (0.21 to 0.63) for women in the same category. Among female hospital physicians there was a positive relation between the proportion of women in their specialty and the probability of leadership. Women do not reach senior positions as easily as men. Medical specialties with high proportions of women have more female leaders.

  9. New resonance cross section calculational algorithms

    International Nuclear Information System (INIS)

    Mathews, D.R.

    1978-01-01

    Improved resonance cross section calculational algorithms were developed and tested for inclusion in a fast reactor version of the MICROX code. The resonance energy portion of the MICROX code solves the neutron slowing-down equations for a two-region lattice cell on a very detailed energy grid (about 14,500 energies). In the MICROX algorithms, the exact P 0 elastic scattering kernels are replaced by synthetic (approximate) elastic scattering kernels which permit the use of an efficient and numerically stable recursion relation solution of the slowing-down equation. In the work described here, the MICROX algorithms were modified as follows: an additional delta function term was included in the P 0 synthetic scattering kernel. The additional delta function term allows one more moments of the exact elastic scattering kernel to be preserved without much extra computational effort. With the improved synthetic scattering kernel, the flux returns more closely to the exact flux below a resonance than with the original MICROX kernel. The slowing-down calculation was extended to a true B 1 hyperfine energy grid calculatn in each region by using P 1 synthetic scattering kernels and tranport-corrected P 0 collision probabilities to couple the two regions. 1 figure, 6 tables

  10. [Psychoprophylaxis and the rate of cesarean section].

    Science.gov (United States)

    Oyuela-García, Juana; Hernández-Herrera, Ricardo Jorge

    2010-01-01

    The psychoprophylactic programs (PPP) have been widely used in women to face the fear-tension-pain cycle, reducing anxiety and pain during labour. The aim was to demonstrate if a PPP reduces the caesarean rate. 300 low risk pregnant women were included; 100 in the PPP group and 200 in the control group. The PPP participants attended theory and practical sessions; they visited labor, delivery, recovery and hospitalization areas. Chi-square, Student's t test and odds ratio were applied. Pregnancy ended by caesarean section in 35/100 of PPP group and in 99/200 (49.5%) in control group (p < 0.02, OR = 1.8, IC = 1.1-2.9). Maternal complications occurred in 13/100 in the PPP group, and 42/200 (21%) in control group (p = 0.09, RM = 0.56). The newborn (NB) complications were observed in 9/100 in PPP and 46/200 (23%) in control group (p < 0.02, OR = 0.33). In the PPP group, 70% assisted to three or more sessions. Hospital stance in control group, accumulated 17 days more in mothers and 171 days more in NB than in the PPP group. In PPP group observed a caesarean rate reduction with fewer maternal and perinatal complications.

  11. Atlas of photoneutron cross sections obtained with monoenergetic photons

    International Nuclear Information System (INIS)

    Dietrich, S.S.; Berman, B.L.

    1988-01-01

    Photoneutron cross-section and integrated cross-section data obtained with monoenergetic photons are presented in a uniform format. All of the measured partial photoneutron cross sections, the total photoneutron cross section, and the photoneutron yield cross section are plotted as functions of the incident photon energy, as are the integrated photoneutron cross sections and their first and second moments. The values of the integrated cross sections and the moments of the integrated total cross section up to the highest photon energy for which they were measured are tabulated, as are the parameters of Lorentz curves fitted to the total photoneutron cross-section data for medium and heavy nuclei (A>50). This compilation is current as of June 1987. copyright 1988 Academic Press, Inc

  12. Influence of structural transformations on functional properties of Fe75Ni2Si8B13C2 amorphous alloy

    Czech Academy of Sciences Publication Activity Database

    Minić, Dušan M.; Blagojević, V.; Maričić, A.; Žák, Tomáš; Minić, Dragica M.

    2012-01-01

    Roč. 134, č. 1 (2012), s. 111-115 ISSN 0254-0584 R&D Projects: GA MŠk 1M0512 Institutional support: RVO:68081723 Keywords : Amorphous materials * Mössbauer spectroscopy * Electrical properties * Magnetic properties Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.072, year: 2012

  13. Hydraulic interaction of engineered and natural barriers. Task 8b-8d and 8f of SKB

    Energy Technology Data Exchange (ETDEWEB)

    Kroehn, Klaus-Peter

    2017-04-15

    The Task Force on Groundwater Flow and Transport of Solutes (TF GWFTS) and the Task Force on Engineered Barrier Systems (TF EBS) both established by the Svensk Kaernbraenslehantering AB (SKB) have defined the so-called Task 8 to investigate the hydraulic interaction of the granitic host rock at the Hard Rock Laboratory at Aespoeand the bentonite clay buffer in a deep geological repository. Task 8 a-d ran parallel to the related BRIE-project (Bentonite Rock Interaction Experiment) at the AespoeHard Rock Laboratory (HRL). The BRIE-project was concerned with an in-situ test where two boreholes were drilled from a tunnel floor and filled with compacted bentonite. Task 8 encompassed obviously characterizing the groundwater flow field as well as simulating bentonite re-saturation. Described here is an approach to solve the problem by decoupling both aspects. Groundwater flow was simplified to a steady-state single-phase flow model including discretely described large fractures. Modelling was performed with the code d{sup 3}f. Outflow data from the rock was then assigned to the inflow boundary of the alternative re-saturation model realized in the experimental code VIPER. With increasing knowledge about the site the upcoming data and the accompanying flow modelling indicated an inherent problem with predictions for the site and borehole characterization. Specific (deterministic) answers were sought from a flow domain that contains a relevant water-bearing fracture network which is only known in terms of geostatistics. While the overall flow regime could be represented in the final model the results were therefore not detailed below the scale of the boreholes. Early data from the flow model had indicated that water uptake of the bentonite at the bentonite-matrix contact would occur under restricted access to water. This had not been considered in laboratory tests up to then and also not in VIPER. A new appropriate boundary condition was developed and implemented. The time until full saturation in a horizontal disk was calculated for low inflow from the matrix and high inflow from a fracture. Also the sensitivity of the re-saturation model against uncertainties in the inflow data from a flow model was analyzed. In the framework of Task 8f the bentonite re-saturation model was finally checked against sensor data and the extensive post-test data of the BRIE. The water uptake at water bearing IV fractures which follows t he uptake under unrestricted access of bentonite to water could be reproduced satisfyingly in the model. However, no unambiguous interpretation of data concerning uptake from the matrix which was assumed to provide insight into uptake under a limited water supply from the rock was possible.

  14. B8B8 interaction in the SU6 quark model and its applications to few-body systems

    International Nuclear Information System (INIS)

    Fujiwara, Y.; Miyagawa, K.; Kohno, M.; Suzuki, Y.; Nakamoto, C.

    2004-01-01

    The recent QCD-inspired spin-flavor SU 6 quark model for the baryon-baryon interaction, proposed by the Kyoto-Niigata group, is a unified model for the complete baryon octet (B 8 =N, Λ, Σ and Ξ), which has achieved very accurate description of the NN and YN interactions. These quark-model interactions are now applied to realistic calculations of few-body systems in a new three-cluster Faddeev formalism which uses the 2-cluster resonating-group method kernel explicitly. We review the essential features of the most recent models, fss2 and FSS, and their predictions to few-body systems in confrontation with the available experimental data. As the few-body systems, we discuss the three-nucleon bound states, 2αΛ system for Λ 9 Be, and 2Λα system for ΛΛ 6 He. (author)

  15. Differences between LASL- and ANL-processed cross sections

    International Nuclear Information System (INIS)

    Kidman, R.B.; MacFarlane, R.E.; Becker, M.

    1978-03-01

    As part of the Los Alamos Scientific Laboratory (LASL) cross-section processing development, LASL cross sections and results from MINX/1DX system are compared to the Argonne National Laboratory cross sections and results from the ETOE-2/MC 2 -2 system for a simple reactor problem. Exact perturbation theory is used to establish the eigenvalue effect of every isotope group cross-section difference. Cross sections, cross-section differences, and their eigenvalue effects are clearly and conveniently displayed and compared on a group-by-group basis

  16. Cross section homogenization analysis for a simplified Candu reactor

    International Nuclear Information System (INIS)

    Pounders, Justin; Rahnema, Farzad; Mosher, Scott; Serghiuta, Dumitru; Turinsky, Paul; Sarsour, Hisham

    2008-01-01

    The effect of using zero current (infinite medium) boundary conditions to generate bundle homogenized cross sections for a stylized half-core Candu reactor problem is examined. Homogenized cross section from infinite medium lattice calculations are compared with cross sections homogenized using the exact flux from the reference core environment. The impact of these cross section differences is quantified by generating nodal diffusion theory solutions with both sets of cross sections. It is shown that the infinite medium spatial approximation is not negligible, and that ignoring the impact of the heterogeneous core environment on cross section homogenization leads to increased errors, particularly near control elements and the core periphery. (authors)

  17. Heavy-Section Steel Irradiation Program

    International Nuclear Information System (INIS)

    Anon.

    1991-01-01

    In FY1990 the Heavy-Section Steel Irradiation (HSSI) Program was arranged into 8 tasks: (1) program management, (2) K Ic curve shift in high-copper welds, (3) K Ia curve shift in high-copper welds, (4) irradiation effects on cladding, (5) K Ic and K Ia curve shifts in low upper-shelf (LUS) welds, (6) irradiation effects in a commercial LUS weld, (7) microstructural analysis of irradiation effects, and (8) in-service aged material evaluations. Of particular interest are the efforts in FY1990 concerning the shifts in fracture toughness and crack arrest toughness in high-copper welds, the unirradiated examination of a LUS weld from the Midland reactor, and the continued investigation into the causes of accelerated low-temperature embrittlement recently observed in RPV support steels. In the Fifth and Sixth Irradiation Series, designed to examine the shifts and possible changes in shape in the ASME K Ic and K Ia curves for two irradiated high-copper welds, it was seen that both the lower bound and mean fracture toughness shifts were greater than those of the associated Charpy-impact energies, whereas the shifts in crack arrest toughness were comparable. The irradiation-shifted fracture toughness data fell slightly below the appropriately indexed ASME K Ic curve even when it was shifted according to Revision 2 of Regulatory Guide 1.99 including its margins. The beltline weld, which was removed from the Midland reactor, fabricated by Babcock and Wilcox, Co. using Linde 80 flux, is being examined in the Tenth Irradiation Series to establish the effects of irradiation on a commercial LUS weld. A wide variation in the unirradiated fracture properties of the Midland weld were measured with values of RT NDT ranging from -22 to 54F through its thickness. In addition, a wide range of copper content from 0.21 to 0.45 wt % was found, compared to the 0.42 wt % previously reported

  18. Special section on biomimetics of movement.

    Science.gov (United States)

    Carpi, Federico; Erb, Rainer; Jeronimidis, George

    2011-12-01

    Movement in biology is an essential aspect of survival for many organisms, animals and plants. Implementing movement efficiently to meet specific needs is a key attribute of natural living systems, and can provide ideas for man-made developments. If we had to find a subtitle able to essentially convey the aim of this special section, it could read as follows: 'taking inspiration from nature for new materials, actuators, structures and controls for systems that move'. Our world is characterized by a huge variety of technical, engineering systems that move. They surround us in countless products that integrate actuators for different kinds of purposes. Basically, any kind of mechatronic system, such as those used for consumer products, machines, vehicles, industrial systems, robots, etc, is based on one or more devices that move, according to different implementations and motion ranges, often in response to external and internal stimuli. Despite this, technical solutions to develop systems that move do not evolve very quickly as they rely on traditional and well consolidated actuation technologies, which are implemented according to known architectures and with established materials. This fact limits our capability to overcome challenges related to the needs continuously raised by new fields of application, either at small or at large scales. Biomimetics-based approaches may provide innovative thinking and technologies in the field, taking inspiration from nature for smart and effective solutions. In an effort to disseminate current advances in this field, this special section collects some papers that cover different topics. A brief synopsis of the content of each contribution is presented below. The first paper, by Lienhard et al [1], deals with bioinspiration for the realization of structural parts in systems that passively move. It presents a bioinspired hingeless flapping mechanism, considered as a solution to the kinematics of deployable systems for

  19. Constraint effects in heavy-section steels

    International Nuclear Information System (INIS)

    Bass, B.R.; Shum, D.K.M.; Keeney-Walker, J.; Theiss, T.J.

    1993-01-01

    A focal point of the Nuclear Regulatory Commission-funded Heavy-Section Steel Technology (HSST) Program is the development of technology required for accurate assessment of fracture-prevention margins in commercial nuclear reactor pressure vessels (RPVs). In a series of investigations, the HSST Program is seeking to obtain an improved understanding of the relationships governing transfer of fracture toughness data from small-scale specimens to large-scale structures. This paper describes two analytical approaches to the transferability issues that are being evaluated in the HSST Program. One is a continuum correlative methodology based on two-parameter descriptions (K-T or J-Q) of the near crack-tip fields that incorporate effects of the higher-order T-stress for linear-elastic fracture mechanics conditions or the Q-stress for more general elastic-plastic fracture mechanics conditions. The second approach utilizes a micromechanical predictive methodology that relates cleavage crack initiation to the attainment of a critical volume enclosed within a selected maximum principal stress contour surrounding the crack tip. In preliminary evaluations, these methodologies were applied to experimental data taken from several intermediate- and large-scale testing programs. Results and conclusions from these applications are discussed in the paper. Applications of the methodologies to analytical studies concerning biaxial stress effects on fracture toughness and safety margin assessments of an RPV subjected to pressurized-thermal-shock transient loadings are also presented. While these fracture methodologies appear to show promise in being able to differentiate among crack-tip constraint levels, numerous issues were identified in the HSST studies that require further investigation. Recommendations are given concerning future work intended to resolve several of these issues. 42 refs., 26 figs., 1 tab

  20. Relating DSM-5 section III personality traits to section II personality disorder diagnoses.

    Science.gov (United States)

    Morey, L C; Benson, K T; Skodol, A E

    2016-02-01

    The DSM-5 Personality and Personality Disorders Work Group formulated a hybrid dimensional/categorical model that represented personality disorders as combinations of core impairments in personality functioning with specific configurations of problematic personality traits. Specific clusters of traits were selected to serve as indicators for six DSM categorical diagnoses to be retained in this system - antisocial, avoidant, borderline, narcissistic, obsessive-compulsive and schizotypal personality disorders. The goal of the current study was to describe the empirical relationships between the DSM-5 section III pathological traits and DSM-IV/DSM-5 section II personality disorder diagnoses. Data were obtained from a sample of 337 clinicians, each of whom rated one of his or her patients on all aspects of the DSM-IV and DSM-5 proposed alternative model. Regression models were constructed to examine trait-disorder relationships, and the incremental validity of core personality dysfunctions (i.e. criterion A features for each disorder) was examined in combination with the specified trait clusters. Findings suggested that the trait assignments specified by the Work Group tended to be substantially associated with corresponding DSM-IV concepts, and the criterion A features provided additional diagnostic information in all but one instance. Although the DSM-5 section III alternative model provided a substantially different taxonomic structure for personality disorders, the associations between this new approach and the traditional personality disorder concepts in DSM-5 section II make it possible to render traditional personality disorder concepts using alternative model traits in combination with core impairments in personality functioning.