Aerobic biodegradation potential of endocrine-disrupting chemicals in surface-water sediment at Rocky Mountain National Park, USA.

Science.gov (United States)

Bradley, Paul M; Battaglin, William A; Iwanowicz, Luke R; Clark, Jimmy M; Journey, Celeste A

2016-05-01

Endocrine-disrupting chemicals (EDCs) in surface water and bed sediment threaten the structure and function of aquatic ecosystems. In natural, remote, and protected surface-water environments where contaminant releases are sporadic, contaminant biodegradation is a fundamental driver of exposure concentration, timing, duration, and, thus, EDC ecological risk. Anthropogenic contaminants, including known and suspected EDCs, were detected in surface water and sediment collected from 2 streams and 2 lakes in Rocky Mountain National Park (Colorado, USA). The potential for aerobic EDC biodegradation was assessed in collected sediments using 6 (14) C-radiolabeled model compounds. Aerobic microbial mineralization of natural (estrone and 17β-estradiol) and synthetic (17α-ethinylestradiol) estrogen was significant at all sites. Bed sediment microbial communities in Rocky Mountain National Park also effectively degraded the xenoestrogens bisphenol-A and 4-nonylphenol. The same sediment samples exhibited little potential for aerobic biodegradation of triclocarban, however, illustrating the need to assess a wider range of contaminant compounds. The present study's results support recent concerns over the widespread environmental occurrence of carbanalide antibacterials, like triclocarban and triclosan, and suggest that backcountry use of products containing these compounds should be discouraged. Published 2015 Wiley Periodicals Inc. on behalf of SETAC. This article is a US Government work and, as such, is in the public domain in the United States of America.

Ultrafine Particle Metrics and Research Considerations: Review of the 2015 UFP Workshop

Directory of Open Access Journals (Sweden)

Richard W. Baldauf

2016-10-01

Full Text Available In February 2015, the United States Environmental Protection Agency (EPA sponsored a workshop in Research Triangle Park, NC, USA to review the current state of the science one missions, air quality impacts, and health effects associated with exposures to ultrafine particles[1].[...

Snowmelt timing, phenology, and growing season length in conifer forests of Crater Lake National Park, USA

Science.gov (United States)

O'Leary, Donal S.; Kellermann, Jherime L.; Wayne, Chris

2018-02-01

Anthropogenic climate change is having significant impacts on montane and high-elevation areas globally. Warmer winter temperatures are driving reduced snowpack in the western USA with broad potential impacts on ecosystem dynamics of particular concern for protected areas. Vegetation phenology is a sensitive indicator of ecological response to climate change and is associated with snowmelt timing. Human monitoring of climate impacts can be resource prohibitive for land management agencies, whereas remotely sensed phenology observations are freely available at a range of spatiotemporal scales. Little work has been done in regions dominated by evergreen conifer cover, which represents many mountain regions at temperate latitudes. We used moderate resolution imaging spectroradiometer (MODIS) data to assess the influence of snowmelt timing and elevation on five phenology metrics (green up, maximum greenness, senescence, dormancy, and growing season length) within Crater Lake National Park, Oregon, USA from 2001 to 2012. Earlier annual mean snowmelt timing was significantly correlated with earlier onset of green up at the landscape scale. Snowmelt timing and elevation have significant explanatory power for phenology, though with high variability. Elevation has a moderate control on early season indicators such as snowmelt timing and green up and less on late-season variables such as senescence and growing season length. PCA results show that early season indicators and late season indicators vary independently. These results have important implications for ecosystem dynamics, management, and conservation, particularly of species such as whitebark pine ( Pinus albicaulis) in alpine and subalpine areas.

DETECTION OF WHOLE BODY OXIDATIVE STRESS IN URINE USING OXYGEN-18 LABELING

Science.gov (United States)

DETECTION OF WHOLE BODY OXIDATIVE STRESS IN URINE USING OXYGEN-18 LABELING. R Slade, J L McKee and G E Hatch. PTB, ETD, NHEERL, ORD, USEPA, Research Triangle Park, NC, USA.Reliable non-invasive markers for detecting oxidative stress in vivo are currently not available. We pr...

Complete Genome Sequence of Paenibacillus strain Y4.12MC10, a Novel Paenibacillus lautus strain Isolated from Obsidian Hot Spring in Yellowstone National Park.

Science.gov (United States)

Mead, David A; Lucas, Susan; Copeland, Alex; Lapidus, Alla; Cheng, Jan-Feng; Bruce, David C; Goodwin, Lynne A; Pitluck, Sam; Chertkov, Olga; Zhang, Xiaojing; Detter, John C; Han, Cliff S; Tapia, Roxanne; Land, Miriam; Hauser, Loren J; Chang, Yun-Juan; Kyrpides, Nikos C; Ivanova, Natalia N; Ovchinnikova, Galina; Woyke, Tanja; Brumm, Catherine; Hochstein, Rebecca; Schoenfeld, Thomas; Brumm, Phillip

2012-07-30

Paenibacillus sp.Y412MC10 was one of a number of organisms isolated from Obsidian Hot Spring, Yellowstone National Park, Montana, USA under permit from the National Park Service. The isolate was initially classified as a Geobacillus sp. Y412MC10 based on its isolation conditions and similarity to other organisms isolated from hot springs at Yellowstone National Park. Comparison of 16 S rRNA sequences within the Bacillales indicated that Geobacillus sp.Y412MC10 clustered with Paenibacillus species, and the organism was most closely related to Paenibacillus lautus. Lucigen Corp. prepared genomic DNA and the genome was sequenced, assembled, and annotated by the DOE Joint Genome Institute. The genome sequence was deposited at the NCBI in October 2009 (NC_013406). The genome of Paenibacillus sp. Y412MC10 consists of one circular chromosome of 7,121,665 bp with an average G+C content of 51.2%. Comparison to other Paenibacillus species shows the organism lacks nitrogen fixation, antibiotic production and social interaction genes reported in other paenibacilli. The Y412MC10 genome shows a high level of synteny and homology to the draft sequence of Paenibacillus sp. HGF5, an organism from the Human Microbiome Project (HMP) Reference Genomes. This, combined with genomic CAZyme analysis, suggests an intestinal, rather than environmental origin for Y412MC10.

77 FR 30027 - Manufacturer of Controlled Substances; Notice of Registration; Siegfried (USA)

Science.gov (United States)

2012-05-21

...; Notice of Registration; Siegfried (USA) By Notice dated January 6, 2012, and published in the Federal Register on January 17, 2012, 77 FR 2323, Siegfried (USA), 33 Industrial Park Road, Pennsville, New Jersey... U.S.C. 823(a) and determined that the registration of Siegfried (USA), to manufacture the listed...

Quantifying the fire regime distributions for severity in Yosemite National Park, California, USA

Science.gov (United States)

Thode, Andrea E.; van Wagtendonk, Jan W.; Miller, Jay D.; Quinn, James F.

2011-01-01

This paper quantifies current fire severity distributions for 19 different fire-regime types in Yosemite National Park, California, USA. Landsat Thematic Mapper remote sensing data are used to map burn severity for 99 fires (cumulatively over 97 000 ha) that burned in Yosemite over a 20-year period. These maps are used to quantify the frequency distributions of fire severity by fire-regime type. A classification is created for the resultant distributions and they are discussed within the context of four vegetation zones: the foothill shrub and woodland zone; the lower montane forest zone; the upper montane forest zone and the subalpine forest zone. The severity distributions can form a building block from which to discuss current fire regimes across the Sierra Nevada in California. This work establishes a framework for comparing the effects of current fires on our landscapes with our notions of how fires historically burned, and how current fire severity distributions differ from our desired future conditions. As this process is refined, a new set of information will be available to researchers and land managers to help understand how fire regimes have changed from the past and how we might attempt to manage them in the future.

78 FR 64020 - Manufacturer of Controlled Substances, Notice of Registration, Siegfried USA, LLC

Science.gov (United States)

2013-10-25

..., Notice of Registration, Siegfried USA, LLC The Notice dated July 23, 2013, and published in the Federal Register on August 1, 2013, 78 FR 46613, page 18338, Siegfried (USA), LLC., 33 Industrial Park Road...), and Poppy Straw Concentrate (9670). On August 6, 2013, Siegfried (USA), LLC., subsequently withdrew...

A new species of in the Rhyacophila vagrita group (Trichoptera: Rhyacophilidae) from Olympic National Park, Washington, USA.

Science.gov (United States)

Lee, Jonathan J; Giersch, J. Joseph

2014-01-01

Rhyacophila vagrita Milne, 1936 was described from specimens collected in British Columbia and Alberta, Canada. Ross (1950), while examining R. vagrita paratypes from Alberta, discovered four males that did not fi t the R. vagrita description. These he described and named R. milnei Ross, 1950. Ross (1956) established the R. vagrita group for R. vagrita and R. milnei based primarily on the synapomorphies of the “curious dorsal projections of both ninth and tenth tergites”, a very small simple aedeagus, and “a curious development of the apical band and anal sclerite”. Schmid (1970) indicated that males of the vagrita group have genitalia that are among the most unique in all of the species of Rhyacophila. While collecting in Olympic National Park, Washington, USA, we discovered an undescribed Rhyacophila species, most similar to R. milnei, with structures as remarkable as those described for R. vagrita and R. milnei

78 FR 30333 - Manufacturer of Controlled Substances; Notice of Registration; Siegfried (Usa), Llc.

Science.gov (United States)

2013-05-22

...; Notice of Registration; Siegfried (Usa), Llc. By Notice dated November 19, 2012, and published in the Federal Register on November 27, 2012, 77 FR 70825, Siegfried (USA), LLC., 33 Industrial Park Road... 21 U.S.C. 823(a) and determined that the registration of Siegfried (USA), LLC., to manufacture the...

78 FR 64020 - Manufacturer of Controlled Substances; Notice of Registration; Siegfried USA, LLC

Science.gov (United States)

2013-10-25

...; Notice of Registration; Siegfried USA, LLC By Notice dated May 22, 2013, and published in the Federal Register on May 30, 2013, 78 FR 32458, Siegfried USA, LLC., 33 Industrial Park Road, Pennsville, New Jersey... determined that the registration of Siegfried USA, LLC., to manufacture the listed basic class of controlled...

Two New Species of Bibloplectus Reitter (Coleoptera: Staphylinidae: Pselaphinae) from the Orlando Park Collection, Field Museum of Natural History.

Science.gov (United States)

Owens, Brittany E; Carlton, Christopher E

2018-04-10

Two new species of Bibloplectus Reitter, 1881 are described from the Orlando Park Collection of Pselaphinae at the FMNH (Field Museum of Natural History, Chicago, IL, USA): Bibloplectus silvestris Owens and Carlton, new species (type locality, Urbana, IL, USA) and Bibloplectus wingi Owens and Carlton, new species (type locality, Shades State Park, IN, USA). Types of these new species were part of a series of specimens bearing unpublished Park manuscript names in both the pinned and slide collection at the FMNH. They bring the total number of species in the genus in eastern North America to twenty-three. Resolving these manuscript names adds to previous efforts to uncover elements of the hidden diversity of North American Bibloplectus from museum collections (Owens and Carlton 2016, Owens and Carlton 2017) and highlights the importance of close examination of the Orlando Park pselaphine collection as a valuable historic and taxonomic resource.

78 FR 5500 - Manufacturer of Controlled Substances, Notice of Application; Siegfried (USA)

Science.gov (United States)

2013-01-25

... DEPARTMENT OF JUSTICE Drug Enforcement Administration Manufacturer of Controlled Substances, Notice of Application; Siegfried (USA) Pursuant to Sec. 1301.33(a), Title 21 of the Code of Federal Regulations (CFR), this is notice that on June 19, 2012, Siegfried (USA), 33 Industrial Park Road, Pennsville...

Inhibition of Caused by Bacteria Isolated from the Skin of Boreal Toads, , from Grand Teton National Park, Wyoming, USA

Directory of Open Access Journals (Sweden)

Shawna T. Park

2014-01-01

Full Text Available The chytrid fungus Batrachochytrium dendrobatidis is a significant cause of the worldwide decline in amphibian populations; however, various amphibian species are capable of coexisting with B. dendrobatidis. Among them are boreal toads ( Anaxyrus ( Bufo boreas boreas located in Grand Teton National Park (GTNP in Wyoming, USA. The purpose of this study was to identify cultivable bacterial isolates from the skin microbiota of boreal toads from GTNP and determine if they were capable of inhibiting B. dendrobatidis in vitro, and therefore might be a factor in the toad's coexistence with this pathogen. Isolates from 6 of 21 genera tested were found to inhibit the growth of B. dendrobatidis. These bacteria represent diverse lineages such as the Gammaproteobacteria, the Betaproteobacteria, and the Bacteroidetes/Chlorobium groups. We propose that these bacteria compete via microbial antagonism with B. dendrobatidis.

Le Corbusier 24NC Un fragmento habitado de la Ville Radieuse = Le Corbusier 24NC An inhabited fragment of the Ville Radieuse

Directory of Open Access Journals (Sweden)

José Ramón Alonso Pereira

2014-11-01

the word used to define the ideal city: a modern urbs imagined within a large park. This paper tries to analyse this maison radieuse: the place and the space where Le Corbusier lived in and his ways of living in along the time, from 1934 to his death in 1965. To study the double aspect of habitat and living. To analyse the place and the space where Le Corbusier lived, at his projects and his metaphors: the maison radieuse, the urbs in ortu, the crystal house, the labour archipielago, with its different islands of paints and books, of papers and memories...  Because 24NC suppose the transit from project to life: from planning Ville Radieuse, to living in.

78 FR 49546 - Importer of Controlled Substances; Notice of Application; Siegfried USA, LLC

Science.gov (United States)

2013-08-14

... DEPARTMENT OF JUSTICE Drug Enforcement Administration Importer of Controlled Substances; Notice of Application; Siegfried USA, LLC This is notice that on June 10, 2013, Siegfried USA, LLC., 33 Industrial Park Road, Pennsville, New Jersey 08070, made application by letter to the Drug Enforcement Administration...

Biscayne National Park study on reef fish community changes over time

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Reef fish assemblage structure was assessed in 20062007 (recent period) in Biscayne National Park, Florida, USA , and compared with data collected from 1977 to 1981...

33 CFR 80.525 - Cape Lookout, NC to Cape Fear, NC.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Lookout, NC to Cape Fear, NC... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Fifth District § 80.525 Cape Lookout, NC to Cape Fear... southeast side of the Inlet. (g) Except as provided elsewhere in this section from Cape Lookout to Cape Fear...

78 FR 46613 - Manufacturer of Controlled Substances; Notice of Application; Siegfried (USA), LLC

Science.gov (United States)

2013-08-01

... DEPARTMENT OF JUSTICE Drug Enforcement Administration Manufacturer of Controlled Substances; Notice of Application; Siegfried (USA), LLC Pursuant to Sec. 1301.33(a), Title 21 of the Code of Federal Regulations (CFR), this is notice that on June 10, 2013, Siegfried (USA), LLC., 33 Industrial Park Road...

77 FR 70825 - Manufacturer of Controlled Substances; Notice of Application; Siegfried (USA), LLC

Science.gov (United States)

2012-11-27

... DEPARTMENT OF JUSTICE Drug Enforcement Administration Manufacturer of Controlled Substances; Notice of Application; Siegfried (USA), LLC Pursuant to Sec. 1301.33(a), Title 21 of the Code of Federal Regulations (CFR), this is notice that on November 5, 2012, Siegfried (USA) LLC, 33 Industrial Park Road...

78 FR 32458 - Manufacturer of Controlled Substances; Notice of Application; Siegfried USA, LLC

Science.gov (United States)

2013-05-30

... DEPARTMENT OF JUSTICE Drug Enforcement Administration Manufacturer of Controlled Substances; Notice of Application; Siegfried USA, LLC Pursuant to Sec. 1301.33(a), Title 21 of the Code of Federal Regulations (CFR), this is notice that on April 18, 2013, Siegfried USA, LLC., 33 Industrial Park Road...

Channel-planform evolution in four rivers of Olympic National Park, Washington, U.S.A.: The roles of physical drivers and trophic cascades

Science.gov (United States)

East, Amy E.; Jenkins, Kurt J.; Happe, Patricia J.; Bountry, Jennifer A.; Beechie, Timothy J.; Mastin, Mark C.; Sankey, Joel B.; Randle, Timothy J.

2017-01-01

Identifying the relative contributions of physical and ecological processes to channel evolution remains a substantial challenge in fluvial geomorphology. We use a 74-year aerial photographic record of the Hoh, Queets, Quinault, and Elwha Rivers, Olympic National Park, Washington, U.S.A., to investigate whether physical or trophic-cascade-driven ecological factors—excessive elk impacts after wolves were extirpated a century ago—are the dominant controls on channel planform of these gravel-bed rivers. We find that channel width and braiding show strong relationships with recent flood history. All four rivers have widened significantly in recent decades, consistent with increased flood activity since the 1970s. Channel planform also reflects sediment-supply changes, evident from landslide response on the Elwha River. We surmise that the Hoh River, which shows a multi-decadal trend toward greater braiding, is adjusting to increased sediment supply associated with rapid glacial retreat. In this sediment-routing system with high connectivity, such climate-driven signals appear to propagate downstream without being buffered substantially by sediment storage. Legacy effects of anthropogenic modification likely also affect the Quinault River planform. We infer no correspondence between channel geomorphic evolution and elk abundance, suggesting that trophic-cascade effects in this setting are subsidiary to physical controls on channel morphology. Our findings differ from previous interpretations of Olympic National Park fluvial dynamics and contrast with the classic example of Yellowstone National Park, where legacy effects of elk overuse are apparent in channel morphology; we attribute these differences to hydrologic regime and large-wood availability.

The ALARA project of the EDF nuclear park exploitation

International Nuclear Information System (INIS)

Potoczek, J.

1998-01-01

To bring the exploitation of the nuclear park of EDF at the level of the best exploiters in the world in matter of collective and individual dosimetry, the ALARA principle coordinates numerous actions: to associate the temporary societies, to define common language, methods and tools for the whole park to organize a level effect in this area, to optimize the maintenance that is expansive in radiation doses, to make the different levels of management responsible on dosimetric stakes, to reduce the singular sources of exposure, to assure the organisation and exploitation of the experience back in this field and adapt consequently the system of information. The results are cheerful and the objectives for 2000 are: less than 1.2 h.Sv by year and by reactor, no intervener whom annual radiation dose is upper than 20 mSv (out of exceptional case). (N.C.)

Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD

Science.gov (United States)

Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui

2017-11-01

TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.

Are bison exotic in the Wrangell-St. Elias National Park and Preserve?

Science.gov (United States)

Peek, James M.; Miquelle, Dale G.; Wright, R. Gerald

1987-03-01

The effect of past distributions of animal populations now extinct in an area from unknown causes is considered relative to their status as exotic or native in national parks. The example is the bison (Bison bison) on the Copper and Chitina river drainages in Alaska in the USA which was introduced prior to establishment of Wrangell-St. Elias National Park and Preserve. The fossil record suggests that bison were present as recently as 500 years ago in Alaska. The policy of the US National Park Service to maintain natural ecosystems and restrict or eliminate exotic species raises the issue of whether this species should be treated as exotic or native.

Evaluation of Radon Pollution in Underground Parking Lots by Discomfort Index

Directory of Open Access Journals (Sweden)

AH Bu-Olayan

2016-06-01

Full Text Available Introduction Recent studies of public underground parking lots showed the influence of radon concentration and the probable discomfort caused by parking cars. Materials and Methods Radon concentration was measured in semi-closed public parking lots in the six governorates of Kuwait, using Durridge RAD7radon detector (USA. Results The peak radon concentration in the parking lots of Kuwait governorates was relatively higher during winter (63.15Bq/m3 compared to summer (41.73 Bq/m3. Radon in the evaluated parking lots revealed a mean annual absorbed dose (DRn: 0.02mSv/y and annual effective dose (HE: 0.06mSv/y.  Conclusion This study validated the influence of relative humidity and temperature as the major components of discomfort index (DI. The mean annual absorbed and effective dose  of radon in the evaluated parking lots were found below the permissible limits. However, high radon DRn and HE were reported when the assessment included the parking lots, the surrounding residential apartments, and office premises. Furthermore, the time-series analysis indicated significant variations of the seasonal and site-wise distribution of radon concentrations in the indoor evaluated parking lots of the six Kuwait governorates

Access to parks and physical activity: an eight country comparison

DEFF Research Database (Denmark)

Schipperijn, Jasper; Cerin, Ester; Adams, Marc A

2017-01-01

Abstract Several systematic reviews have reported mixed associations between access to parks and physical activity, and suggest that this is due to inconsistencies in the study methods or differences across countries. An international study using consistent methods is needed to investigate...... the association between access to parks and physical activity. The International Physical Activity and Environment Network (IPEN) Adult Study is a multi-country cross-sectional study using a common design and consistent methods Accelerometer, survey and Geographic Information Systems (GIS) data for 6......,181 participants from 12 cities in 8 countries (Belgium, Brazil, Czech Republic, Denmark, Mexico, New Zealand, UK, USA) were used to estimate the strength and shape of associations of 11 measures of park access (1 perceived and 10 GIS-based measures) with accelerometer-based moderate-to-vigorous physical activity...

Plant dieback under exceptional drought driven by elevation, not by plant traits, in Big Bend National Park, Texas, USA

Directory of Open Access Journals (Sweden)

Elizabeth F. Waring

2014-07-01

Full Text Available In 2011, Big Bend National Park, Texas, USA, experienced the most severe single year drought in its recorded history, resulting in significant plant mortality. We used this event to test how perennial plant response to drought varied across elevation, plant growth form and leaf traits. In October 2010 and October 2011, we measured plant cover by species at six evenly-spaced elevations ranging from Chihuahuan desert (666 m to oak forest in the Chisos mountains (1,920 m. We asked the following questions: what was the relationship between elevation and stem dieback and did susceptibility to drought differ among functional groups or by leaf traits? In 2010, pre-drought, we measured leaf mass per area (LMA on each species. In 2011, the percent of canopy dieback for each individual was visually estimated. Living canopy cover decreased significantly after the drought of 2011 and dieback decreased with elevation. There was no relationship between LMA and dieback within elevations. The negative relationship between proportional dieback and elevation was consistent in shrub and succulent species, which were the most common growth forms across elevations, indicating that dieback was largely driven by elevation and not by species traits. Growth form turnover did not influence canopy dieback; differences in canopy cover and proportional dieback among elevations were driven primarily by differences in drought severity. These results indicate that the 2011 drought in Big Bend National Park had a large effect on communities at all elevations with average dieback for all woody plants ranging from 8% dieback at the highest elevation to 83% dieback at lowest elevations.

Translating science into policy: Using ecosystem thresholds to protect resources in Rocky Mountain National Park

International Nuclear Information System (INIS)

Porter, Ellen; Johnson, Susan

2007-01-01

Concern over impacts of atmospheric nitrogen deposition to ecosystems in Rocky Mountain National Park, Colorado, has prompted the National Park Service, the State of Colorado Department of Public Health and Environment, the Environmental Protection Agency, and interested stakeholders to collaborate in the Rocky Mountain National Park Initiative, a process to address these impacts. The development of a nitrogen critical load for park aquatic resources has provided the basis for a deposition goal to achieve resource protection, and parties to the Initiative are now discussing strategies to meet that goal by reducing air pollutant emissions that contribute to nitrogen deposition in the Park. Issues being considered include the types and locations of emissions to be reduced, the timeline for emission reductions, and the impact of emission reductions from programs already in place. These strategies may serve as templates for addressing ecosystem impacts from deposition in other national parks. - A collaborative approach between scientists and policymakers is described for addressing nitrogen deposition effects to Rocky Mountain National Park, USA

Heterogeneous Parking Market Subject to Parking Rationing

Directory of Open Access Journals (Sweden)

Saeed Asadi Bagloee

2015-01-01

Full Text Available Different types of drivers and parking spaces delineate a heterogeneous parking market for which the literature has yet to provide a model applicable to the real world. The main obstacle is computational complexities of considering various parking restrictions along with traffic congestion on the road network. In this study, the heterogeneity aspects are considered within a Logit parking choice model. A mathematical programming problem was introduced to explicitly consider parking capacities and parking rationing constraints. The parking rationing is defined as any arrangement to reserve parking space for some specific demand such as parking permit, private parking, VIP parking, and different parking durations. Introduction of parking rationing in the presence of other constraints is a unique factor in this study which makes the model more realistic. The algorithm was tested on a central business district case study. The results prove that the algorithm is able to converge rapidly. Among the algorithm’s output are shadow prices of the parking capacity and parking rationing constraints. The shadow prices contain important information which is key to addressing a variety of parking issues, such as the location of parking shortages, identification of fair parking charges, viability of parking permits, and the size of reserved parking.

ECO-INDUSTRIAL PARK - A TOOL FOR SUSTAINABLE DEVELOPMENT

Directory of Open Access Journals (Sweden)

BUGNAR NICOLETA GEORGETA

2013-07-01

relations between the firms are success factors within Eco-industrial networks. The successful cases – especially those in the USA or the Northern countries – have proved that Eco parks engage a multitude of entities, from regional/local authorities to non-governmental organizations; in these entities’ action the objectives and actions of the firms; management overlap with those of the community management

Dose in a recreational water park with thermal water

International Nuclear Information System (INIS)

Thomassin, A.

2006-01-01

This paper assesses the annual effective dose received by the public due to baths in thermal water of a recreational water park in Royat (France) with significant levels of natural radionuclides. After the context be specified and the measurements of radioactivity presented, an assessment of radiological consequences is performed, based on an hypothetical scenario for persons of the public. Context The french commune of Royat in the Massif Central (centre of France) intends to build a recreational water park, using thermal water from a local source, out of the public water supply network. With this aim in view, the operator builds up a technical file to get a prefectorial authorization. Considering that many waters and thermal waters in this area have significant levels of natural radionuclides (granitic subsoil) on the one hand, and that the operator of establishments receiving public is requested by L 1333-10 article of the Public Health Code to supervise the exposure if an impact on health is possible on the other hand, the operator asked I.R.S.N. to measure the level of radioactivity in the water. Considering the level of radioactivity measured, the competent authority then asks I.R.S.N. if this level is compatible with its use in a recreational water park. After calculations it appears that in the particular case of the commune of Royat, the level of activity of natural radionuclides of the thermal water (22 Bq.L -1 for 222 Rn) is compatible with its use in a recreational water park, the annual effective dose being about 40 μSv with a conservative approach. For other thermal waters in France winch could have much higher levels of natural radioactivity, it is recommended to pay attention to their use in recreational water park. (N.C.)

Serological survey for diseases in free-ranging coyotes (Canis latrans) in Yellowstone National Park, Wyoming.

Science.gov (United States)

Gese, E M; Schultz, R D; Johnson, M R; Williams, E S; Crabtree, R L; Ruff, R L

1997-01-01

From October 1989 to June 1993, we captured and sampled 110 coyotes (Canis latrans) for various diseases in Yellowstone National Park, Wyoming (USA). Prevalence of antibodies against canine parvovirus (CPV) was 100% for adults (> 24 months old), 100% for yearlings (12 to 24 months old), and 100% for old pups (4 to 12 months old); 0% of the young pups (Yellowstone National Park, with CPV influencing coyote pup survival during the first 3 months of life; eight of 21 transmitted pups died of CPV infection in 1992. The potential impact of these canine pathogens on wolves (C. lupus) reintroduced to Yellowstone National Park remains to be documented.

Engage the Public in Phenology Monitoring: Lessons Learned from the USA National Phenology Network

Science.gov (United States)

Crimmins, T. M.; Lebuhn, G.; Miller-Rushing, A. J.

2009-12-01

The USA National Phenology Network (USA-NPN) is a recently established network that brings together citizen scientists, government agencies, non-profit groups, educators and students of all ages to monitor the impacts of climate change on plants and animals in the United States. Though a handful of observers participated in the USA-NPN monitoring program in 2008, 2009 was the first truly operational year for the program. With a goal of 100,000 observers for this nationwide effort, we are working to engage participants both directly and through established organizations and agencies. The first year of operational monitoring and program advertisement has yielded many insights that are shaping how we move forward. In this presentation, we will highlight some of our most prominent “lessons learned” from our experience engaging participants, mainly through partnerships with organizations and agencies. One successful partnership that the USA-NPN established in 2009 was with the Great Sunflower Project, a citizen science effort focused on tracking bee activity. By piggy-backing on this established program, we were able to invite tens of thousands of self-selected individuals to learn about plant phenology and to contribute to the program. A benefit to the Great Sunflower Project was that monitoring phenology of their sunflowers gave observers something to do while waiting for the plant to attract bees. Observers’ experiences, data, and comments from the 2009 season are yielding insights into how this partnership can be strengthened and USA-NPN and GSP goals can more effectively be met. A second partnership initiated in 2009 was with the US National Park Service (NPS). Partnering with federal and state agencies offers great opportunities for data collection and education. In return, agencies stand to gain information that can directly influence management decisions. However, such efforts necessitate careful planning and execution. Together the USA-NPN and NPS drafted

ParkIndex

DEFF Research Database (Denmark)

Kaczynski, Andrew T; Schipperijn, Jasper; Hipp, J Aaron

2016-01-01

using ArcGIS 9.3 and the Community Park Audit Tool. Four park summary variables - distance to nearest park, and the number of parks, amount of park space, and average park quality index within 1 mile were analyzed in relation to park use using logistic regression. Coefficients for significant park......, planners, and citizens to evaluate the potential for park use for a given area. Data used for developing ParkIndex were collected in 2010 in Kansas City, Missouri (KCMO). Adult study participants (n=891) reported whether they used a park within the past month, and all parks in KCMO were mapped and audited...

Structural studies of n-type nc-Si-QD thin films for nc-Si solar cells

Science.gov (United States)

Das, Debajyoti; Kar, Debjit

2017-12-01

A wide optical gap nanocrystalline silicon (nc-Si) dielectric material is a basic requirement at the n-type window layer of nc-Si solar cells in thin film n-i-p structure on glass substrates. Taking advantage of the high atomic-H density inherent to the planar inductively coupled low-pressure (SiH4 + CH4)-plasma, development of an analogous material in P-doped nc-Si-QD/a-SiC:H network has been tried. Incorporation of C in the Si-network extracted from the CH4 widens the optical band gap; however, at enhanced PH3-dilution of the plasma spontaneous miniaturization of the nc-Si-QDs below the dimension of Bohr radius (∼4.5 nm) further enhances the band gap by virtue of the quantum size effect. At increased flow rate of PH3, dopant induced continuous amorphization of the intrinsic crystalline network is counterbalanced by the further crystallization promoted by the supplementary atomic-H extracted from PH3 (1% in H2) in the plasma, eventually holding a moderately high degree of crystallinity. The n-type wide band gap (∼1.93 eV) window layer with nc-Si-QDs in adequate volume fraction (∼52%) could furthermore be instrumental as an effective seed layer for advancing sequential crystallization in the i-layer of nc-Si solar cells with n-i-p structure in superstrate configuration.

Echinococcus granulosus in gray wolves and ungulates in Idaho and Montana, USA.

Science.gov (United States)

Foreyt, William J; Drew, Mark L; Atkinson, Mark; McCauley, Deborah

2009-10-01

We evaluated the small intestines of 123 gray wolves (Canis lupus) that were collected from Idaho, USA (n=63), and Montana, USA (n=60), between 2006 and 2008 for the tapeworm Echinococcus granulosus. The tapeworm was detected in 39 of 63 wolves (62%) in Idaho, USA, and 38 of 60 wolves (63%) in Montana, USA. The detection of thousands of tapeworms per wolf was a common finding. In Idaho, USA, hydatid cysts, the intermediate form of E. granulosus, were detected in elk (Cervus elaphus), mule deer (Odocoileus hemionus), and a mountain goat (Oreamnos americanus). In Montana, USA, hydatid cysts were detected in elk. To our knowledge, this is the first report of adult E. granulosus in Idaho, USA, or Montana, USA. It is unknown whether the parasite was introduced into Idaho, USA, and southwestern Montana, USA, with the importation of wolves from Alberta, Canada, or British Columbia, Canada, into Yellowstone National Park, Wyoming, USA, and central Idaho, USA, in 1995 and 1996, or whether the parasite has always been present in other carnivore hosts, and wolves became a new definitive host. Based on our results, the parasite is now well established in wolves in these states and is documented in elk, mule deer, and a mountain goat as intermediate hosts.

Non-leptonic kaon decays at large Nc

Science.gov (United States)

Donini, Andrea; Hernández, Pilar; Pena, Carlos; Romero-López, Fernando

2018-03-01

We study the scaling with the number of colors Nc of the weak amplitudes mediating kaon mixing and decay, in the limit of light charm masses (mu = md = ms = mc). The amplitudes are extracted directly on the lattice for Nc = 3 - 7 (with preliminar results for Nc = 8 and 17) using twisted mass QCD. It is shown that the (sub-leading) 1 /Nc corrections to B\\hatk are small and that the naive Nc → ∞ limit, B\\hatk = 3/4, seems to be recovered. On the other hand, the O (1/Nc) corrections in K → ππ amplitudes (derived from K → π matrix elements) are large and fully anti-correlated in the I = 0 and I = 2 channels. This may have some implications for the understanding of the ΔI = 1/2 rule.

A vaccine formulation combining rhoptry proteins NcROP40 and NcROP2 improves pup survival in a pregnant mouse model of neosporosis.

Science.gov (United States)

Pastor-Fernández, Iván; Arranz-Solís, David; Regidor-Cerrillo, Javier; Álvarez-García, Gema; Hemphill, Andrew; García-Culebras, Alicia; Cuevas-Martín, Carmen; Ortega-Mora, Luis M

2015-01-30

Currently there are no effective vaccines for the control of bovine neosporosis. During the last years several subunit vaccines based on immunodominant antigens and other proteins involved in adhesion, invasion and intracellular proliferation of Neospora caninum have been evaluated as targets for vaccine development in experimental mouse infection models. Among them, the rhoptry antigen NcROP2 and the immunodominant NcGRA7 protein have been assessed with varying results. Recent studies have shown that another rhoptry component, NcROP40, and NcNTPase, a putative dense granule antigen, exhibit higher expression levels in tachyzoites of virulent N. caninum isolates, suggesting that these could be potential vaccine candidates to limit the effects of infection. In the present work, the safety and efficacy of these recombinant antigens formulated in Quil-A adjuvant as monovalent vaccines or pair-wise combinations (rNcROP40+rNcROP2 and rNcGRA7+rNcNTPase) were evaluated in a pregnant mouse model of neosporosis. All the vaccine formulations elicited a specific immune response against their respective native proteins after immunization. Mice vaccinated with rNcROP40 and rNcROP2 alone or in combination produced the highest levels of IFN-γ and exhibited low parasite burdens and low IgG antibody levels after the challenge. In addition, most of the vaccine formulations were able to increase the median survival time in the offspring. However, pup survival only ensued in the groups vaccinated with rNcROP40+rNcROP2 (16.2%) and rNcROP2 (6.3%). Interestingly, vertical transmission was not observed in those survivor pups immunized with rNcROP40+rNcROP2, as shown by PCR analyses. These results show a partial protection against N. caninum infection after vaccination with rNcROP40+rNcROP2, suggesting a synergistic effect of the two recombinant rhoptry antigens. Copyright © 2014 Elsevier B.V. All rights reserved.

Aulacoseira coroniformis sp. nov., a new diatom (Bacillariophyta) species from Highland Hammock State Park, Florida

NARCIS (Netherlands)

Cremer, H.; Pearce, C.; Wagner-Cremer, F.

2010-01-01

Aulacoseira coroniformis sp. nov. is described from a short peat core recovered in Highlands Hammock State Park, Florida, U.S.A. The morphology of the new diatom species is documented by light and scanning electron micrographs and discussed in detail, including a comparison with related species in

NC10 bacteria in marine oxygen minimum zones

DEFF Research Database (Denmark)

Padilla, Cory C; Bristow, Laura A; Sarode, Neha

2016-01-01

Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic....... rRNA and mRNA transcripts assignable to NC10 peaked within the OMZ and included genes of the putative nitrite-dependent intra-aerobic pathway, with high representation of transcripts containing the unique motif structure of the nitric oxide (NO) reductase of NC10 bacteria, hypothesized...

Virtual NC machine model with integrated knowledge data

International Nuclear Information System (INIS)

Sidorenko, Sofija; Dukovski, Vladimir

2002-01-01

The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)

Parking Navigation for Alleviating Congestion in Multilevel Parking Facility

OpenAIRE

Kenmotsu, Masahiro; Sun, Weihua; Shibata, Naoki; Yasumoto, Keiichi; Ito, Minoru

2012-01-01

Finding a vacant parking space in a large crowded parking facility takes long time. In this paper, we propose a navigation method that minimizes the parking time based on collected real-time positional information of cars. In the proposed method, a central server in the parking facility collects the information and estimates the occupancy of each parking zone. Then, the server broadcasts the occupancy data to the cars in the parking facility. Each car then computes a parking route with the sh...

Case Study in International Cooperation: Cuba's Molecular Immunology Center and Roswell Park Cancer Institute.

Science.gov (United States)

Evans, Rachel; Reid, Mary; Segal, Brahm; Abrams, Scott I; Lee, Kelvin

2018-04-01

In 1961, the USA severed diplomatic relations with Cuba, and in 1962 an embargo was imposed on trade and financial relations with that country. It was not until five decades later that the USA and Cuba would reestablish relations. This opened the way for the New York State Trade Mission to Cuba in April 2015, during which Cuba's Molecular Immunology Center and Buffalo, New York's Roswell Park Cancer Institute signed a formal agreement that would set in motion biotechnology research collaboration to address one of the most important causes of death in both countries. Significant research from Cuba led to this groundbreaking collaboration. The purpose of this paper is to discuss the development of this cooperation, from the Molecular Immunology Center's initial investigations, through the opening of a phase I clinical trial at Roswell Park Cancer Institute with therapies developed at the Center. This cooperation was responsible for the first clinical trial for CIMAvax-EGF involving advanced-stage non-small cell lung cancer patients in the USA. A license was also approved by the US Department of the Treasury's Office of Foreign Assets Control authorizing a commercial partnership for development of biotechnology products, combining the cancer research efforts of both institutions. This unusual collaboration between Cuba and the USA-the US economic embargo and travel restrictions not withstanding-opens good prospects for expanded medical research between the two countries. While political and logistical challenges remain, the shared mission and dedication of these Cuban and US scientists points the way towards relationships that can lead to development, testing, approval and use of promising new therapies for cancer patients. KEYWORDS Biotechnology, clinical trials, cancer vaccines, cancer immunotherapy, non-small cell lung cancer, NSCLC, Cuba, USA.

Eruptions at Lone Star Geyser, Yellowstone National Park, USA, part 1: energetics and eruption dynamics

Science.gov (United States)

Karlstrom, Leif; Hurwitz, Shaul; Sohn, Robert; Vandemeulebrouck, Jean; Murphy, Fred; Rudolph, Maxwell L.; Johnston, Malcolm J.S.; Manga, Michael; McCleskey, R. Blaine

2013-01-01

Geysers provide a natural laboratory to study multiphase eruptive processes. We present results from a four–day experiment at Lone Star Geyser in Yellowstone National Park, USA. We simultaneously measured water discharge, acoustic emissions, infraredintensity, and visible and infrared video to quantify the energetics and dynamics of eruptions, occurring approximately every three hours. We define four phases in the eruption cycle: 1) a 28 ± 3 minute phase with liquid and steam fountaining, with maximum jet velocities of 16–28 m s− 1, steam mass fraction of less than ∼ 0.01. Intermittently choked flow and flow oscillations with periods increasing from 20 to 40 s are coincident with a decrease in jet velocity and an increase of steam fraction; 2) a 26 ± 8 minute post–eruption relaxation phase with no discharge from the vent, infrared (IR) and acoustic power oscillations gliding between 30 and 40 s; 3) a 59 ± 13 minute recharge period during which the geyser is quiescent and progressively refills, and 4) a 69 ± 14 minute pre–play period characterized by a series of 5–10 minute–long pulses of steam, small volumes of liquid water discharge and 50–70 s flow oscillations. The erupted waters ascend froma 160 − 170° C reservoir and the volume discharged during the entire eruptive cycle is 20.8 ± 4.1 m3. Assuming isentropic expansion, we calculate a heat output from the geyser of 1.4–1.5 MW, which is < 0.1% of the total heat output from Yellowstone Caldera.

Wetland occupancy of pond-breeding amphibians in Yosemite National Park, USA

Science.gov (United States)

Fellers, Gary M.; Kleeman, Patrick M.; Miller, David A.W.

2015-01-01

We estimated wetland occupancy and population trends for three species of pond-breeding anurans in Yosemite National Park from 2007-2011. We used a double survey technique in which two observers independently surveyed each site on the same day. Double surveys allowed us to calculate detectability for the three most common anurans within the park: Rana sierrae, Anaxyrus canorus, and Pseudacris regilla. Annual estimates of detectability were generally high; mean detectability ranged from 73.7% + 0.6 (SE) for any life history stage of A. canorus to 86.7% + 0.7 for sites with P. regilla reproduction (eggs or larvae present). Detectability was most variable for Anaxyrus canorus, which ranged from 45.9% to 99.7%. The probability of occupancy for R. sierrae was highest in larger, low-elevation wetlands that lacked fish. Anaxyrus canorus were more common in shallow high-elevation ponds; their occurrence was minimally impacted by the presence of fish. Finally, occurrence of P. regilla was largely unrelated to wetland size and elevation, but like R. sierrae, they were less likely to occupy sites with fi sh. Occupancy showed no trend over the five years of our study for R. sierrae or A. canorus when considering either sites with any life stage or only sites with reproduction. However, P. regilla showed a modest downward trend for sites with any life stage and sites with reproduction. Our results for R. sierrae run counter to expectations given recent concern about the decline of this species, while our findings for P. regilla raise concerns for this widespread and generally common species.

DETECTING FOREST STRESS AND DECLINE IN RESPONSE TO INCREASING RIVER FLOW IN SOUTHWEST FLORIDA, USA

Science.gov (United States)

Forest stress and decline resulting from increased river flows were investigated in Myakka River State Park (MRSP), Florida, USA. Since 1977, land-use changes around the upper Myakka River watershed have resulted in significant increases in water entering the river, which have...

Field validation of food outlet databases: the Latino food environment in North Carolina, USA.

Science.gov (United States)

Rummo, Pasquale E; Albrecht, Sandra S; Gordon-Larsen, Penny

2015-04-01

Obtaining valid, reliable measures of food environments that serve Latino communities is important for understanding barriers to healthy eating in this at-risk population. The primary aim of the study was to examine agreement between retail food outlet data from two commercial databases, Nielsen TDLinx (TDLinx) for food stores and Dun & Bradstreet (D&B) for food stores and restaurants, relative to field observations of food stores and restaurants in thirty-one census tracts in Durham County, NC, USA. We also examined differences by proportion of Hispanic population (Spanish language. One hundred and seventy-four food stores and 337 restaurants in Durham County, NC, USA. We found that overall sensitivity of food store listings in TDLinx was higher (64 %) than listings in D&B (55 %). Twenty-five food stores were characterized by auditors as Latino food stores, with 20 % identified in TDLinx, 52 % in D&B and 56 % in both sources. Overall sensitivity of restaurants (68 %) was higher than sensitivity of Latino restaurants (38 %) listed in D&B. Sensitivity did not differ substantially by Hispanic composition of neighbourhoods. Our findings suggest that while TDLinx and D&B commercial data sources perform well for total food stores, they perform less well in identifying small and independent food outlets, including many Latino food stores and restaurants.

78 FR 59042 - National Institute of Environmental Health Sciences; Notice of Meeting

Science.gov (United States)

2013-09-25

... Drive, Research Triangle Park, NC 27709. Open: October 21, 2013, 9:20 a.m. to 11:15 a.m. Agenda... Park, NC 27709. Open: October 21, 2013, 1:00 p.m. to 2:30 p.m. Agenda: Poster Session. Place: Nat. Inst..., Research Triangle Park, NC 27709. Closed: October 21, 2013, 2:30 p.m. to 3:00 p.m. Agenda: To review and...

Smart parking barrier

KAUST Repository

Alharbi, Abdulrazaq M.

2016-05-06

Various methods and systems are provided for smart parking barriers. In one example, among others, a smart parking barrier system includes a movable parking barrier located at one end of a parking space, a barrier drive configured to control positioning of the movable parking barrier, and a parking controller configured to initiate movement of the parking barrier, via the barrier drive. The movable parking barrier can be positioned between a first position that restricts access to the parking space and a second position that allows access to the parking space. The parking controller can initiate movement of the movable parking barrier in response to a positive identification of an individual allowed to use the parking space. The parking controller can identify the individual through, e.g., a RFID tag, a mobile device (e.g., a remote control, smartphone, tablet, etc.), an access card, biometric information, or other appropriate identifier.

parkITsmart: minimization of cruising for parking

OpenAIRE

Tsiaras, Christos; Hobi, Livio; Hofstetter, Fabian; Liniger, Samuel; Stiller, Burkhard

2015-01-01

Finding a parking space in urban areas is a daily challenge for drivers across the world, due to the increasing amount of vehicles and the limited amount of parking spaces. Drivers who are looking for a parking space in peak hours are often forced to drive around city blocks until they spot a free parking space. This process is termed in literature “cruising for parking” and is proven to (a) cost a lot of time and gas for drivers, (b) generate unnecessary traffic load, and (c) affect the envi...

Exploring en-route parking type and parking-search route choice

DEFF Research Database (Denmark)

Kaplan, Sigal; Bekhor, Sholomo

2011-01-01

This paper describes the first phase of an on-going research investigating the joint choice of parking type, parking facility and cruising-for-parking route. The importance of this issue derives from the significant share of cruising-for-parking traffic in urban areas, the relevance of parking po...

iParking: an intelligent indoor location-based smartphone parking service.

Science.gov (United States)

Liu, Jingbin; Chen, Ruizhi; Chen, Yuwei; Pei, Ling; Chen, Liang

2012-10-31

Indoor positioning technologies have been widely studied with a number of solutions being proposed, yet substantial applications and services are still fairly primitive. Taking advantage of the emerging concept of the connected car, the popularity of smartphones and mobile Internet, and precise indoor locations, this study presents the development of a novel intelligent parking service called iParking. With the iParking service, multiple parties such as users, parking facilities and service providers are connected through Internet in a distributed architecture. The client software is a light-weight application running on a smartphone, and it works essentially based on a precise indoor positioning solution, which fuses Wireless Local Area Network (WLAN) signals and the measurements of the built-in sensors of the smartphones. The positioning accuracy, availability and reliability of the proposed positioning solution are adequate for facilitating the novel parking service. An iParking prototype has been developed and demonstrated in a real parking environment at a shopping mall. The demonstration showed how the iParking service could improve the parking experience and increase the efficiency of parking facilities. The iParking is a novel service in terms of cost- and energy-efficient solution.

iParking: An Intelligent Indoor Location-Based Smartphone Parking Service

Directory of Open Access Journals (Sweden)

Liang Chen

2012-10-01

Full Text Available Indoor positioning technologies have been widely studied with a number of solutions being proposed, yet substantial applications and services are still fairly primitive. Taking advantage of the emerging concept of the connected car, the popularity of smartphones and mobile Internet, and precise indoor locations, this study presents the development of a novel intelligent parking service called iParking. With the iParking service, multiple parties such as users, parking facilities and service providers are connected through Internet in a distributed architecture. The client software is a light-weight application running on a smartphone, and it works essentially based on a precise indoor positioning solution, which fuses Wireless Local Area Network (WLAN signals and the measurements of the built-in sensors of the smartphones. The positioning accuracy, availability and reliability of the proposed positioning solution are adequate for facilitating the novel parking service. An iParking prototype has been developed and demonstrated in a real parking environment at a shopping mall. The demonstration showed how the iParking service could improve the parking experience and increase the efficiency of parking facilities. The iParking is a novel service in terms of cost- and energy-efficient solution.

iParking: An Intelligent Indoor Location-Based Smartphone Parking Service

Science.gov (United States)

Liu, Jingbin; Chen, Ruizhi; Chen, Yuwei; Pei, Ling; Chen, Liang

2012-01-01

Indoor positioning technologies have been widely studied with a number of solutions being proposed, yet substantial applications and services are still fairly primitive. Taking advantage of the emerging concept of the connected car, the popularity of smartphones and mobile Internet, and precise indoor locations, this study presents the development of a novel intelligent parking service called iParking. With the iParking service, multiple parties such as users, parking facilities and service providers are connected through Internet in a distributed architecture. The client software is a light-weight application running on a smartphone, and it works essentially based on a precise indoor positioning solution, which fuses Wireless Local Area Network (WLAN) signals and the measurements of the built-in sensors of the smartphones. The positioning accuracy, availability and reliability of the proposed positioning solution are adequate for facilitating the novel parking service. An iParking prototype has been developed and demonstrated in a real parking environment at a shopping mall. The demonstration showed how the iParking service could improve the parking experience and increase the efficiency of parking facilities. The iParking is a novel service in terms of cost- and energy-efficient solution. PMID:23202179

ncRNA consensus secondary structure derivation using grammar strings.

Science.gov (United States)

Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh

2011-04-01

Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at http://www.cse.msu.edu/~yannisun/grammar-string.

Inherent and antigen-induced airway hyperreactivity in NC mice

Directory of Open Access Journals (Sweden)

Tetsuto Kobayashi

1999-01-01

Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.

National Parks

Data.gov (United States)

Department of Transportation — National Park Service unit boundaries (NTAD). These park boundaries signify legislative boundary definitions and local park names have been consolidated according to...

Smart parking barrier

KAUST Repository

Alharbi, Abdulrazaq M.

2016-01-01

positioning of the movable parking barrier, and a parking controller configured to initiate movement of the parking barrier, via the barrier drive. The movable parking barrier can be positioned between a first position that restricts access to the parking

Skin permeability and pharmacokinetics of diclofenac epolamine administered by dermal patch in Yorkshire-Landrace pigs

OpenAIRE

Tse S; Powell KD; MacLennan SJ; Moorman AR; Paterson C; Bell RR

2012-01-01

Susanna Tse,1 Kendall D Powell,2 Stephen MacLennan,3 Allan R Moorman,4 Craig Paterson,5 Rosonald R Bell11Pfizer Inc, Groton, CT, USA; 2Tandem Labs, Durham, NC, USA; 3BioCryst Pharmaceuticals Inc, Durham, NC, USA; 4Alta Vetta Pharmaceutical Consulting LLC, Durham, NC, USA; 5Salix Pharmaceuticals Inc, Raleigh, NC, USAPurpose: This study compared the pharmacokinetic profile, and systemic and local absorption of diclofenac, following dermal patch application and oral administration in Yorkshire- ...

Improving Earth Science Metadata: Modernizing ncISO

Science.gov (United States)

O'Brien, K.; Schweitzer, R.; Neufeld, D.; Burger, E. F.; Signell, R. P.; Arms, S. C.; Wilcox, K.

2016-12-01

ncISO is a package of tools developed at NOAA's National Center for Environmental Information (NCEI) that facilitates the generation of ISO 19115-2 metadata from NetCDF data sources. The tool currently exists in two iterations: a command line utility and a web-accessible service within the THREDDS Data Server (TDS). Several projects, including NOAA's Unified Access Framework (UAF), depend upon ncISO to generate the ISO-compliant metadata from their data holdings and use the resulting information to populate discovery tools such as NCEI's ESRI Geoportal and NOAA's data.noaa.gov CKAN system. In addition to generating ISO 19115-2 metadata, the tool calculates a rubric score based on how well the dataset follows the Attribute Conventions for Dataset Discovery (ACDD). The result of this rubric calculation, along with information about what has been included and what is missing is displayed in an HTML document generated by the ncISO software package. Recently ncISO has fallen behind in terms of supporting updates to conventions such updates to the ACDD. With the blessing of the original programmer, NOAA's UAF has been working to modernize the ncISO software base. In addition to upgrading ncISO to utilize version1.3 of the ACDD, we have been working with partners at Unidata and IOOS to unify the tool's code base. In essence, we are merging the command line capabilities into the same software that will now be used by the TDS service, allowing easier updates when conventions such as ACDD are updated in the future. In this presentation, we will discuss the work the UAF project has done to support updated conventions within ncISO, as well as describe how the updated tool is helping to improve metadata throughout the earth and ocean sciences.

Explorations of the extended ncKP hierarchy

International Nuclear Information System (INIS)

Dimakis, Aristophanes; Mueller-Hoissen, Folkert

2004-01-01

A recently obtained extension (xncKP) of the Moyal-deformed KP hierarchy (ncKP hierarchy) by a set of evolution equations in the Moyal-deformation parameters is further explored. Formulae are derived to compute these equations efficiently. Reductions of the xncKP hierarchy are treated, in particular to the extended ncKdV and ncBoussinesq hierarchies. Furthermore, a good part of the Sato formalism for the KP hierarchy is carried over to the generalized framework. In particular, the well-known bilinear identity theorem for the KP hierarchy, expressed in terms of the (formal) Baker-Akhiezer function, extends to the xncKP hierarchy. Moreover, it is demonstrated that N-soliton solutions of the ncKP equation are also solutions of the first few deformation equations. This is shown to be related to the existence of certain families of algebraic identities

Rural Latino youth park use: characteristics, park amenities, and physical activity.

Science.gov (United States)

Perry, Cynthia K; Saelens, Brain E; Thompson, Beti

2011-06-01

Less than half of youth engage in sufficient physical activity to achieve health benefits. Key environmental factors of park and recreation spaces may influence youth physical activity. We sought to ascertain youth characteristics and behaviors that attract youth to parks with specific amenities and encourage physical activity while at the parks in a rural, predominantly Latino community. We examined the quality of amenities in the 13 parks and recreation spaces that middle school aged youth have access to in their community using the Environmental Assessment of Parks and Recreation Spaces (EAPRS) tool. Middle school students completed surveys in the school classroom (n = 1,102) regarding park use, physical activity, and intrapersonal characteristics (e.g., motivators). We used logistic regression to identify correlates of any park use, use of higher quality field and court parks, and active and sedentary park use. Younger age, participation in an after school activity, and identification of a team as a motivator were positively associated with any park use. Use of higher quality court and field parks was associated with participation in an after school activity and being Latino. The odds of being active in the parks were greater for boys and Latinos. Older age and alcohol use are correlated with being sedentary at the park, while odds of being sedentary at the park were lower for boys and youth who met physical activity guidelines. Organized team activities may encourage active use of higher quality fields and courts parks by Latino youth; thereby, increasing their level of physical activity.

Twentieth-century decline of large-diameter trees in Yosemite National Park, California, USA

Science.gov (United States)

Lutz, J.A.; van Wagtendonk, J.W.; Franklin, J.F.

2009-01-01

Studies of forest change in western North America often focus on increased densities of small-diameter trees rather than on changes in the large tree component. Large trees generally have lower rates of mortality than small trees and are more resilient to climate change, but these assumptions have rarely been examined in long-term studies. We combined data from 655 historical (1932-1936) and 210 modern (1988-1999) vegetation plots to examine changes in density of large-diameter trees in Yosemite National Park (3027 km2). We tested the assumption of stability for large-diameter trees, as both individual species and communities of large-diameter trees. Between the 1930s and 1990s, large-diameter tree density in Yosemite declined 24%. Although the decrease was apparent in all forest types, declines were greatest in subalpine and upper montane forests (57.0% of park area), and least in lower montane forests (15.3% of park area). Large-diameter tree densities of 11 species declined while only 3 species increased. Four general patterns emerged: (1) Pinus albicaulis, Quercus chrysolepis, and Quercus kelloggii had increases in density of large-diameter trees occur throughout their ranges; (2) Pinus jeffreyi, Pinus lambertiana, and Pinus ponderosa, had disproportionately larger decreases in large-diameter tree densities in lower-elevation portions of their ranges; (3) Abies concolor and Pinus contorta, had approximately uniform decreases in large-diameter trees throughout their elevational ranges; and (4) Abies magnifica, Calocedrus decurrens, Juniperus occidentalis, Pinus monticola, Pseudotsuga menziesii, and Tsuga mertensiana displayed little or no change in large-diameter tree densities. In Pinus ponderosa-Calocedrus decurrens forests, modern large-diameter tree densities were equivalent whether or not plots had burned since 1936. However, in unburned plots, the large-diameter trees were predominantly A. concolor, C. decurrens, and Q. chrysolepis, whereas P. ponderosa

Analysis of Parking Reliability Guidance of Urban Parking Variable Message Sign System

Directory of Open Access Journals (Sweden)

Zhenyu Mei

2012-01-01

Full Text Available Operators of parking guidance and information systems (PGIS often encounter difficulty in determining when and how to provide reliable car park availability information to drivers. Reliability has become a key factor to ensure the benefits of urban PGIS. The present paper is the first to define the guiding parking reliability of urban parking variable message signs (VMSs. By analyzing the parking choice under guiding and optional parking lots, a guiding parking reliability model was constructed. A mathematical program was formulated to determine the guiding parking reliability of VMS. The procedures were applied to a numerical example, and the factors that affect guiding reliability were analyzed. The quantitative changes of the parking berths and the display conditions of VMS were found to be the most important factors influencing guiding reliability. The parking guiding VMS achieved the best benefit when the parking supply was close to or was less than the demand. The combination of a guiding parking reliability model and parking choice behavior offers potential for PGIS operators to reduce traffic congestion in central city areas.

Analysis of Parking Reliability Guidance of Urban Parking Variable Message Sign System

OpenAIRE

Zhenyu Mei; Ye Tian; Dongping Li

2012-01-01

Operators of parking guidance and information systems (PGIS) often encounter difficulty in determining when and how to provide reliable car park availability information to drivers. Reliability has become a key factor to ensure the benefits of urban PGIS. The present paper is the first to define the guiding parking reliability of urban parking variable message signs (VMSs). By analyzing the parking choice under guiding and optional parking lots, a guiding parking reliability model was constru...

78 FR 24197 - Product Cancellation Order for Certain Pesticide Registrations

Science.gov (United States)

2013-04-24

...; MI110003)..... Syngenta Crop Protection, LLC, 410 Swing Rd., P.O. Box 18300, Greensboro, NC 27419-8300. 264 (ME090004) Bayer CropScience LP, 2 T.W. Alexander Dr., P.O. Box 12014, Research Triangle Park, NC 27709. 432 Bayer Environmental Science, 2 T.W. Alexander Dr., P.O. Box 12014, Research Triangle Park, NC 27709. 675...

Application of a MODIS Soil Moisture-Evapotranspiration (MOD-SMET) Model to Evaluate Landscape and Hydrologic Recovery after the High Park Fire in Colorado, USA

Science.gov (United States)

Blount, W. K.; Hogue, T. S.; Franz, K.; Knipper, K. R.

2017-12-01

Accurate estimation of evapotranspiration (ET) is critical for the management of water resources, especially in water-stressed regions. ET accounts for approximately 60% of terrestrial precipitation globally and approaches 100% of annual rainfall in arid ecosystems, where transpiration becomes the dominant term. ET is difficult to measure due to its spatiotemporal variation, which requires adequate data coverage. While new remote sensing-based ET products are available at a 1 km spatial resolution, including the Operational Simplified Surface Energy Balance model (SSEBop) and the MODIS Global Evapotranspiration Project (MOD16), these products are available at monthly and 8-day temporal resolutions, respectively. To better understand the changing dynamics of hydrologic fluxes and the partitioning of water after land cover disturbances and to identify statically significant trends, more frequent observations are necessary. Utilizing the recently developed MODIS Soil Moisture-Evapotranspiration (MOD-SMET) model, daily temporal resolution is achieved. This presentation outlines the methodology of the MOD-SMET model and compares SSEBop, MOD16, and MOD-SMET ET estimates over the High Park Fire burn scar in Colorado, USA. MOD-SMET estimates are used to identify changes in fluxes and partitioning of the water cycle after a wildfire and during recovery in the High Park Fire near Fort Collins, Colorado. Initial results indicate greenness and ET from all three models decrease post-fire, with higher statistical confidence in high burn areas and spatial patterns that closely align with burn severity. MOD-SMET improves the ability to resolve statistically significant changes in ET following wildfires and better understand changes in the post-fire water budget. Utilizing this knowledge, water resource managers can better plan for, and mitigate, the short- and long-term impacts of wildfire on regional water supplies.

Using high-resolution future climate scenarios to forecast Bromus tectorum invasion in Rocky Mountain National Park.

Science.gov (United States)

West, Amanda M; Kumar, Sunil; Wakie, Tewodros; Brown, Cynthia S; Stohlgren, Thomas J; Laituri, Melinda; Bromberg, Jim

2015-01-01

National Parks are hallmarks of ecosystem preservation in the United States. The introduction of alien invasive plant species threatens protection of these areas. Bromus tectorum L. (commonly called downy brome or cheatgrass), which is found in Rocky Mountain National Park (hereafter, the Park), Colorado, USA, has been implicated in early spring competition with native grasses, decreased soil nitrogen, altered nutrient and hydrologic regimes, and increased fire intensity. We estimated the potential distribution of B. tectorum in the Park based on occurrence records (n = 211), current and future climate, and distance to roads and trails. An ensemble of six future climate scenarios indicated the habitable area of B. tectorum may increase from approximately 5.5% currently to 20.4% of the Park by the year 2050. Using ordination methods we evaluated the climatic space occupied by B. tectorum in the Park and how this space may shift given future climate change. Modeling climate change at a small extent (1,076 km2) and at a fine spatial resolution (90 m) is a novel approach in species distribution modeling, and may provide inference for microclimates not captured in coarse-scale models. Maps from our models serve as high-resolution hypotheses that can be improved over time by land managers to set priorities for surveys and removal of invasive species such as B. tectorum.

Using High-Resolution Future Climate Scenarios to Forecast Bromus tectorum Invasion in Rocky Mountain National Park

Science.gov (United States)

West, Amanda M.; Kumar, Sunil; Wakie, Tewodros; Brown, Cynthia S.; Stohlgren, Thomas J.; Laituri, Melinda; Bromberg, Jim

2015-01-01

National Parks are hallmarks of ecosystem preservation in the United States. The introduction of alien invasive plant species threatens protection of these areas. Bromus tectorum L. (commonly called downy brome or cheatgrass), which is found in Rocky Mountain National Park (hereafter, the Park), Colorado, USA, has been implicated in early spring competition with native grasses, decreased soil nitrogen, altered nutrient and hydrologic regimes, and increased fire intensity. We estimated the potential distribution of B. tectorum in the Park based on occurrence records (n = 211), current and future climate, and distance to roads and trails. An ensemble of six future climate scenarios indicated the habitable area of B. tectorum may increase from approximately 5.5% currently to 20.4% of the Park by the year 2050. Using ordination methods we evaluated the climatic space occupied by B. tectorum in the Park and how this space may shift given future climate change. Modeling climate change at a small extent (1,076 km2) and at a fine spatial resolution (90 m) is a novel approach in species distribution modeling, and may provide inference for microclimates not captured in coarse-scale models. Maps from our models serve as high-resolution hypotheses that can be improved over time by land managers to set priorities for surveys and removal of invasive species such as B. tectorum. PMID:25695255

Using high-resolution future climate scenarios to forecast Bromus tectorum invasion in Rocky Mountain National Park.

Directory of Open Access Journals (Sweden)

Amanda M West

Full Text Available National Parks are hallmarks of ecosystem preservation in the United States. The introduction of alien invasive plant species threatens protection of these areas. Bromus tectorum L. (commonly called downy brome or cheatgrass, which is found in Rocky Mountain National Park (hereafter, the Park, Colorado, USA, has been implicated in early spring competition with native grasses, decreased soil nitrogen, altered nutrient and hydrologic regimes, and increased fire intensity. We estimated the potential distribution of B. tectorum in the Park based on occurrence records (n = 211, current and future climate, and distance to roads and trails. An ensemble of six future climate scenarios indicated the habitable area of B. tectorum may increase from approximately 5.5% currently to 20.4% of the Park by the year 2050. Using ordination methods we evaluated the climatic space occupied by B. tectorum in the Park and how this space may shift given future climate change. Modeling climate change at a small extent (1,076 km2 and at a fine spatial resolution (90 m is a novel approach in species distribution modeling, and may provide inference for microclimates not captured in coarse-scale models. Maps from our models serve as high-resolution hypotheses that can be improved over time by land managers to set priorities for surveys and removal of invasive species such as B. tectorum.

Motivations for recreating on farmlands, private forests, and state or national parks.

Science.gov (United States)

Sotomayor, Sandra; Barbieri, Carla; Wilhelm Stanis, Sonja; Aguilar, Francisco X; Smith, Jordan W

2014-07-01

This study explores the importance of different motivations to visit three types of recreational settings--farms, private forests, and state or national parks. Data were collected via a mail-back questionnaire administered to a stratified random sample of households in Missouri (USA). Descriptive and inferential statistics reveal both similarities and discontinuities in motivations for visiting farms, private forests, and state or national parks for recreation. Being with family, viewing natural scenery, and enjoying the smells and sounds of nature were all highly important motivations for visiting the three types of settings. However, all 15 motivations examined were perceived to be significantly more important for visits to state or national parks than to farms or private forests. Findings suggest that individuals are more strongly motivated to recreate at state and national parks relative to farmlands or forests. Post hoc paired t tests comparing motivations between both agricultural settings (farms and private forests) revealed significant differences in eight different recreational motivations. Individuals tended to place more importance on the ability to use equipment and test their skills when considering recreating on private forests. Conversely, social motivations (e.g., doing something with the family) were more important when individuals were considering recreating on farmland. Collectively, the findings suggest individuals expect distinctly different outcomes from their visits to farmlands, private forests, or state or national parks. Consequently, all three types of recreational settings have competitive advantages that their managers could capitalize on when making decisions about how to attract new visitors or produce the most desirable experiences for current recreationists.

Increase of child car seat temperature in cars parked in the outpatient parking lot.

Science.gov (United States)

Sugimura, Tetsu; Suzue, Junji; Kamada, Makoto; Ozaki, Yukiko; Tananari, Yoshifumi; Maeno, Yasuki; Ito, Shinichi; Nishino, Hiroshi; Kakimoto, Noriko; Yamakawa, Rumi

2011-12-01

A guideline for the safe use of child car seats (CS) was published by the Japan Pediatric Society in 2008. There have been few studies of the increase of temperature of a CS in parked cars. The aim of this study was to determine the change in the temperature of the CS in cars parked in full sun. The temperature of CS was measured during summer (July and August) in 2006, 2007, and 2008. The CS used in this study (n= 50) were for children (≤ 6 years old) who were taken by car to Sugimura Children's Medical Clinic. Temperatures were only measured on sunny days. Measurements were performed from 09.00 to 17.00 hours. Thermochron (Thermochron i-Button: G type, Maxim Integrated Products, CA, USA) was used to measure the temperatures. The maximum temperatures of CS were compared in time at the clinic, taking into consideration seat colors, and car colors. Of the 50 cars, three cars were excluded due to being in the shade while the temperature was measured. A total of 47 cars were used for this study. The temperature of the CS ranged from 38.0 to 65.5°C (47.8 ± 5.8°C). Eighteen CS (38.3%) reached a temperature of 50°C or above. The maximum temperature of the 13.00-15.00-hours group was significantly higher than that of the 09.00-11.00-hours group (P= 0.035). The CS temperatures in the black car group were significantly higher than those of the white car group (P= 0.013). CS may become very hot while a car is parked in sun, especially if the car and the CS are black, so the CS should be cooled before a young child is placed in it. Guardians of small children should be aware of this risk. © 2011 The Authors. Pediatrics International © 2011 Japan Pediatric Society.

An overview on STEP-NC compliant controller development

Science.gov (United States)

Othman, M. A.; Minhat, M.; Jamaludin, Z.

2017-10-01

The capabilities of conventional Computer Numerical Control (CNC) machine tools as termination organiser to fabricate high-quality parts promptly, economically and precisely are undeniable. To date, most CNCs follow the programming standard of ISO 6983, also called G & M code. However, in fluctuating shop floor environment, flexibility and interoperability of current CNC system to react dynamically and adaptively are believed still limited. This outdated programming language does not explicitly relate to each other to have control of arbitrary locations other than the motion of the block-by-block. To address this limitation, new standard known as STEP-NC was developed in late 1990s and is formalized as an ISO 14649. It adds intelligence to the CNC in term of interoperability, flexibility, adaptability and openness. This paper presents an overview of the research work that have been done in developing a STEP-NC controller standard and the capabilities of STEP-NC to overcome modern manufacturing demands. Reviews stated that most existing STEP-NC controller prototypes are based on type 1 and type 2 implementation levels. There are still lack of effort being done to develop type 3 and type 4 STEP-NC compliant controller.

78 FR 72009 - Establishment of Class E Airspace; Star, NC

Science.gov (United States)

2013-12-02

...-0440; Airspace Docket No. 13-ASO-10] Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...

Implementation of ergonomics in the management of parking increasing the quality of living parking park in mall Robinson Denpasar city

Science.gov (United States)

Sutapa, I. K.; Sudiarsa, I. M.

2018-01-01

The problems that often arise in the area of Denpasar City mostly caused by parking problems at the centers of activities such as shopping centers. The problems that occur not only because of the large number of vehicles that parked but also the result of the condition of parking officers who have not received attention, there is no concern about the physical condition of parking attendants because doing night guard duty. To improve the quality of parking officer, ergonomic parking lot is improved through the application of appropriate technology with systemic, holistic, interdisciplinary and participatory approach. The general objective of the research is to know the implementation of ergonomics in parking management on the improvement of the quality of parking officer in Robinson shopping center. The indicator of the quality of the parking officer work is the decrease of musculoskeletal complaints, fatigue, workload, boredom and increasing work motivation. The study was conducted using the same subject design, involving 10 subjects as a simple random sample. Intervention is done by arrangement of ergonomic basement motorcycle parking. Measurements done before and after repair. Washing out (WO) for 14 days. The data obtained were analyzed descriptively, tested normality (shapirowilk) and homogeneity (Levene Test). For normal and homogeneous distribution data, different test with One Way Anova, different test between Period with Post Hoc. Normally distributed and non-homogeneous data, different test with Friedman Test, different test between periods using Wilcoxon test. Data were analyzed with significance level of 5%. The results showed that the implementation of ergonomic in the management of parking area of the court decreased musculoskeletal complaints by 15.10% (p management of the parking lot improves the quality of the parking officer work from: (1) decrease of musculoskeletal complaints, (2) decrease of melting rate, (3) decrease of parking workload

Parks & benefits

DEFF Research Database (Denmark)

Brandt, Jesper; Christensen, Andreas Aagaard; Holmes, Esbern

2011-01-01

conservation. Increasing visitor flows and cuts in staff resources has put focus on the management of visitor carrying capacities and their relation to landscape structure and zoning. At the same time park authorities face falling public appropriations and receding focus on their conservation functions...... compared to recreation and settlement. The constant priority of the balancing of nature protection and economic utilization gives rise to various experience with land use and visitor management relevant for sustainable development also outside the parks. In European nature parks the handling of visitor...... carrying capacities related to Natura2000-sites and their included habitat type areas is a priority theme for the sustainable management of nature parks. A comparative analysis of conditions and initiatives related to visitor carrying capacities in 8 nature parks in the Baltic region has been carried out...

iParking: An Intelligent Indoor Location-Based Smartphone Parking Service

OpenAIRE

Liu, Jingbin; Chen, Ruizhi; Chen, Yuwei; Pei, Ling; Chen, Liang

2012-01-01

Indoor positioning technologies have been widely studied with a number of solutions being proposed, yet substantial applications and services are still fairly primitive. Taking advantage of the emerging concept of the connected car, the popularity of smartphones and mobile Internet, and precise indoor locations, this study presents the development of a novel intelligent parking service called iParking. With the iParking service, multiple parties such as users, parking facilities and service p...

78 FR 24071 - Safety Zone; Pasquotank River; Elizabeth City, NC

Science.gov (United States)

2013-04-24

... 1625-AA00 Safety Zone; Pasquotank River; Elizabeth City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary... Pasquotank River in Elizabeth City, NC in support of the Fireworks display for the Potato Festival. This... Guard is establishing a safety zone on the navigable waters of Pasquotank River in Elizabeth City, NC...

Software module for geometric product modeling and NC tool path generation

International Nuclear Information System (INIS)

Sidorenko, Sofija; Dukovski, Vladimir

2003-01-01

The intelligent CAD/CAM system named VIRTUAL MANUFACTURE is created. It is consisted of four intelligent software modules: the module for virtual NC machine creation, the module for geometric product modeling and automatic NC path generation, the module for virtual NC machining and the module for virtual product evaluation. In this paper the second intelligent software module is presented. This module enables feature-based product modeling carried out via automatic saving of the designed product geometric features as knowledge data. The knowledge data are afterwards applied for automatic NC program generation for the designed product NC machining. (Author)

Parks, Place and Pedagogy - Education Partnerships with the National Park Service

Science.gov (United States)

Vye, E. C.; Rose, W. I.; Nash, B.; Klawiter, M.; Huntoon, J. E.; Engelmann, C. A.; Gochis, E. E.; MiTEP

2011-12-01

The Michigan Teaching Excellence Program (MITEP) is a multi-year program of teacher leadership development that empowers science teachers in Grand Rapids, Kalamazoo, and Jackson to lead their schools and districts through the process of improving science teaching and learning. A component of this program is facilitated through partnership between academia, K-12 educators, and the National Park Service (NPS) that aims to develop place-based education strategies that improve diversity and Earth Science literacy. This tangible education method draws upon both the sense of place that National Parks offer and the art of interpretation employed by the park service. Combined, these deepen cognitive process and provide a more diverse reflection of what place means and the processes behind shaping what we see. Our partnerships present participants the opportunity to intern in a Midwest national park for 3-8 weeks during their third year in the program. In summer 2011, eleven teachers from the Grand Rapids school district participated in this innovative way of learning and teaching Earth Science. One goal was to develop geological interpretive materials desired and needed for the parks. Secondly, and important to place-based educational methodologies, these deliverables will be used as a way of bringing the parks to urban classrooms. Participants lived in the parks and worked directly with both national park and Michigan Tech staff to create lesson plans, podcasts, media clips, video, and photographic documentation of their experiences. These lesson plans will be hosted in the Views of the National Park website in an effort to provide innovative teaching resources nationally for teachers or free-choice learners wishing to access information on Midwest national parks. To the benefit of park staff, working with teachers from urban areas offered an opportunity for park staff to access diverse learners in urban settings unable to visit the park. The foundation has been laid for

Iraq: Usa and Great Britain hold up an agreement on limited sales of Iraq petroleum

International Nuclear Information System (INIS)

Anon.

1996-01-01

The negotiations United Nations/Iraq have been stopped because of objections coming from Usa and Great Britain. Three points were developed: The distribution of medicine and foods in three Kurdish countries, these countries are actually under the United nations control, Iraq wants to participate at the distribution but Usa and Great Britain think that it could be a way of pressure from Iraq on Kurdish countries and in this mind they refuse. The second point is about the sequestered banking account on which must be deposited the receipts of Iraqi petroleum sales which must be put under United Nation control in order to avoid, according to Washington and London, that Iraq uses it to get round the sanctions. The third point is that Usa and Great Britain consider that the resolution number 986 has only for object to relieve the pains of Iraqi people and its application must not be interpreted as a lightening of international sanctions against Iraq. The results of the suspension are a surge of petroleum prices on international market and a fall of Iraqi Dinar. (N.C.)

MOF derived Ni/Co/NC catalysts with enhanced properties for oxygen evolution reaction

Science.gov (United States)

Hu, Jiapeng; Chen, Juan; Lin, Hao; Liu, Ruilai; Yang, Xiaobing

2018-03-01

Designing efficient electrocatalysts for oxygen evolution reaction (OER) is very important for renewable energy storage and conversion devices. In this paper, we introduced a new strategy to synthesize Ni doped Co/NC catalysts (NC is the abbreviation of nitrogen-doped graphitic carbon), which were derived from ZIF-67. All catalysts were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscope (TEM) and oxygen evolution reaction (OER). The results show that Ni was well doped in the Ni/Co/NC catalysts and the doping of Ni has great influence on the OER activity of Ni/Co/NC catalysts. Among these catalysts, 0.50Ni/Co/NC exhibits the highest OER activity. The onset potential of 0.50Ni/Co/NC is 1.47 V, which is superior than the onset potential of Co/NC (1.54 V), 0.25Ni/Co/NC (1.48 V), 1.00Ni/Co/NC (1.53 V). The excellent OER activity of 0.50Ni/Co/NC catalyst makes its potential to be used on renewable energy storage.

Influence of Parking Price on Parking Garage Users’ Behaviour

Directory of Open Access Journals (Sweden)

Jelena Simićević

2012-09-01

Full Text Available Parking charge is a powerful tool for solving parking and traffic congestion problems. In order to achieve the expected effects without any adverse impact it is necessary to understand well the users’ responses to this policy. This paper, based on a sample of interviewed parking garage users, has developed binary logit model for identification and quantification of characteristics of users and trips, on which the acceptance of parking price is dependent. In addition, multinomial logit model has been made in order to predict what the users will opt for when faced with an increase in parking price. For the first time the parameter “shorten duration” has been introduced which has shown to be the most significant in making behaviour-related decisions. The results show that the users with the purpose work are the most sensitive to an increase in parking charge, what can be deemed positive for policy makers. However, great sensitivity of the users with the purpose shopping should cause their concern. The results of the multinomial model show that they would not discontinue coming into the area after all.

Mathematical model of parking space unit for triangular parking area

Science.gov (United States)

Syahrini, Intan; Sundari, Teti; Iskandar, Taufiq; Halfiani, Vera; Munzir, Said; Ramli, Marwan

2018-01-01

Parking space unit (PSU) is an effective measure for the area size of a vehicle, including the free space and the width of the door opening of the vehicle (car). This article discusses a mathematical model for parking space of vehicles in triangular shape area. An optimization model for triangular parking lot is developed. Integer Linear Programming (ILP) method is used to determine the maximum number of the PSU. The triangular parking lot is in isosceles and equilateral triangles shape and implements four possible rows and five possible angles for each field. The vehicles which are considered are cars and motorcycles. The results show that the isosceles triangular parking area has 218 units of optimal PSU, which are 84 units of PSU for cars and 134 units of PSU for motorcycles. Equilateral triangular parking area has 688 units of optimal PSU, which are 175 units of PSU for cars and 513 units of PSU for motorcycles.

Evaluating urban parking policies with agent-based model of driver parking behavior

NARCIS (Netherlands)

Martens, C.J.C.M.; Benenson, I.

2008-01-01

This paper presents an explicit agent-based model of parking search in a city. In the model, “drivers” drive toward their destination, search for parking, park, remain at the parking place, and leave. The city’s infrastructure is represented by a high-resolution geographic information system (GIS)

Analysis on Time Window of Shared Parking in Hospitals Based on Parking Behaviors

Directory of Open Access Journals (Sweden)

Qin Chen

2017-01-01

Full Text Available Hospitals are essential components of a city; huge traffic demand is generated and attracted, causing contradiction between parking supply and demand. By sharing parking berths, limited space can serve more demand which is beneficial to alleviating parking problems. Aimed at improving the capacity of shared parking, the paper analyzes four parking groups in typical hospitals, which are medical staff, outpatients, emergency patients, and visiting groups. The parking demand of medical staff is rigid. For outpatients and visiting groups, longer walking distance is acceptable and more attention is paid to parking fee. By contrast, emergency patients can accept shorter walking distance and focus more on convenience due to urgency. Under this circumstance, parking behaviors selection models are established by means of Multinomial Logit Model. On this basis, time value is adopted to calculate the tolerance of alterative parking time. Moreover, this paper explores the variation of time window, under different parking impedance. A case study is conducted and suggests that start and end point of a certain time window can be influenced by external factors.

Development of STEP-NC Adaptor for Advanced Web Manufacturing System

Science.gov (United States)

Ajay Konapala, Mr.; Koona, Ramji, Dr.

2017-08-01

Information systems play a key role in the modern era of Information Technology. Rapid developments in IT & global competition calls for many changes in basic CAD/CAM/CAPP/CNC manufacturing chain of operations. ‘STEP-NC’ an enhancement to STEP for operating CNC machines, creating new opportunities for collaborative, concurrent, adaptive works across the manufacturing chain of operations. Schemas and data models defined by ISO14649 in liaison with ISO10303 standards made STEP-NC file rich with feature based, rather than mere point to point information of G/M Code format. But one needs to have a suitable information system to understand and modify these files. Various STEP-NC information systems are reviewed to understand the suitability of STEP-NC for web manufacturing. Present work also deals with the development of an adaptor which imports STEP-NC file, organizes its information, allowing modifications to entity values and finally generates a new STEP-NC file to export. The system is designed and developed to work on web to avail additional benefits through the web and also to be part of a proposed ‘Web based STEP-NC manufacturing platform’ which is under development and explained as future scope.

Inherent and antigen-induced airway hyperreactivity in NC mice

OpenAIRE

Tetsuto Kobayashi; Toru Miura; Tomoko Haba; Miyuki Sato; Masao Takei; Isao Serizawa

1999-01-01

In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those st...

SMART VEHICLE PARKING

OpenAIRE

S.Bharath Ram

2016-01-01

The goal of this project is to count the number of empty car parking areas and to display them in a Website. This system consists of sensors attached to several parking areas. These sensors located in different parking area’s detects the presence of vehicle and sends information to Microcontroller, which calculates the number of available empty parking areas and uploads them in a website. This basically works on the principle of Internet of Things here the sensors are connected to internet.

Capacity Analysis Of Parking Lot And Volume Of Vehicle Toward Sustainable Parking Convenience

Science.gov (United States)

Herdiansyah, Herdis; Sugiyanto; Guntur Octavianto, Andrew; Guntur Aritonang, Edison; Nova Imaduddin, Malya; Dedi; Rilaningrum, Magfira

2017-10-01

The development of human's population is having effect on the increase of facilities and transportation needs. One of the primary problems is the availability of parking area. This has occurred in Universitas Indonesia (UI), mainly in Salemba Campus. The availability of land is not as equal as the number of vehicles, which are to be parked, that is why the convenience of students, lecturers and employees at UI is unsatisfactory. The purpose of this paper is to know the level of parking convenience that is affected by the capacity of parking lots and the volume of vehicles in UI Salemba Campus. The results of this research indicate Salemba campus's parking index. The motor index is still in the category of medium (index 0.945) and the car parking index has less category with a parking index 0.485. While with the location of research object being behind the UI Salemba campus, the results obtained were both the motor and the car are still in the category of “enough” with the parking index of, that is 0.657 for the motor and 0.777 for the car. So theoretically, the parking management at Salemba Campus is in an unsustainable parking degree because, if there is no long-term solution, it will increase congestion in the surrounding area and intensify the dissatisfaction of existing parking users.

On pseudorandom generators in NC⁰

DEFF Research Database (Denmark)

Cryan, Mary; Miltersen, Peter Bro

2001-01-01

In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch ...

78 FR 54413 - Proposed Establishment of Class E Airspace; Star, NC

Science.gov (United States)

2013-09-04

...-0440; Airspace Docket No. 13-ASO-10] Proposed Establishment of Class E Airspace; Star, NC AGENCY... action proposes to establish Class E Airspace at Star, NC, to accommodate a new Area Navigation (RNAV... establish Class E airspace at Star, NC, providing the controlled airspace required to support the new RNAV...

IMPORTANT INFORMATION - Flagstaff Car-Park and Park-and-Ride (P+R)

CERN Document Server

GS Department

2011-01-01

As part of the new arrangements following the arrival of the tram-line at CERN, an Automatic Number-Plate Recognition (ANPR) system has been installed restricting access to the Flagstaff Car-park and the Park-and-Ride (P+R) zone according to the conditions set out below: Holders of a valid P+R user card may enter the car-park at all hours but may only park in the area specifically designated as the P+R zone. P+R user cards can be purchased from the Fondation des Parkings de Genève (http://www.ge.ch/parkings/abonnements.html)   Members of CERN personnel and of contractors' personnel, whatever their status, may freely access the Flagstaff Car-Park at all hours, as long as their vehicle is duly registered with CERN, but they may not use the P+R zone, which is reserved for holders of P+R user cards. Please check that your vehicle number-plates are properly registered via AdaMS (http://cern.ch/adams). If this is not the case, the following action must be taken: - for private or co...

Role of Ca ++ Influx via Epidermal TRP Ion Channels

Science.gov (United States)

2016-10-01

the North Carolina Biotechnology Center (NCBC), and by the Harrington Discovery Institute of University Hospitals in Cleveland OH. 7   The...widely read forum on Pain Medicine in the US and in English-speaking countries. http://www.painmedicinenews.com/Science-Technology/Article/08-16/Study...University, Durham NC USA. 2Dept of Medicine , Duke University, Durham NC USA. 3Dept of Chemistry, Duke University, Durham NC USA. 4Dept of Neurobiology

Health museums or theme parks: a new approach to intersectoral collaboration.

Science.gov (United States)

Seymour, H; Ashton, J; Edwards, P

1986-01-01

This paper is an outline of a proposed initiative on intersectoral collaboration in health promotion--collaboration between health, tourist, cultural and entertainment sectors to provide a powerful mass educational experience about the human mind and body. There has been a recent rise in interest in using the technology of museums, science centres, exploratories and theme parks for the promotion of health. This revival is shown to have a historical tradition in the health education museum started in this century in Europe 75 years ago at the Deutsches Hygiene Museum and then spreading to the USA. The proposed Body, Mind, City Museum planned for Liverpool acts as a future model for a new type of health Museum; a mixture of science exploratorium and a Walt Disney-style them park. It is intended that "hand-on" exhibits using interactive video, computers, games and experiences will be used to test people's own capacities or to describe biological functions or processes. This will be combined with park rides and simulations with their inherent appeal of fun, movement and surprise, for example the ride through the blood vessels and the "walk-through brain". This type of venture has a number of special features and advantages; it is truly intersectoral, it may be self-financing, and it can provide a mass audience with a powerful individual experience.

APPLICATIONS OF A MODEL FOR THE HORMONAL REGULATION OF THE MENSTRUAL CYCLE

Science.gov (United States)

APPLICATIONS OF A MODEL FOR THE HORMONAL REGULATION OF THE MENSTRUAL CYCLE. Leona H. Clark1, Paul M. Schlosser2, and James F. Selgrade3. 1US Environmental Protection Agency, ORD, NHEERL, ETD, Research Triangle Park, NC; 2CIIT, Research Triangle Park, NC; 3North Carolina State Un...

76 FR 7225 - National Institute of Environmental Health Sciences; Notice of Meetings

Science.gov (United States)

2011-02-09

... Environmental Health Sciences; Notice of Meetings Pursuant to section 10(a) of the Federal Advisory Committee..., National Institute of Environmental Health Sciences, 615 Davis Dr., KEY615/3112, Research Triangle Park, NC..., National Institute of Environmental Health Sciences, 615 Davis Dr., KEY615/3112, Research Triangle Park, NC...

Perceived Health Benefits and Willingness to Pay for Parks by Park Users: Quantitative and Qualitative Research

Directory of Open Access Journals (Sweden)

Claire Henderson-Wilson

2017-05-01

Full Text Available Whilst a growing body of evidence demonstrates people derive a range of health and wellbeing benefits from visiting parks, only a limited number of attempts have been made to provide a complementary economic assessment of parks. The aim of this exploratory study was to directly estimate the perceived health and wellbeing benefits attained from parks and the economic value assigned to parks by park users in Victoria, Australia. The research employed a mixed methods approach (survey and interviews to collect primary data from a selection of 140 park users: 100 from two metropolitan parks in Melbourne and 40 from a park on the urban fringe of Melbourne, Victoria. Our findings suggest that park users derive a range of perceived physical, mental/spiritual, and social health benefits, but park use was predominantly associated with physical health benefits. Overall, our exploratory study findings suggest that park users are willing to pay for parks, as they highly value them as places for exercising, socialising, and relaxing. Importantly, most people would miss parks if they did not exist. The findings aim to provide park managers, public health advocates, and urban policy makers with evidence about the perceived health and wellbeing benefits of park usage and the economic value park visitors place on parks.

Are TODs Over-Parked?

OpenAIRE

Cervero, Robert; Adkins, Arlie; Sullivan, Cathleen

2009-01-01

This study empirically investigates the proposition that TOD, and specifically housing near suburban rail stops, is “over-parked†in the U.S. This is done by comparing parking generation rates for 31 housing complexes near rail stops in the San Francisco Bay Area and Portland, Oregon with on-site parking supplies and with ITE parking generation rates. Factors that explain parking demand for transit-oriented housing are also investigated, both statistically and through case analyses. The re...

Characterizing ncRNAs in human pathogenic protists using high-throughput sequencing technology

Directory of Open Access Journals (Sweden)

Lesley Joan Collins

2011-12-01

Full Text Available ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, snoRNAs and long ncRNAs on a genomic scale making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases.

Characterizing ncRNAs in Human Pathogenic Protists Using High-Throughput Sequencing Technology

Science.gov (United States)

Collins, Lesley Joan

2011-01-01

ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses, and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, small nucleolar RNAs (snoRNAs), and long ncRNAs on a genomic scale, making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational, and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases. PMID:22303390

Bark in the Park: A Review of Domestic Dogs in Parks

Science.gov (United States)

Weston, Michael A.; Fitzsimons, James A.; Wescott, Geoffrey; Miller, Kelly K.; Ekanayake, Kasun B.; Schneider, Thomas

2014-09-01

The presence of domestic dogs Canis familiaris in public open spaces is increasingly controversial. In our review of the literature, we located 133 publications of various types (papers, reports etc.) that examine some aspect of dogs in parks and open spaces (50 % focussed solely on dogs). There has been an exponential growth in the cumulative number of articles ( R 2 = 0.96; 82 % published since 1997); almost all pertain to temperate latitudes (97 %) and most to the northern hemisphere (62 %). Most articles focus on impacts on wildlife (51 %), zoonotic diseases (17 %), and people's perceptions regarding dogs (12 %). Articles mostly describe problems associated with dogs, while reports of low compliance with dog regulations are common. We outline six major findings regarding dogs in parks: (1) there is a paucity of information on dogs in parks, particularly in relation to their interactions with wildlife and regarding their management; (2) published studies are mainly restricted to a handful of locations in developed countries; (3) sectors of societies hold different views over the desirability of dogs in parks; (4) the benefits and risks of dogs to humans and park values are poorly documented and known; (5) dogs represent a notable disease risk in some but not all countries; and (6) coastal parks are over-represented in the literature in terms of potential negative impacts. Park managers globally require better information to achieve conservation outcomes from dog management in parks.

Using the Theory of Games to Modelling the Equipment and Prices of Car Parking

Science.gov (United States)

Parkitny, Waldemar

2017-10-01

center. There were assumed that from the city’s point of view it is one rival, independently on the actual ownership of private car parks on whose strategy of acting the city do not have an influence. It is consistent with the basic foundations of the game theory. Both players compete for consumers - drivers using car parks, with such parameters like: price, distance from the destination, car parks’ equipment. The built model allows to indicate the best strategy. Knowing that strategy, one can form prices and equipment of car parks. That model may be used by municipal governments and companies which administer car parks. However, one should remember about limitations, which occur in reality, e.g. law restrictions referring to maximum prices for parking. The increasing pressure of cities’ authorities in Poland for changing those regulations, and examples of such solutions received, e.g. in USA, which concern varying prices for parking according to the demand on different car parks, and different hours, permit to have hopes, that the proposed model will be possible to use practically, soon.

Park Forest (L5) and the asteroidal source of shocked L chondrites

Science.gov (United States)

Meier, Matthias M. M.; Welten, Kees C.; Riebe, My E. I.; Caffee, Marc W.; Gritsevich, Maria; Maden, Colin; Busemann, Henner

2017-08-01

The Park Forest (L5) meteorite fell in a suburb of Chicago, Illinois (USA) on March 26, 2003. It is one of the currently 25 meteorites for which photographic documentation of the fireball enabled the reconstruction of the meteoroid orbit. The combination of orbits with pre-atmospheric sizes, cosmic-ray exposure (CRE), and radiogenic gas retention ages ("cosmic histories") is significant because they can be used to constrain the meteoroid's "birth region," and test models of meteoroid delivery. Using He, Ne, Ar, 10Be, and 26Al, as well as a dynamical model, we show that the Park Forest meteoroid had a pre-atmospheric size close to 180 g cm-2, 0-40% porosity, and a pre-atmospheric mass range of 2-6 tons. It has a CRE age of 14 ± 2 Ma, and (U, Th)-He and K-Ar ages of 430 ± 90 and 490 ± 70 Ma, respectively. Of the meteorites with photographic orbits, Park Forest is the second (after Novato) that was shocked during the L chondrite parent body (LCPB) break-up event approximately 470 Ma ago. The suggested association of this event with the formation of the Gefion family of asteroids has recently been challenged and we suggest the Ino family as a potential alternative source for the shocked L chondrites. The location of the LCPB break-up event close to the 5:2 resonance also allows us to put some constraints on the possible orbital migration paths of the Park Forest meteoroid.

BASEMAP, MECKLENBURG, NC, USA

Data.gov (United States)

Federal Emergency Management Agency, Department of Homeland Security — FEMA Framework Basemap datasets comprise six of the seven FGDC themes of geospatial data that are used by most GIS applications (Note: the seventh framework theme,...

Conditions for the management of carrying capacity in the parks of Parks&Benefits

DEFF Research Database (Denmark)

Brandt, Jesper; Holmes, Esbern

2011-01-01

Growth in the number of visitors is an upcoming problem in nature parks. Nature parks are at the same time facing increasing demand, falling public appropriations and receding focus on their conservation functions. To ensure a balancing of nature protection and economic utilization the concept...... stakeholders, balancing use and protection preferably based on scientific and/or experiential cognition. The conditions for the management of carrying capacity for the 8 nature parks in the EC Baltic Project Parks&Benefits are analysed in the report. 1. Part focus on the methodology, concentrated...... on the comparison of the common conditions related to the international nature protection obligations in the parks, primarily expressed through the management under the EU Natura2000-program. In part 2, a comparison of the 8 parks concerning extent, land use composition, population in and around the park...

Exploration of Science Parks

Institute of Scientific and Technical Information of China (English)

Xiong Huibing; Sun Nengli

2005-01-01

Science parks have developed gready in the world, whereas empirical researches have showed that science parks based on linear model cannot guarantee the creation of innovation. Hi-tech innovation is derived from flow and management of information. The commercial and social interactions between in-parks and off-park firms and research institutions act as the key determinant for innovation.Industrial clustering is the rational choice for further developing Chinese science parks and solving some problems such as the lack of dear major industries and strong innovation sense, etc.

Parking management : strategies, evaluation and planning

International Nuclear Information System (INIS)

Litman, T.A.

2006-01-01

Parking facilities are a major cost to society. Current planning practices are based on the assumption that parking should be abundant and provided free, with costs borne indirectly. This report examined parking management strategies related to integrated parking plans. Problems with current parking planning practices were reviewed. The costs of parking facilities were examined, as well as the savings that can accrue from improved management techniques. Strategies included shared parking; remote parking and shuttle services; walking and cycling improvements; improved enforcement and control; and increasing the capacity of existing parking facilities. Parking pricing methods, financial incentives and parking tax reforms were reviewed. Issues concerning user information and marketing were examined. Overflow parking plans were evaluated. Three illustrative examples of parking management programs were outlined, along with details of implementation, planning and evaluation procedures. It was concluded that cost-effective parking management programs can often reduce parking requirements by 20 to 40 per cent compared with conventional planning requirements, in addition to providing economic, social and environmental benefits. 32 refs., 7 tabs., 3 figs

Correspondence of perceived vs. objective proximity to parks and their relationship to park-based physical activity

Directory of Open Access Journals (Sweden)

Kaczynski Andrew T

2009-08-01

Full Text Available Abstract Background Parks are key environmental resources for encouraging population-level physical activity (PA. In measuring availability of parks, studies have employed both self-reported and objective indicators of proximity, with little correspondence observed between these two types of measures. However, little research has examined how the degree of correspondence between self-reported and objectively-measured distance to parks is influenced by individual, neighborhood, and park-related variables, or which type of measure is more strongly related to physical activity outcomes. Methods We used data from 574 respondents who reported the distance to their closest park and compared this with objective measurements of proximity to the closest park. Both indicators were dichotomized as having or not having a park within 750 m. Audits of all park features within this distance were also conducted and other personal characteristics and neighborhood context variables (safety, connectedness, aesthetics were gleaned from participants' survey responses. Participants also completed detailed seven-day PA log booklets from which measures of neighborhood-based and park-based PA were derived. Results Agreement was poor in that only 18% of respondents achieved a match between perceived and objective proximity to the closest park (kappa = 0.01. Agreement was higher among certain subgroups, especially those who reported engaging in at least some park-based PA. As well, respondents with a greater number of parks nearby, whose closest park had more features, and whose closest park contained a playground or wooded area were more likely to achieve a match. Having a ball diamond or soccer field in the closest park was negatively related to achieving a match between perceived and objective proximity. Finally, engaging in at least some park-based PA was not related to either perceived or objective proximity to a park, but was more likely when a match between and

The baryon vector current in the combined chiral and 1/Nc expansions

Energy Technology Data Exchange (ETDEWEB)

Flores-Mendieta, Ruben; Goity, Jose L [JLAB

2014-12-01

The baryon vector current is computed at one-loop order in large-Nc baryon chiral perturbation theory, where Nc is the number of colors. Loop graphs with octet and decuplet intermediate states are systematically incorporated into the analysis and the effects of the decuplet-octet mass difference and SU(3) flavor symmetry breaking are accounted for. There are large-Nc cancellations between different one-loop graphs as a consequence of the large-Nc spin-flavor symmetry of QCD baryons. The results are compared against the available experimental data through several fits in order to extract information about the unknown parameters. The large-Nc baryon chiral perturbation theory predictions are in very good agreement both with the expectations from the 1/Nc expansion and with the experimental data. The effect of SU(3) flavor symmetry breaking for the |Delta S|=1 vector current form factors f1(0) results in a reduction by a few percent with respect to the corresponding SU(3) symmetric values.

33 CFR 110.170 - Lockwoods Folly Inlet, N.C.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lockwoods Folly Inlet, N.C. 110.170 Section 110.170 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.170 Lockwoods Folly Inlet, N.C. (a) Explosives...

Parking taxes : evaluating options and impacts

International Nuclear Information System (INIS)

Litman, T.A.

2006-01-01

In addition to encouraging the use of alternative modes of transport, parking taxes can help to reduce congestion, air pollution, and urban sprawl. Various types of parking taxes were evaluated in this paper, as well as their impacts on parking supply, prices and travel patterns. Examples of various parking tax programs in major cities in Canada, Europe, the United States and Australia were presented. Parking tax programs were divided into 2 main categories: (1) per-space parking levies which distribute cost burdens and encourage property owners to manage parking supply more efficiently and (2) commercial parking taxes on parking rental transactions which discourage the pricing of parking and concentrate impacts in limited areas. Worksite parking levies were discussed, as well stormwater fees and employee parking as a taxable benefit. Typical parking facility financial costs were reviewed and best practices for structuring and implementing parking taxes to increase public acceptability were outlined. It was suggested that the tax base should be broad and well-defined. Local governments should increase parking prices to market rates before imposing special parking taxes, and taxes and fees should be structured to avoid undesirable land use. Parking tax reforms should be part of an overall parking and mobility management program. Stakeholders should be consulted to insure that regulations, administrative procedures and enforcement policies are efficient and fair. The establishment of an evaluation program to determine tax impacts on parking supply and pricing, economic activity, traffic and spillover problems was also recommended. 42 refs., 4 tabs., 1 fig

The on-street parking premium and car drivers' choice between street and garage parking

NARCIS (Netherlands)

Kobus, M.B.W.; Gutierrez Puigarnau, E.; Rietveld, P.; van Ommeren, J.N.

2013-01-01

We introduce a methodology to estimate the effect of parking prices on car drivers' choice between street and garage parking. Our key identifying assumption is that the marginal benefit of parking duration does not depend on this choice. The endogeneity of parking duration is acknowledged in the

Sulphur and oxygen sequestration of n-C 37 and n-C 38 unsaturated ketones in an immature kerogen and the release of their carbon skeletons during early stages of thermal maturation

Science.gov (United States)

Koopmans, Martin P.; Schaeffer-Reiss, Christine; de Leeuw, Jan W.; Lewan, Michael D.; Maxwell, James R.; Schaeffer, Philippe; Sinninghe Damsté, Jaap S.

1997-06-01

Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature ( Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330°C for 72 h to study the diagenetic fate of n-C 37 and n-C 38 di- and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260°C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S- and O-bound n-C 37 and n-C 38 skeletons, saturated n-C 37 and n-C38 methyl, ethyl, and mid-chain ketones, C 37 and C 38 mid-chain 2,5-di- n-alkylthiophenes, C 37 and C 38 1,2-di- n-alkylbenzenes, and C 37 and C 38n-alkanes. With increasing thermal maturation, three forms of the n-C 37 and n-C 38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di- n-alkylbenzenes and saturated ketones), whereas the S- and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C 37 and n-C 38 skeleton can be expected as well as the corresponding hydrocarbons.

Sulphur and oxygen sequestration of n-C37 and n-C38 unsaturated ketones in an immature kerogen and the release of their carbon skeletons during early stages of thermal maturation

Science.gov (United States)

Koopmans, M.P.; Schaeffer-Reiss, C.; De Leeuw, J. W.; Lewan, M.D.; Maxwell, J.R.; Schaeffer, P.; Sinninghe, Damste J.S.

1997-01-01

Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature (Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330??C for 72 h to study the diagenetic fate of n-C37 and n-C38 di-and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260??C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S-and O-bound n-C37 and n-C38 skeletons, saturated n-C37 and n-C38 methyl, ethyl, and mid-chain ketones, C37 and C38 mid-chain 2,5-di-n-alkylthiophenes, C37 and C38 1,2-di-n-alkylbenzenes, and C37 and C38 n-alkanes. With increasing thermal maturation, three forms of the n-C37 and n-C38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di-n-alkylbenzenes and saturated ketones), whereas the S-and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C37 and n-C38 skeleton can be expected as well as the corresponding hydrocarbons. Copyright ?? 1997 Elsevier Science Ltd.

Semi-automatic parking slot marking recognition for intelligent parking assist systems

Directory of Open Access Journals (Sweden)

Ho Gi Jung

2014-01-01

Full Text Available This paper proposes a semi-automatic parking slot marking-based target position designation method for parking assist systems in cases where the parking slot markings are of a rectangular type, and its efficient implementation for real-time operation. After the driver observes a rearview image captured by a rearward camera installed at the rear of the vehicle through a touchscreen-based human machine interface, a target parking position is designated by touching the inside of a parking slot. To ensure the proposed method operates in real-time in an embedded environment, access of the bird's-eye view image is made efficient: image-wise batch transformation is replaced with pixel-wise instantaneous transformation. The proposed method showed a 95.5% recognition rate in 378 test cases with 63 test images. Additionally, experiments confirmed that the pixel-wise instantaneous transformation reduced execution time by 92%.

Smart Parking Management Field Test: A Bay Area Rapid Transit (BART) District Parking Demonstration

OpenAIRE

Shaheen, Susan

2005-01-01

In almost every major city in the U.S. and internationally, parking problems are ubiquitous. It is well known that the limited availability of parking contributes to roadway congestion, air pollution, and driver frustration and that the cost of expanding traditional parking capacity is frequently prohibitive. However, less research has addressed the effect of insufficient parking at transit stations on transit use. In the San Francisco Bay Area, parking has recently been at or near capacity a...

A Cross-Sectional Investigation of the Importance of Park Features for Promoting Regular Physical Activity in Parks.

Science.gov (United States)

Costigan, Sarah A; Veitch, Jenny; Crawford, David; Carver, Alison; Timperio, Anna

2017-11-02

Parks in the US and Australia are generally underutilised, and park visitors typically engage in low levels of physical activity (PA). Better understanding park features that may encourage visitors to be active is important. This study examined the perceived importance of park features for encouraging park-based PA and examined differences by sex, age, parental-status and participation in PA. Cross-sectional surveys were completed by local residents ( n = 2775) living near two parks (2013/2015). Demographic variables, park visitation and leisure-time PA were self-reported, respondents rated the importance of 20 park features for encouraging park-based PA in the next fortnight. Chi-square tests of independence examined differences in importance of park features for PA among sub-groups of local residents (sex, age, parental-status, PA). Park features ranked most important for park-based PA were: well maintained (96.2%), feel safe (95.4%), relaxing atmosphere (91.2%), easy to get to (91.7%), and shady trees (90.3%). All subgroups ranked 'well maintained' as most important. Natural and built environment features of parks are important for promoting adults' park-based PA, and should be considered in park (re)design.

Using Ecological Indicators and a Decision Support System for Integrated Ecological Assessment at Two National Park Units in the Mid-Atlantic Region, USA

Science.gov (United States)

Mahan, Carolyn G.; Young, John A.; Miller, Bruce J.; Saunders, Michael C.

2015-02-01

We implemented an integrated ecological assessment using a GIS-based decision support system model for Upper Delaware Scenic and Recreational River (UPDE) and Delaware Water Gap National Recreation Area (DEWA)—national park units with the mid-Atlantic region of the United States. Our assessment examined a variety of aquatic and terrestrial indicators of ecosystem components that reflect the parks' conservation purpose and reference condition. Our assessment compared these indicators to ecological thresholds to determine the condition of park watersheds. Selected indicators included chemical and physical measures of water quality, biologic indicators of water quality, and landscape condition measures. For the chemical and physical measures of water quality, we used a water quality index and each of its nine components to assess the condition of water quality in each watershed. For biologic measures of water quality, we used the Ephemeroptera, Plecoptera, Trichoptera aquatic macroinvertebrate index and, secondarily, the Hilsenhoff aquatic macroinvertebrate index. Finally, for the landscape condition measures of our model, we used percent forest and percent impervious surface. Based on our overall assessment, UPDE and DEWA watersheds had an ecological assessment score of 0.433 on a -1 to 1 fuzzy logic scale. This score indicates that, in general, the natural resource condition within watersheds at these parks is healthy or ecologically unimpaired; however, we had only partial data for many of our indicators. Our model is iterative and new data may be incorporated as they become available. These natural parks are located within a rapidly urbanizing landscape—we recommend that natural resource managers remain vigilant to surrounding land uses that may adversely affect natural resources within the parks.

Improving diabetes medication adherence: successful, scalable interventions

Directory of Open Access Journals (Sweden)

Zullig LL

2015-01-01

Full Text Available Leah L Zullig,1,2 Walid F Gellad,3,4 Jivan Moaddeb,2,5 Matthew J Crowley,1,2 William Shrank,6 Bradi B Granger,7 Christopher B Granger,8 Troy Trygstad,9 Larry Z Liu,10 Hayden B Bosworth1,2,7,11 1Center for Health Services Research in Primary Care, Durham Veterans Affairs Medical Center, Durham, NC, USA; 2Department of Medicine, Duke University, Durham, NC, USA; 3Center for Health Equity Research and Promotion, Pittsburgh Veterans Affairs Medical Center, Pittsburgh, PA, USA; 4Division of General Internal Medicine, University of Pittsburgh, Pittsburgh, PA, USA; 5Institute for Genome Sciences and Policy, Duke University, Durham, NC, USA; 6CVS Caremark Corporation; 7School of Nursing, Duke University, Durham, NC, USA; 8Department of Medicine, Division of Cardiology, Duke University School of Medicine, Durham, NC, USA; 9North Carolina Community Care Networks, Raleigh, NC, USA; 10Pfizer, Inc., and Weill Medical College of Cornell University, New York, NY, USA; 11Department of Psychiatry and Behavioral Sciences, Duke University School of Medicine, Durham, NC, USA Abstract: Effective medications are a cornerstone of prevention and disease treatment, yet only about half of patients take their medications as prescribed, resulting in a common and costly public health challenge for the US healthcare system. Since poor medication adherence is a complex problem with many contributing causes, there is no one universal solution. This paper describes interventions that were not only effective in improving medication adherence among patients with diabetes, but were also potentially scalable (ie, easy to implement to a large population. We identify key characteristics that make these interventions effective and scalable. This information is intended to inform healthcare systems seeking proven, low resource, cost-effective solutions to improve medication adherence. Keywords: medication adherence, diabetes mellitus, chronic disease, dissemination research

Modelling parking behaviour considering heterogeneity

Energy Technology Data Exchange (ETDEWEB)

San Martin, G.A.; Ibeas Portilla, A.; Alonso Oreña, B.; Olio, L. del

2016-07-01

Most of motorized trips in cities of middle and small size are made in public transport and mainly in private vehicle, this has caused a saturation in parking systems of the cities, causing important problems to society, one of the most important problems is high occupancy of public space by parking systems. Thus, is required the estimation of models that reproduce users’ behaviour when they are choosing for parking in cities, to carry out transport policies to improve transport efficiency and parking systems in the cities. The aim of this paper is the specification and estimation of models that simulate users’ behaviour when they are choosing among alternatives of parking that there are in the city: free on street parking, paid on street parking, paid on underground parking and Park and Ride (now there isn´t). For this purpose, is proposed a multinomial logit model that consider systematic and random variations in tastes. Data of users’ behaviour from the different alternatives of parking have been obtained with a stated preference surveys campaign which have been done in May 2015 in the principal parking zones of the city of Santander. In this paper, we provide a number of improvements to previously developed methodologies because of we consider much more realism to create the scenarios stated preference survey, obtaining better adjustments. (Author)

Impacts of national parks on tourism: a case study from a prominent alpine national park

International Nuclear Information System (INIS)

Getzner, M.

2008-01-01

National parks and other categories of protected areas are often assumed to enhance regional economic development due to park tourism. The current study attempts to estimate the impact of the Hohe Tauern national park (Austria) on tourism by exploring whether and to what extent the national park may have had an influence on tourism development. For most national park communities, the results suggest that the establishment of the national park had some impact by enforcing an already positive trend or by weakening or reversing a negative trend of tourism. However, breakpoint tests exhibit turning points up to several years after the establishment of the park, indicating that taking a national park as the basis for tourism development is a medium to long term development strategy. In the short term, the impact of a national park on tourism is not measurable. Tourism increased by 1 to 3% annually after the breakpoint, indicating that the establishment of a national park has to be incorporated into the tourism and development strategy of a region right from the start. The causal relationship between the establishment of the national park and tourism development may be weak, in particular in communities where the difference between the actual and the forecast numbers of overnight stays is small. Marketing national park tourism and building up a brand or distinctive label may therefore contribute to regional development particularly in the long term. [it

Parking Spoorzone Delft : Addressing expected parking challenges 2015-2017

NARCIS (Netherlands)

Piccot, C.; Groenendijk, L.; Rot, M.; Van der Meijs, P.; Rakers, T.; Negenborn, R.R.; Annema, J.A.; Pel, A.; Vleugel, J.

2014-01-01

This project is carried out on request of the BVOW, the interest group of the neighbourhoods Olofsbuurt and Westerkwartier in Delft, in order to propose solutions for the parking issue of Spoorzone Delft expected between 2015 and 2017. They are worried that parking disturbances will emerge in their

Habitat models to assist plant protection efforts in Shenandoah National Park, Virginia, USA

Science.gov (United States)

Van Manen, F.T.; Young, J.A.; Thatcher, C.A.; Cass, W.B.; Ulrey, C.

2005-01-01

During 2002, the National Park Service initiated a demonstration project to develop science-based law enforcement strategies for the protection of at-risk natural resources, including American ginseng (Panax quinquefolius L.), bloodroot (Sanguinaria canadensis L.), and black cohosh (Cimicifuga racemosa (L.) Nutt. [syn. Actaea racemosa L.]). Harvest pressure on these species is increasing because of the growing herbal remedy market. We developed habitat models for Shenandoah National Park and the northern portion of the Blue Ridge Parkway to determine the distribution of favorable habitats of these three plant species and to demonstrate the use of that information to support plant protection activities. We compiled locations for the three plant species to delineate favorable habitats with a geographic information system (GIS). We mapped potential habitat quality for each species by calculating a multivariate statistic, Mahalanobis distance, based on GIS layers that characterized the topography, land cover, and geology of the plant locations (10-m resolution). We tested model performance with an independent dataset of plant locations, which indicated a significant relationship between Mahalanobis distance values and species occurrence. We also generated null models by examining the distribution of the Mahalanobis distance values had plants been distributed randomly. For all species, the habitat models performed markedly better than their respective null models. We used our models to direct field searches to the most favorable habitats, resulting in a sizeable number of new plant locations (82 ginseng, 73 bloodroot, and 139 black cohosh locations). The odds of finding new plant locations based on the habitat models were 4.5 (black cohosh) to 12.3 (American ginseng) times greater than random searches; thus, the habitat models can be used to improve the efficiency of plant protection efforts, (e.g., marking of plants, law enforcement activities). The field searches also

Insights into the dolomitization process and porosity modification in sucrosic dolostones, Avon Park Formation (Middle Eocene), East-Central Florida, U.S.A.

KAUST Repository

Maliva,, Robert G.

2011-03-01

The Avon Park Formation (middle Eocene) in central Florida, U.S.A., contains shallow-water carbonates that have been replaced by dolomite to varying degrees, ranging from partially replaced limestones, to highly porous sucrosic dolostones, to, less commonly, low-porosity dense dolostones. The relationships between dolomitization and porosity and permeability were studied focusing on three 305-m-long cores taken in the City of Daytona Beach. Stable-isotope data from pure dolostones (mean δ 18O = +3.91% V-PDB) indicate dolomite precipitation in Eocene penesaline pore waters, which would be expected to have been at or above saturation with respect to calcite. Nuclear magnetic log-derived porosity and permeability data indicate that dolomitization did not materially change total porosity values at the bed and formation scale, but did result in a general increase in pore size and an associated substantial increase in permeability compared to limestone precursors. Dolomitization differentially affects the porosity and permeability of carbonate strata on the scale of individual crystals, beds, and formations. At the crystal scale, dolomitization occurs in a volume-for-volume manner in which the space occupied by the former porous calcium carbonate is replaced by a solid dolomite crystal with an associated reduction in porosity. Dolomite crystal precipitation was principally responsible for calcite dissolution both at the actual site of dolomite crystal growth and in the adjoining rock mass. Carbonate is passively scavenged from the formation, which results in no significant porosity change at the formation scale. Moldic pores after allochems formed mainly in beds that experienced high degrees of dolomitization, which demonstrates the intimate association of the dolomitization process with carbonate dissolution. The model of force of crystallization-controlled replacement provides a plausible explanation for key observations concerning the dolomitization process in the

Insights into the dolomitization process and porosity modification in sucrosic dolostones, Avon Park Formation (Middle Eocene), East-Central Florida, U.S.A.

KAUST Repository

Maliva,, Robert G.; Budd, David A.; Clayton, Edward A.; Missimer, Thomas M.; Dickson, John Anthony D

2011-01-01

The Avon Park Formation (middle Eocene) in central Florida, U.S.A., contains shallow-water carbonates that have been replaced by dolomite to varying degrees, ranging from partially replaced limestones, to highly porous sucrosic dolostones, to, less commonly, low-porosity dense dolostones. The relationships between dolomitization and porosity and permeability were studied focusing on three 305-m-long cores taken in the City of Daytona Beach. Stable-isotope data from pure dolostones (mean δ 18O = +3.91% V-PDB) indicate dolomite precipitation in Eocene penesaline pore waters, which would be expected to have been at or above saturation with respect to calcite. Nuclear magnetic log-derived porosity and permeability data indicate that dolomitization did not materially change total porosity values at the bed and formation scale, but did result in a general increase in pore size and an associated substantial increase in permeability compared to limestone precursors. Dolomitization differentially affects the porosity and permeability of carbonate strata on the scale of individual crystals, beds, and formations. At the crystal scale, dolomitization occurs in a volume-for-volume manner in which the space occupied by the former porous calcium carbonate is replaced by a solid dolomite crystal with an associated reduction in porosity. Dolomite crystal precipitation was principally responsible for calcite dissolution both at the actual site of dolomite crystal growth and in the adjoining rock mass. Carbonate is passively scavenged from the formation, which results in no significant porosity change at the formation scale. Moldic pores after allochems formed mainly in beds that experienced high degrees of dolomitization, which demonstrates the intimate association of the dolomitization process with carbonate dissolution. The model of force of crystallization-controlled replacement provides a plausible explanation for key observations concerning the dolomitization process in the

Fire-climate-human interactions during the postglacial period at Sunrise Ridge, Mount Rainier National Park, Washington (USA)

Science.gov (United States)

Walsh, Megan K.; Lukens, Michael L.; McCutcheon, Patrick T.; Burtchard, Greg C.

2017-12-01

With the creation of Mount Rainier National Park (MORA) in 1899 came the active management of the park's landscapes and a heavy emphasis on fire suppression. Today, managers at MORA seek to better manage current fire activity; however, this requires an improved understanding of past fire activity on the mountain. In this study high-resolution macroscopic charcoal analysis and pollen analysis of lake sediment records was used to reconstruct the postglacial fire and vegetation history for the Sunrise Ridge area of MORA. Fire activity was lowest during the Late Glacial when vegetation was sparse and climate was cool and dry. Fire activity increased during the early Holocene as the regional climate warmed and dried, and burnable biomass became more abundant. Fire activity continued to increase into the middle Holocene (until ca. 6600 cal yr BP) even as the regional climate became wetter and eventually cooler; the modern-day mesic forest and subalpine meadow landscapes of the park established at this time. Fire activity was generally highest and mean fire return intervals were lowest on Sunrise Ridge during the late Holocene, and are consistent with tree-ring based estimates of fire frequency. The similarity between the Sunrise Ridge and other paleofire records in the Pacific Northwest suggests that broad-scale climatic shifts, such as the retreat of the Cordilleran ice sheet and changes in annual insolation, as well as increased interannual climate variability (i.e., drought) particularly in the middle to late Holocene, were responsible for changes in fire activity during the postglacial period. However, abundant and increasing archaeological evidence from Sunrise Ridge during the middle to late Holocene suggests that humans may have also influenced the landscape at this time. It is likely that fires will continue to increase at MORA as drought becomes a more frequent occurrence in the Pacific Northwest.

Spatial analysis related to the location characteristics of park supply. Case study: Music Park and Pendawa Park, Bandung City, Indonesia

Science.gov (United States)

Malik, A.; Akbar, R.; Maryati, S.; Natalivan, P.

2018-05-01

Public space plays a role in defining the character of a city and is a valuable asset for a city and one of the indicators in assessing whether a city is considered successful or not. In the context of urban sociology, high-quality public spaces with well-maintained environments can improve the quality of the heterogeneous life of urban social communities by creating economic, social, or environmental value-added. Urban societies tend to be heterogeneous, individualistic, and characterized by high competition that often causes conflicts. Another reason for conflicts is the relatively high social differentiation because of the level of religious differences, customs, languages, and sociocultural aspects brought by immigrants from various regions. In the context of space, the city is a system that does not stand alone because internally the city is a unified system of functional activities in it. Meanwhile, externally, the city is influenced by its surrounding environment. As part of the public space, park has an important role in the environmental, aesthetic, recreational, psychological, social, educational, and economic aspects of the city. Public space can be understood as open spaces in urban areas, where everyone regardless their interests and backgrounds can be intersectional and have social contact and serve as an “urban regenerator” including educational functions through innovation and technological intervention. Moreover, park can also absorb carbon dioxide emissions, produce oxygen, improve air and water quality, regulate the microclimate, reduce noise, protect soil and water, and maintain biodiversity. However, many things cause the function of parks to decrease. One reason relates to the distribution of parks related to the characteristics of their location. Research has not seen many studies on the characteristics of locations in the planning of public space. The provision of public space should consider these location characteristics. This study

Interview with Steve Parks

Science.gov (United States)

Hitchcock, Jennifer

2016-01-01

Jennifer Hitchcock interviews community activist and director of Syracuse University's Composition and Cultural Rhetoric doctoral program, Steve Parks. They discuss Parks's working-class background, career path, influences, and activism. Parks also considers the direction of the field of composition and rhetoric and expresses optimism for the…

Automated Car Park Management System

Science.gov (United States)

Fabros, J. P.; Tabañag, D.; Espra, A.; Gerasta, O. J.

2015-06-01

This study aims to develop a prototype for an Automated Car Park Management System that will increase the quality of service of parking lots through the integration of a smart system that assists motorist in finding vacant parking lot. The research was based on implementing an operating system and a monitoring system for parking system without the use of manpower. This will include Parking Guidance and Information System concept which will efficiently assist motorists and ensures the safety of the vehicles and the valuables inside the vehicle. For monitoring, Optical Character Recognition was employed to monitor and put into list all the cars entering the parking area. All parking events in this system are visible via MATLAB GUI which contain time-in, time-out, time consumed information and also the lot number where the car parks. To put into reality, this system has a payment method, and it comes via a coin slot operation to control the exit gate. The Automated Car Park Management System was successfully built by utilizing microcontrollers specifically one PIC18f4550 and two PIC16F84s and one PIC16F628A.

Orlice Nature Park - environmental themes

International Nuclear Information System (INIS)

Hanus, L.

2002-01-01

The aim of this abstract is to outline the main characteristics of Orlice Nature Park and of the procedure of Environmental Impact Assessment (EIA), and to evaluate public interest in the nature park and in nature protection in general. Orlice Nature Park was instituted in 1996. The function of the park is to protect the character of the area of landscape around the River Orlice. Orlice Natural Park covers an area of 115 sq. km. The main environmental risks to the park are: intensive agriculture, forest mono-culture, industry, transport, channel improvement, the building of holiday cottages, sport, and recreation. Among the conflicts of interest in the park are: nature protection, water management, building constrictions, business, fishery, water sports and recreation. During the process of Environmental Impact Assessment in Hradec Kralove, the public voiced its opinion against the building of a supermarket within the grounds of of the nature park. In this case the public showed its interest in the value of nature and landscape, the value of human health and the value of plant species. In general, the public and the local media show an interest in the park only in exceptional circumstances. (author)

Park It!

Science.gov (United States)

Sartorius, Tara Cady

2010-01-01

Many artists visit national parks to draw, paint and take photographs of some of the most amazing scenery on earth. Raw nature is one of the greatest inspirations to an artist, and artists can be credited for helping inspire the government to create the National Park System. This article features Thomas Moran (1837-1926), one of the artists who…

iPark

DEFF Research Database (Denmark)

Yang, Bin; Fantini, Ernesto Nicolas; Jensen, Christian S.

2013-01-01

where the geo-spatial aspect is not just a tag on other content, but is the primary content, e.g., a city street map with up-to-date road construction data. Along these lines, the iPark system aims to turn volumes of GPS data obtained from vehicles into information about the locations of parking spaces...

State Park Trails

Data.gov (United States)

Minnesota Department of Natural Resources — This data set is a collection of ArcView shapefiles (by park) of trails within statutory boundaries of individual MN State Parks, State Recreation Areas and State...

Noise in NC-AFM measurements with significant tip–sample interaction

Directory of Open Access Journals (Sweden)

Jannis Lübbe

2016-12-01

Full Text Available The frequency shift noise in non-contact atomic force microscopy (NC-AFM imaging and spectroscopy consists of thermal noise and detection system noise with an additional contribution from amplitude noise if there are significant tip–sample interactions. The total noise power spectral density DΔf(fm is, however, not just the sum of these noise contributions. Instead its magnitude and spectral characteristics are determined by the strongly non-linear tip–sample interaction, by the coupling between the amplitude and tip–sample distance control loops of the NC-AFM system as well as by the characteristics of the phase locked loop (PLL detector used for frequency demodulation. Here, we measure DΔf(fm for various NC-AFM parameter settings representing realistic measurement conditions and compare experimental data to simulations based on a model of the NC-AFM system that includes the tip–sample interaction. The good agreement between predicted and measured noise spectra confirms that the model covers the relevant noise contributions and interactions. Results yield a general understanding of noise generation and propagation in the NC-AFM and provide a quantitative prediction of noise for given experimental parameters. We derive strategies for noise-optimised imaging and spectroscopy and outline a full optimisation procedure for the instrumentation and control loops.

Pulsars at Parkes

OpenAIRE

Manchester, R. N.

2012-01-01

The first pulsar observations were made at Parkes on March 8, 1968, just 13 days after the publication of the discovery paper by Hewish and Bell. Since then, Parkes has become the world's most successful pulsar search machine, discovering nearly two thirds of the known pulsars, among them many highly significant objects. It has also led the world in pulsar polarisation and timing studies. In this talk I will review the highlights of pulsar work at Parkes from those 1968 observations to about ...

ORF Sequence: NC_002695 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002695 gi|15830145 >gi|15830145|ref|NP_308918.1| putative transmembrane subunit...IFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN

ORF Sequence: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23464690 >gi|23464690|ref|NP_695293.1| hypothetical transmembrane pro...LVQLCAMGFIIGYVIRSNNVWMVFSLMAVMLVAAVQIVMSRARGIPKGLAGPIFLSLVITMLLMLALVTELIVRPHPWYAPQLVVPLTGMLLGNTVSALAVGLSRFYESME

ORF Sequence: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32471017 >gi|32471017|ref|NP_864010.1| hypothetical protein-transmemb...HALISRLRIWGRETLTEMPSWLVSMVVHLTLLLVLALIGRSTSKVGQIELLFRQSSESSSMELAEFTIAAAAPLESFERSMEEERIATTQLVSIDVIDAEAEMFSLVP

ORF Sequence: NC_002942 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002942 gi|52840424 >gi|52840424|ref|YP_094223.1| probable transmembrane protein...EYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIGEVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVAEIELIKPTPAVKYKQTYYHSYPVFPTHNSAEKYTSME

ORF Sequence: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32476407 >gi|32476407|ref|NP_869401.1| hypothetical protein-transmemb...IYPDDRPGWIDQPIVNDGKDYSLVVTAGPSGSMEEADELIGVYARGAVQSYVDELVSEQEWATEPEMIPLDIDWIRDELVVRRYEGVVQVGDEQQFEKAILIRIEPEDKKVFETAIADMKLKERLAATGIVILGGFSLLVGGSIVLGGLASRQKQPTAAA

Parking Space Detection and Trajectory Tracking Control for Vehicle Auto-Parking

OpenAIRE

Shiuh-Jer Huang; Yu-Sheng Hsu

2017-01-01

On-board available parking space detecting system, parking trajectory planning and tracking control mechanism are the key components of vehicle backward auto-parking system. Firstly, pair of ultrasonic sensors is installed on each side of vehicle body surface to detect the relative distance between ego-car and surrounding obstacle. The dimension of a found empty space can be calculated based on vehicle speed and the time history of ultrasonic sensor detecting information. This result can be u...

Correlation between the physical parameters of the i-nc-Si absorber layer grown by 27.12 MHz plasma with the nc-Si solar cell parameters

Science.gov (United States)

Das, Debajyoti; Mondal, Praloy

2017-09-01

Growth of highly conducting nanocrystalline silicon (nc-Si) thin films of optimum crystalline volume fraction, involving dominant crystallographic preferred orientation with simultaneous low fraction of microstructures at a low substrate temperature and high growth rate, is a challenging task for its promising utilization in nc-Si solar cells. Utilizing enhanced electron density and superior ion flux densities of the high frequency (∼27.12 MHz) SiH4 plasma, improved nc-Si films have been produced by simple optimization of H2-dilution, controlling the ion damage and enhancing supply of atomic-hydrogen onto the growing surface. Single junction nc-Si p-i-n solar cells have been prepared with i-nc-Si absorber layer and optimized. The physical parameters of the absorber layer have been systematically correlated to variations of the solar cell parameters. The preferred alignment of crystallites, its contribution to the low recombination losses for conduction of charge carriers along the vertical direction, its spectroscopic correlation with the dominant growth of ultra-nanocrystalline silicon (unc-Si) component and corresponding longer wavelength absorption, especially in the neighborhood of i/n-interface region recognize scientific and technological key issues that pave the ground for imminent advancement of multi-junction silicon solar cells.

ORF Sequence: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39933242 >gi|39933242|ref|NP_945518.1| possible nicotinate-nucleotide adn...WWLVSPGNPLKDISSLREIDARVAAAQAIADDPRIQVSRLEAVIGTRYTADTLRYLRRHCPGARFVWIMGADNLAQFHRWQQWQQIAAEIPIAVIDRPPTSFRALAAPAAQRLMRMRIPNNKAATLADREPPAWVYLTGLKSLVSSTALRNPDGSWKT

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13358092 >gi|13358092|ref|NP_078366.1| cytosine-specific methyltransferase [Ureap...RILFDLQKLNQLPQFLLLENVNNMLSKQHKLDYDMWTKSLKQLGYSTCTFQLNALDYGSAQRRKRVYAISILNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYK

Public parks as urban tourism in Jakarta

Science.gov (United States)

Adiati, M. P.; Lestari, N. S.; Wiastuti, R. D.

2018-03-01

Sustainable urban tourism development should provide better places for people to live in and for people to visit. Jakarta as the capital city has a potential for its urban tourism. Thus, urban tourism attribute such as Public Park should be in high- quality to cope with the needs of urban people and outside visitors. The purpose of this study is to investigate Public Park attributes and to analyze its compliance refer to Public Park that eventually supports sustainable urban tourism. This paper used a qualitative approach. Primary data obtain from direct field observation in seven Public Parks in Jakarta; Menteng Park, Suropati Park, Situ Lembang Park, Ayodhya Park, Cattleya Park, Kodok Park, and Langsat Park. Observation checks list use as guidance. The result provides an assessment of Public Park based on four categories; the accessibility, park activities, safety, and user. The implication of this study offers recommendations to enhance Public Park so that it complies with good public park design- attributes and with the obligations of sustainable urban tourism in Jakarta.

Improvement of Theme Park Marketing Mode:A Case Study of Theme Parks in Chengdu

Institute of Scientific and Technical Information of China (English)

Min; LI; Gaoli; XIONG

2013-01-01

Construction of theme park has been launched since the early 1990s in Chengdu City,but ended up as a losing proposition after its short-term prosperity because of similar scale and similarity with those in other cities.As more international well-known theme parks entering the market,theme parks in Chengdu have been faced with the transition,and novel concepts are also introduced into the operation of these parks.To adapt to the market,it is imperative to make marketing strategies and combine marketing elements.Through analyzing current development of local theme parks and introducing successful marketing modes of domestic and overseas theme parks,a favorable marketing mode for theme parks in Chengdu was defined on the basis of fully exploring Ba-Shu culture(Ba and Shu are two ancient kingdoms in the history of Sichuan).By defining a favorable theme,focusing more on visitors’experience,devoting more in developing new products,adopting flexible price strategies,and integrating advertisement marketing,internet marketing,and other marketing methods,outstanding brands will be formed,and tourism cultures with distinguished features of Chengdu will be created.

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13358063 >gi|13358063|ref|NP_078337.1| hypothetical protein UU500 [Ureap...MGNHTWDHPDIFEILTTKTNIIRPYNIINTHQYHLVGSGSRVFYCNKKMIRVTNLLGNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKL

Black bear density in Glacier National Park, Montana

Science.gov (United States)

Stetz, Jeff B.; Kendall, Katherine C.; Macleod, Amy C.

2013-01-01

We report the first abundance and density estimates for American black bears (Ursus americanus) in Glacier National Park (NP),Montana, USA.We used data from 2 independent and concurrent noninvasive genetic sampling methods—hair traps and bear rubs—collected during 2004 to generate individual black bear encounter histories for use in closed population mark–recapture models. We improved the precision of our abundance estimate by using noninvasive genetic detection events to develop individual-level covariates of sampling effort within the full and one-half mean maximum distance moved (MMDM) from each bear’s estimated activity center to explain capture probability heterogeneity and inform our estimate of the effective sampling area.Models including the one-halfMMDMcovariate received overwhelming Akaike’s Information Criterion support suggesting that buffering our study area by this distance would be more appropriate than no buffer or the full MMDM buffer for estimating the effectively sampled area and thereby density. Our modelaveraged super-population abundance estimate was 603 (95% CI¼522–684) black bears for Glacier NP. Our black bear density estimate (11.4 bears/100 km2, 95% CI¼9.9–13.0) was consistent with published estimates for populations that are sympatric with grizzly bears (U. arctos) and without access to spawning salmonids. Published 2013. This article is a U.S. Government work and is in the public domain in the USA.

Smart parking management and navigation system

KAUST Repository

Saadeldin, Mohamed

2017-11-09

Various examples are provided for smart parking management, which can include navigation. In one example, a system includes a base station controller configured to: receive a wireless signal from a parking controller located at a parking space; determine a received signal strength indicator (RSSI) from the wireless signal; and identify a presence of a vehicle located at the parking space based at least in part on the RSSI. In another example, a method includes receiving a wireless signals from a base station controller and a parking controller located at a parking space; determining RSSIs from the wireless signals; and determining a location of the mobile computing device in a parking facility based at least in part on the RSSIs. In another example, a RSSI can be received, a parking occupancy can be determined using the RSSI, and an electronic record can be updated based on the parking occupancy.

ORF Sequence: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32475512 >gi|32475512|ref|NP_868506.1| hypothetical protein-signal peptide and transme...VLVGLLLPAVQAAREAARRMSCSNNIAQLTLATHNYEFSMEHLPPGTTNPTGPIVNTPNGEHISFLVRLLPYIEQQGTADDFDLTASVYAPANAKVRAYQISAFLCPS

ORF Sequence: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003280 gi|17533935 >gi|17533935|ref|NP_496777.1| ZYXin (zyx-1) [Caenorhabditis elegans] MNQIFHVDC...FAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCGMQLSSKLEGQGCYPIDNHLLCKTCNGNRLRVVSST

A Novel Type of Non-coding RNA, nc886, Implicated in Tumor Sensing and Suppression

Directory of Open Access Journals (Sweden)

Yong Sun Lee

2015-06-01

Full Text Available nc886 (=vtRNA2-1, pre-miR-886, or CBL3 is a newly identified non-coding RNA (ncRNA that represses the activity of protein kinase R (PKR. nc886 is transcribed by RNA polymerase III (Pol III and is intriguingly the first case of a Pol III gene whose expression is silenced by CpG DNA hypermethylation in several types of cancer. PKR is a sensor protein that recognizes evading viruses and induces apoptosis to eliminate infected cells. Like viral infection, nc886 silencing activates PKR and induces apoptosis. Thus, the significance of the nc886:PKR pathway in cancer is to sense and eliminate pre-malignant cells, which is analogous to PKR's role in cellular innate immunity. Beyond this tumor sensing role, nc886 plays a putative tumor suppressor role as supported by experimental evidence. Collectively, nc886 provides a novel example how epigenetic silencing of a ncRNA contributes to tumorigenesis by controlling the activity of its protein ligand.

76 FR 29645 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-05-23

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC. This safety... Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We received no...

76 FR 18669 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-04-05

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

76 FR 38018 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-06-29

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City-Newport River high rise bridge in Carteret County, NC. This safety...) entitled Safety Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We...

76 FR 23227 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-04-26

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

Smart Parking Management Pilot Project: A Bay Area Rapid Transit (BART) District Parking Demonstration

OpenAIRE

Shaheen, Susan; Rodier, Caroline; Eaken, Amanda M.

2005-01-01

This report presents early findings from an application of advanced parking technologies to maximize existing parking capacity at the Rockridge BART station, which was launched in December 2004 in the East San Francisco Bay Area. The smart parking system includes traffic sensors that count the number of vehicles entering and exiting the parking lots at the station. A reservation system allows travelers to reserve spaces by Internet, personal digital assistant (PDA), phone, and cell phone. The...

ORF Sequence: NC_003279 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003279 gi|17507795 >gi|17507795|ref|NP_493043.1| putative protein, with at least 2 transme...YLNIQIADETTDLPVSIDRANVDMRIYRAFEMSMEKDIISLSTSNTSHAEISTPKSRKKKSRKLGLKNLEEVINSKYNSCQKQDNSMSIQ

Elemental and iron isotopic composition of aerosols collected in a parking structure

International Nuclear Information System (INIS)

Majestic, Brian J.; Anbar, Ariel D.; Herckes, Pierre

2009-01-01

The trace metal contents and iron isotope composition of size-resolved aerosols were determined in a parking structure in Tempe, AZ, USA. Particulate matter (PM) 2.5 μm were collected. Several air toxics (e.g., arsenic, cadmium, and antimony) were enriched above the crustal average, implicating automobiles as an important source. Extremely high levels of fine copper (up to 1000 ng m -3 ) were also observed in the parking garage, likely from brake wear. The iron isotope composition of the aerosols were found to be + 0.15 ± 0.03 per mille and + 0.18 ± 0.03 per mille for the PM 2.5 μm fractions, respectively. The similarity of isotope composition indicates a common source for each size fraction. To better understand the source of iron in the parking garage, the elemental composition in four brake pads (two semi-metallic and two ceramic), two tire tread samples, and two waste oil samples were determined. Striking differences in the metallic and ceramic brake pads were observed. The ceramic brake pads contained 10-20% copper by mass, while the metallic brake pads contained about 70% iron, with very little copper. Both waste oil samples contained significant amounts of calcium, phosphorous, and zinc, consistent with the composition of some engine oil additives. Differences in iron isotope composition were observed between the source materials; most notably between the tire tread (average = + 0.02 per mille ) and the ceramic brake linings (average = + 0.65 per mille ). Differences in isotopic composition were also observed between the metallic (average = + 0.18 per mille ) and ceramic brake pads, implying that iron isotope composition may be used to resolve these sources. The iron isotope composition of the metallic brake pads was found to be identical to the aerosols, implying that brake dust is the dominant source of iron in a parking garage.

Alien plant invasion in mixed-grass prairie: effects of vegetation type, stochiasticity, and anthropogenic disturbance in two park units

Science.gov (United States)

Larson, Diane L.; Anderson, Patrick J.; Newton, Wesley E.

2001-01-01

The ability of alien plant species to invade a region depends not only on attributes of the plant, but on characteristics of the habitat being invaded. Here, we examine characteristics that may influence the success of alien plant invasion in mixed-grass prairie at Theodore Roosevelt National Park, in western North Dakota, USA. The park consists of two geographically separate units with similar vegetation types and management history, which allowed us to examine the effects of native vegetation type, anthropogenic disturbance, and the separate park units on the invasion of native plant communities by alien plant species common to counties surrounding both park units. If matters of chance related to availability of propagules and transient establishment opportunities determine the success of invasion, park unit and anthropogenic disturbance should better explain the variation in alien plant frequency. If invasibility is more strongly related to biotic or physical characteristics of the native plant communities, models of alien plant occurrence should include vegetation type as an explanatory variable. We examined >1300 transects across all vegetation types in both units of the park. Akaike's Information Criterion (AIC) indicated that the fully parameterized model, including the interaction among vegetation type, disturbance, and park unit, best described the distribution of both total number of alien plants per transect and frequency of alien plants on transects where they occurred. Although all vegetation types were invaded by alien plants, mesic communities had both greater numbers and higher frequencies of alien plants than did drier communities. A strong element of stochasticity, reflected in differences in frequencies of individual species between the two park units, suggests that prediction of risk of invasion will always involve uncertainty. In addition, despite well-documented associations between anthropogenic disturbance and alien plant invasion, five of

Adapting to the reality of climate change at Glacier National Park, Montana, USA

Science.gov (United States)

Fagre, Daniel B.

2007-01-01

The glaciers of Glacier National Park (GNP) are disappearing rapidly and likely will be gone by 2030. These alpine glaciers have been continuously present for approximately 7,000 years so their loss from GNP in another 25 years underscores the significance of current climate change. There are presently only 27 glaciers remaining of the 150 estimated to have existed when GNP was created in 1910. Mean annual temperature in GNP has increased 1.6 0 C during the past cen- tury, three times the global mean increase. The temperature increase has affected other parts of the mountain ecosystem, too. Snowpacks hold less water equivalent and melt 2+ weeks earlier in the spring. Forest growth rates have increased, alpine treelines have expanded upward and be- come denser, and subalpine meadows have been invaded by high elevation tree species. These latter responses can be mostly attributed to longer growing seasons and warmer temperatures.

SCIENCE AND TECHNOLOGY PARKS

Directory of Open Access Journals (Sweden)

Miroslav Milutinović

2014-04-01

Full Text Available The establishment of science and technology parks is necessarily accompanied by the establishment of a base of professional staff as the foundation of the park and the base of the potential management that will manage the park and the professional staff. Science and Technology Park is a broader term used to describe a variety of attempts directed at enhancing the entrepreneurship development by means of establishing knowledge – based, small and medium-sized enterprises. The enterprise at the top of the technology pyramid receives support in the form of capital, administration, space and access to new information technologies. The overall objective of the development of industrial enterprises in the technology park is the introduction of economically profitable production with the efficient usage of nonrenewable resources and the application of the highest environmental standards. Achieving the primary developmental objective of the Technology Park includes: creating a favorable business atmosphere in the local community, attractive to both foreign and domestic investors – providing support to the establishment of small and medium-sized enterprises using different models of joint ventures and direct foreign investment.

Smart parking management system with decal electronics system

KAUST Repository

Hussain, Muhammad Mustafa; Wicaksono, Irmandy

2017-01-01

Various examples are related to parking management, including identifying and reserving empty parking spaces. In one example, a smart parking space system includes a parking controller located at a parking space. The parking controller can identify a vehicle located at the parking space via an input sensor or a transceiver that initiates wireless communication with an electronic tag associated with the vehicle; and communicate a parking vacancy associated with the parking space to a remote computing device based at least in part on the identification of the vehicle. In another example, a computing device can receive parking vacancy data associated with a parking space from a parking controller; determine a parking vacancy associated with the parking space using the parking vacancy data; and encode for display on a client device a network page that includes an indication of the parking vacancy associated with the parking space.

Smart parking management system with decal electronics system

KAUST Repository

Hussain, Muhammad Mustafa

2017-09-21

Various examples are related to parking management, including identifying and reserving empty parking spaces. In one example, a smart parking space system includes a parking controller located at a parking space. The parking controller can identify a vehicle located at the parking space via an input sensor or a transceiver that initiates wireless communication with an electronic tag associated with the vehicle; and communicate a parking vacancy associated with the parking space to a remote computing device based at least in part on the identification of the vehicle. In another example, a computing device can receive parking vacancy data associated with a parking space from a parking controller; determine a parking vacancy associated with the parking space using the parking vacancy data; and encode for display on a client device a network page that includes an indication of the parking vacancy associated with the parking space.

Understanding parking habits at CERN

CERN Multimedia

Anaïs Schaeffer

2016-01-01

The SMB department is setting up a monitoring system in certain CERN car parks in order to evaluate their occupancy rates and subsequently make them easier to use.    Vehicle registration plate readers (red triangles) are now installed at the entrances and exits of the Le Cèdres car park (in orange) and of the Building 4 and 5 one (in blue). The 2 other car parks (Building 40 in violet and “high-voltage” in green) will be equipped at a later stage. Vehicle registration plate readers are now installed at the entrances and exits of the Les Cèdres car park and of the Building 4 and 5 car park, both on the Meyrin site. The information collected by these readers will allow the occupancy levels of these car parks to be analysed throughout the day, establishing periods of peak usage and the pattern of vehicle movements. “We have been experiencing parking problems at CERN for several years n...

Effects of carboxylic acids on nC60 aggregate formation

International Nuclear Information System (INIS)

Chang Xiaojun; Vikesland, Peter J.

2009-01-01

The discovery that negatively charged aggregates of C 60 fullerene (nC 60 ) are stable in water has raised concerns regarding the potential environmental and health effects of these aggregates. In this work, we show that nC 60 aggregates produced by extended mixing in the presence of environmentally relevant carboxylic acids (acetic acid, tartaric acid, citric acid) have surface charge and morphologic properties that differ from those produced by extended mixing in water alone. In general, aggregates formed in the presence of these acids have a more negative surface charge and are more homogeneous than those produced in water alone. Carboxylic acid identity, solution pH, and sodium ion concentration, which are all intricately coupled, play an important role in setting the measured surface charge. Comparisons between particle sizes determined by analysis of TEM images and those obtained by dynamic light scattering (DLS) indicate that DLS results require careful evaluation when used to describe nC 60 aggregates. - The effects of carboxylic acids on the formation of nC 60 aggregates are discussed

ORF Sequence: NC_003909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003909 gi|42782207 >gi|42782207|ref|NP_979454.1| BclA protein [Bacillus cereus ATCC 10987] MANRLNFTGP...LGCCGISGKTGPTGPTGPTGVTGSTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGP...TGATGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGSTGP

ORF Sequence: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|18407972 >gi|18407972|ref|NP_564823.1| no apical meristem (NAM) famil...y protein [Arabidopsis thaliana] MQAEEIICRVSDEEIIENYLRPKINGETSSIPRYVVELAEELYTVEPWLLPRQTAPILNPGEWFYFGKRNRKYSN

Characterization and properties of acetylated nanocrystalline cellulose (aNC) reinforced polylactic acid (PLA) polymer

Science.gov (United States)

Kasa, Siti Norbaya; Omar, Mohd Firdaus; Ismail, Ismarul Nizam

2017-12-01

Nanocrystalline cellulose (NCC) was synthesized from banana stem through strong acid hydrolysis with measured length of approximately 287.0 ± 56.4 nm and diameter of 26.6 ± 4.8 nm. Modification of NCC was carried by acetylation reaction in order to increase the compatibility during reinforcement with polylactic acid (PLA) polymer. The reinforcing effect towards morphology, crystallinity, mechanical and thermal properties of bio-nanocomposites was investigated. Scanning Electron Microscope (SEM) micrograph reveals the uniform dispersion achieved at 1 %, 3 % and 5% aNC loading while agglomeration was found at 7 % aNC loading. Disappearance of crystallinity peak at 2θ = 22.7⁰ for low aNC loading during elemental analysis using X-Ray Diffraction (XRD) indicates the proper dispersion of aNC in PLA polymer. From the tensile test, 1 % aNC loading gives the highest mechanical properties of bio-nanocomposite film with 82.71 %, 118.7 % and 24.18 % increment in tensile strength, tensile modulus and elongation at break. However, 7 % aNC loading gives the highest increment in TGA of aNC-PLA nanocomposites which is from 310 °C to 320 °C.

The Open Space Sculptures Used in the Gençlik Park towards Visual Perception of Park Users

Directory of Open Access Journals (Sweden)

Ahmet Polat

2012-11-01

Full Text Available Urban parks are the most important areas that allow recreational activities in our towns. Increasing the visual quality of urban parks provides positive impacts on urban quality. Besides the artistic and technical features of open space sculptures which are used for urban park designs are the visual perceptions and preferences of park users are also important. In the context of this study, six sculptures in Gençlik Park which is in the boundaries Ankara have been considered. The aim of the study, to measure the visual quality of the sculptures in the urban parks through park users and to reveal the relationship between visual landscape indicators (of being interesting, coherence, complexity, meaningfulness, and mystery and the visual quality. For this purpose, the six pieces in Ankara Youth Park of sculpture were evaluated the scope of research. According to the results of the study; it was realized that park users like sculptures visually. A statistically significant relationship was found between the visual quality of the sculptures and some landscape indicators (to be interesting, mystery and harmony. In addition to these, some suggestions were made regarding the use of sculptures in urban parks.

A Survey of Intelligent Car Parking System

OpenAIRE

Faheem; S.A. Mahmud; G.M. Khan; M. Rahman; H. Zafar

2013-01-01

The industrialization of the world, increase in population, slow paced city development and mismanagement of the available parking space has resulted in parking related problems. There is a dire need for a secure, intelligent, efficient and reliable system which can be used for searching the unoccupied parking facility, guidance towards the parking facility, negotiation of the parking fee, along with the proper management of the parking facility. Intelligent Parking Service is a part of Intel...

Parking Space Verification

DEFF Research Database (Denmark)

Høg Peter Jensen, Troels; Thomsen Schmidt, Helge; Dyremose Bodin, Niels

2018-01-01

system, based on a Convolutional Neural Network, that is capable of determining if a parking space is occupied or not. A benchmark database consisting of images captured from different parking areas, under different weather and illumination conditions, has been used to train and test the system...

Configuration study of large wind parks

Energy Technology Data Exchange (ETDEWEB)

Lundberg, Stefan

2003-07-01

In this thesis, layouts of various large-scale wind parks, using both AC as well as DC, are investigated. Loss modelling of the wind park components as well as calculations of the energy capture of the turbines using various electrical systems are performed, and the energy production cost of the various park configurations is determined. The most interesting candidate for a DC transmission based wind park was investigated more in detail, the series DC wind park. Finally, the power quality impact in the PCC (point of common coupling) was studied. It was found that from an energy capture point of view, the difference in energy production between various wind turbine systems is very small. Of all the investigated wind park configurations, the wind park with the series connected DC wind turbines seems to have the best potential to give the lowest energy production cost, if the transmission distance is longer then 10-20 km. Regarding the series DC wind park it was found that it is the most difficult one to control. However, a control algorithm for the series park and its turbines was derived and successfully tested. Still, several more details regarding the control of the series wind park has to be dealt with.

Design and Investigation of SST/nc-Si:H/M (M = Ag, Au, Ni and M/nc-Si:H/M Multifunctional Devices

Directory of Open Access Journals (Sweden)

A. F. Qasrawi

2013-01-01

Full Text Available Hydrogenated nanocrystalline Silicon thin films prepared by the very high frequency chemical vapor deposition technique (VHF-CVD on stainless steel (SST substrates are used to design Schottky point contact barriers for the purpose of solar energy conversion and passive electronic component applications. In this process, the contact performance between SST and M (M = Ag, Au, and Ni and between Ag, Au, and Ni electrodes was characterized by means of current-voltage, capacitance-voltage, and light intensity dependence of short circuit ( current and open circuit voltage ( of the contacts. Particularly, the devices ideality factors, barrier heights were evaluated by the Schottky method and compared to the Cheung's. Best Schottky device performance with lowest ideality factor suitable for electronic applications was observed in the SST/nc-Si:H/Ag structure. This device reflects a of 229 mV with an of 1.6 mA/cm2 under an illumination intensity of ~40 klux. On the other hand, the highest being 9.0 mA/cm2 and the of 53.1 mV were observed for Ni/nc-Si:H/Au structure. As these voltages represent the maximum biasing voltage for some of the designed devices, the SST/nc-Si:H/M and M/nc-Si:H/M can be regarded as multifunctional self-energy that provided electronic devices suitable for active or passive applications.

SmartPark Technology Demonstration Project

Science.gov (United States)

2013-11-01

The purpose of FMCSAs SmartPark initiative is to determine the feasibility of a technology for providing truck parking space availability in real time to truckers on the road. SmartPark consists of two phases. Phase I was a field operational test ...

EnviroAtlas - Durham, NC - Demo (Parent)

Data.gov (United States)

U.S. Environmental Protection Agency — This EnviroAtlas dataset is the base layer for the Durham, NC EnviroAtlas Area. The block groups are from the US Census Bureau and are included/excluded based on...

The relevance of social contexts and social action in reducing substance use and victimization among women participating in an HIV prevention intervention in Cape Town, South Africa

Directory of Open Access Journals (Sweden)

Reed E

2013-06-01

Full Text Available Elizabeth Reed,1 Andrea N Emanuel,2 Bronwyn Myers,3,4 Kim Johnson,3 Wendee M Wechsberg2,5–7 1George Washington University School of Public Health, Department of Prevention and Community Health, Washington, DC, USA; 2RTI International, Research Triangle Park, NC, USA; 3Alcohol and Drug Abuse Research Unit, Medical Research Council, Cape Town, South Africa; 4Department of Psychiatry and Mental Health, University of Cape Town, Cape Town, South Africa; 5Gillings Global School of Public Health, University of North Carolina, Chapel Hill, NC, USA; 6Psychology in the Public Interest, North Carolina State University, NC, USA; 7Psychiatry and Behavioral Sciences, Duke University School of Medicine, NC, USA Objectives: To examine qualitatively how women's social context and community mobilization (eg, mobilizing women to take social action and engaging their community in social change influence substance use abstinence and victimization among women participating in a human immunodeficiency virus (HIV intervention in Cape Town, South Africa. Methods: Thirty women who had participated in a randomized controlled trial of a group-delivered intervention to address substance use, gender-based violence, and associated risk for HIV (The Women's Health CoOp were selected to participate in semi-structured interviews about their perceived impact of the intervention on their substance use and exposure to victimization. The Women's CoOp intervention involved creating a new positive social environment for women within a group setting that also fostered women's social action (eg, educating peers or family members in the community. Interviews were analyzed using content analysis and coded to examine women's descriptions of social contexts and social action, and the influence of these on women's substance use abstinence and exposure to victimization. Results: Social support (eg, via program staff and other participants and social action (eg, engaging others in the

ORF Sequence: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available se/invertase); possible inulinase [Bifidobacterium longum NCC2705] MTDFTPETPVLTPIHDHAAELAKAEAGVAEMAANRNNRWYP... NC_004307 gi|23464731 >gi|23464731|ref|NP_695334.1| beta-fructofuranosidase (sucra

ORF Sequence: NC_005363 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005363 gi|42523756 >gi|42523756|ref|NP_969136.1| membrane protein necessary for nodulation/competitivene...ss [Bdellovibrio bacteriovorus HD100] MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKR

ORF Sequence: NC_003078 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp

ORF Sequence: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13471138 >gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competit...iveness determinant [Mesorhizobium loti MAFF303099] MTNESDTRSAELAELTADIVSAYVSNNPLPV

ORF Sequence: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15964332 >gi|15964332|ref|NP_384685.1| PROBABLE PYRAZINAMIDASE/NICOTINAMIDAS...E (INCLUDES: PYRAZINAMIDASE, NICOTINAMIDASE) PROTEIN [Sinorhizobium meliloti 1021] MADAARPDLREAMADEAL

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13358146 >gi|13358146|ref|NP_078420.1| transcription antitermination factor [Ureap...lasma parvum serovar 3 str. ATCC 700970] MAYKIKDLDSKLLSDLKIDFNHRHQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLKIIKEKIKEVKIYEPSEAP

Parking regulations on the CERN sites

CERN Multimedia

General Infrastructure Services Department

2010-01-01

The site surveillance service is also responsible for supervising compliance with the parking regulations on the CERN site. In that context, it ensures that the following rules are complied with on the CERN car park: Vehicles may not be left on a CERN car park for longer than 5 consecutive working days. However, CERN users are entitled to leave their vehicles parked at CERN for a longer period in the car park near Building 588 , subject to completing the application form "Demande d'autorisation pour un stationnement de longue durée" (application for a long-term parking permit) and sending it to the Reception and Access Control Service (access.surveillance@cern.ch) prior to departure.   Parking spaces, which are in short supply in many crowded areas of the CERN site, must not be occupied by abandoned vehicles/wrecks. The service organizes the disposal of such vehicles. Any CERN users wishing to get rid of a private vehicle parked on one of the CERN car pa...

Full-Automatic Parking registration and payment

DEFF Research Database (Denmark)

Agerholm, Niels; Lahrmann, Harry; Jørgensen, Brian

2014-01-01

As part of ITS Platform North Denmark, a full-automatic GNSS-based parking payment (PP) system was developed (PP app). On the basis of the parking position and parking time, the PP app can determine the price of parking and collect the amount from the car owner’s bank account. The driver...... is informed about any initiation of PP via SMS message. If the driver finds the payment erroneous, it can be cancelled via SMS message. Parking attendants can check if the car in question has an ongoing payment for parking. To handle the problems with GNSS-based positioning in densely built-up areas......, an advanced map matching algorithm was integrated in the PP app. 24 of the participating vehicles used the PP app, and 58 parking payments were carried out without errors. In a few cases, the wrong parking area was selected. This was due to lack of information in the map rather than errors in the map matching...

77 FR 57063 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC

Science.gov (United States)

2012-09-17

... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...

77 FR 64906 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC

Science.gov (United States)

2012-10-24

... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...

ORF Sequence: NC_006155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available g protein (involved in environmental [Yersinia pseudotuberculosis IP 32953] MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK ... NC_006155 gi|51595328 >gi|51595328|ref|YP_069519.1| hemolysin expression modulatin

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13357802 >gi|13357802|ref|NP_078076.1| ribosomal protein L24 [Ureapla...sma parvum serovar 3 str. ATCC 700970] MNRIKKGDTVVVISGKNKNKSGVVIQVNPKEQTALVEGVNKIKRHQKKDQTHEQSGIIEKEAPIRLCKLALVDPKGKDKGKATKVKYLLKDNKKVRVARKSGSELDVNKK

CAI System with Multi-Media Text Through Web Browser for NC Lathe Programming

Science.gov (United States)

Mizugaki, Yoshio; Kikkawa, Koichi; Mizui, Masahiko; Kamijo, Keisuke

A new Computer Aided Instruction (CAI) system for NC lathe programming has been developed with use of multi-media texts including movies, animations, pictures, sound and texts through Web browser. Although many CAI systems developed previously for NC programming consist of text-based instructions, it is difficult for beginners to learn NC programming with use of them. In the developed CAI system, multi-media texts are adopted for the help of users' understanding, and it is available through Web browser anytime and anywhere. Also the error log is automatically recorded for the future references. According to the NC programming coded by a user, the movement of the NC lathe is animated and shown in the monitor screen in front of the user. If its movement causes the collision between a cutting tool and the lathe, some sound and the caution remark are generated. If the user makes mistakes some times at a certain stage in learning NC, the corresponding suggestion is shown in the form of movies, animations, and so forth. By using the multimedia texts, users' attention is kept concentrated during a training course. In this paper, the configuration of the CAI system is explained and the actual procedures for users to learn the NC programming are also explained too. Some beginners tested this CAI system and their results are illustrated and discussed from the viewpoint of the efficiency and usefulness of this CAI system. A brief conclusion is also mentioned.

NSDNA: a manually curated database of experimentally supported ncRNAs associated with nervous system diseases.

Science.gov (United States)

Wang, Jianjian; Cao, Yuze; Zhang, Huixue; Wang, Tianfeng; Tian, Qinghua; Lu, Xiaoyu; Lu, Xiaoyan; Kong, Xiaotong; Liu, Zhaojun; Wang, Ning; Zhang, Shuai; Ma, Heping; Ning, Shangwei; Wang, Lihua

2017-01-04

The Nervous System Disease NcRNAome Atlas (NSDNA) (http://www.bio-bigdata.net/nsdna/) is a manually curated database that provides comprehensive experimentally supported associations about nervous system diseases (NSDs) and noncoding RNAs (ncRNAs). NSDs represent a common group of disorders, some of which are characterized by high morbidity and disabilities. The pathogenesis of NSDs at the molecular level remains poorly understood. ncRNAs are a large family of functionally important RNA molecules. Increasing evidence shows that diverse ncRNAs play a critical role in various NSDs. Mining and summarizing NSD-ncRNA association data can help researchers discover useful information. Hence, we developed an NSDNA database that documents 24 713 associations between 142 NSDs and 8593 ncRNAs in 11 species, curated from more than 1300 articles. This database provides a user-friendly interface for browsing and searching and allows for data downloading flexibility. In addition, NSDNA offers a submission page for researchers to submit novel NSD-ncRNA associations. It represents an extremely useful and valuable resource for researchers who seek to understand the functions and molecular mechanisms of ncRNA involved in NSDs. © The Author(s) 2016. Published by Oxford University Press on behalf of Nucleic Acids Research.

precision deburring using NC and robot equipment. Final report

Energy Technology Data Exchange (ETDEWEB)

Gillespie, L.K.

1980-05-01

Deburring precision miniature components is often time consuming and inconsistent. Although robots are available for deburring parts, they are not precise enough for precision miniature parts. Numerical control (NC) machining can provide edge break consistencies to meet requirements such as 76.2-..mu..m maximum edge break (chamfer). Although NC machining has a number of technical limitations which prohibits its use on many geometries, it can be an effective approach to features that are particularly difficult to deburr.

Metal assessment in urban park soils in Sao Paulo 1. Ibirapuera Park

International Nuclear Information System (INIS)

Figueiredo, Ana Maria G.; Camargo, Sonia P.; Pavese, Arthur C.; Gumiero, Felipe C.; Enzweiler, Jacinta; Sigolo, Joel B.

2007-01-01

In the last years urban soils received increasing attention by scientists, leading to studies focused on their description and investigation all over the world, due to the increasing metal pollution derived from incinerators, industrial waste, atmospheric deposition of dust and aerosols, and other activities. Metal contamination in Sao Paulo public parks is an important environmental question and there is little information on this subject. As part of a project which aims metal assessment in urban park soils from Sao Paulo, in the present paper the concentration of the elements As, Ba, Cr, Pb, Sb and Zn were determined in surface soil samples (0-5 cm) from Ibirapuera park of Sao Paulo. Ibirapuera park is one of the biggest and most visited parks of the city of Sao Paulo, receiving during the weekends more than 400,000 visitors. Instrumental Neutron Activation Analysis (INAA) and X-ray Fluorescence (FRX) were used for metal analysis. Preliminary results showed concentration levels of the analyzed elements higher than the values considered as reference values for soils in Sao Paulo, according to the Environmental Protection Agency of the State of Sao Paulo (CETESB). For As, Ba, Cr and Sb, in some samples the concentrations were even higher than the Prevention values reported by CETESB. The high concentrations of the elements As, Ba, Cr, Pb, Sb and Zn in the Ibirapuera park top soils suggest an anthropogenic source and indicate a potential damage to soil quality. (author)

Changing perspectives in urban park management

DEFF Research Database (Denmark)

Chan, Chung-shing; Marafa, Lawal M.; Konijnendijk, Cecil Cornelis

2015-01-01

managers in Hong Kong have encountered different challenges over time, and the quest for changing park managerial strategies. In 2004, a set of indicators for urban park management in Hong Kong was produced as part of a Master's research. Local park managers were asked about their views on the respective......Urban parks provide numerous benefits to our society. In densely populated metropolises such as Hong Kong, urban parks are in high demand. A variety of indicators can be used as tools for improving park planning and management. Facing a dynamic society and increasing user expectations, urban park...... importance and performance (I–P) of the indicators. In 2012, a follow-up questionnaire survey was conducted with the managers to study if their views regarding these indicators and their performance had changed. Results from the 2004 and 2012 surveys revealed changing perceptions regarding both I...

ORF Sequence: NC_003283 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003283 gi|17563066 >gi|17563066|ref|NP_506462.1| putative protein family member, with a transme...mbrane domain (5O433) [Caenorhabditis elegans] MWNLVSPIHISSKFSMEMAEVNVVAVPEENRQTYLETDNDRLVMAIIWLIMPPMAVFFKCRGCTKHVFINFLLYLLLVLPAYKHATWFCFVKGREFEAEDGFVRAR

ORF Sequence: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003280 gi|17535455 >gi|17535455|ref|NP_495314.1| putative endoplasmic reticulum protein, with a transme...mbrane domain (2G788) [Caenorhabditis elegans] MTDVRFIIWNCIALLVALMMALTSIIILSDAPHNSME

Mayflies, stoneflies, and caddisflies of streams and marshes of Indiana Dunes National Lakeshore, USA

Science.gov (United States)

DeWalt, R. Edward; South, Eric J.; Robertson, Desiree R.; Marburger, Joy E.; Smith, Wendy W.; Brinson, Victoria

2016-01-01

Abstract United States National Parks have protected natural communities for one hundred years. Indiana Dunes National Lakeshore (INDU) is a park unit along the southern boundary of Lake Michigan in Indiana, USA. An inventory of 19 sites, consisting of a seep, 12 streams, four marshes, a bog, and a fen were examined for mayflies (Ephemeroptera), stoneflies (Plecoptera), and caddisflies (Trichoptera) (EPT taxa). Volunteers and authors collect 35 ultraviolet light traps during summer 2013 and supplementary benthic and adult sampling added species not attracted by lights or that were only present in colder months. Seventy-eight EPT species were recovered: 12 mayflies, two stoneflies, and 64 caddisflies. The EPT richness found at INDU was a low proportion of the number of species known from Indiana: caddisflies contributed only 32.7% of known state fauna, mayflies and stoneflies contributed 8.4% and 2.3%, respectively. Site EPT richness ranged from one for a seep to 34 for an 8 m-wide stream. Richness in streams generally increased with stream size. Seven new state records and rare species are reported. The number of EPT species at INDU is slightly larger than that found at Isle Royale National Park in 2013, and the community composition and evenness between orders were different. PMID:26877693

Bioactive contaminants of emerging concern in National Park waters of the northern Colorado Plateau, USA

Science.gov (United States)

Weissinger, Rebecca H; Blackwell, Brett R.; Keteles, Kristen; Battaglin, William A.; Bradley, Paul M.

2018-01-01

Pharmaceuticals and personal care products (PPCPs), wastewater indicators (WWIs), and pesticides (herein, Contaminants of Emerging Concern [CECs]) have been documented in surface waters throughout the world and have associated risks to aquatic life. While much research has focused on temperate and urbanized watersheds, less is known about CEC presence in semi-arid landscapes, where water availability is limited and populations are low. CEC presence in water and sediment is reported for 21 sites in eight U.S. national parks in the northern Colorado Plateau region. From 2012 to 2016, at least one PPCP and/or WWI was detected at most sites on over half of sampling visits, indicating that CECs are not uncommon even in isolated areas. CEC detections were generally fewer and at lower concentrations than in urbanized or agricultural watersheds. Consistent with studies from other U.S. regions, the most frequently detected CECs in this study include DEET, caffeine, organophosphorus flame retardants, and bisphenol A in water and fecal indicators and polycyclic aromatic hydrocarbons in sediment. Maximum concentrations in this study were generally below available water quality benchmarks, sediment quality guidelines, and risk assessment thresholds associated with vertebrates. Additional work is needed to assess the potential activity of hormones, which had high reporting limits in our study, and potential bioactivity of environmental concentrations for invertebrates, microbial communities, and algae. Potential sources of CEC contamination include upstream wastewater effluent discharges and National Park Service invasive-plant-control herbicide applications. CEC occurrence patterns and similarities between continuous and isolated flow locations suggest that direct contamination from individual visitors may also occur. While our data indicate there is little aquatic health risk associated with CECs at our sites, our results demonstrate the ubiquity of CECs on the landscape and a

ORF Sequence: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI

Parks of Chapel Hill

Data.gov (United States)

Town of Chapel Hill, North Carolina — Hours, location, and amenity information for Chapel Hill parks as shown on the Town of Chapel Hill's website. Includes a map with points for each park location.

Parks, people, and change: the importance of multistakeholder engagement in adaptation planning for conserved areas

Directory of Open Access Journals (Sweden)

Corrine N. Knapp

2014-12-01

Full Text Available Climate change challenges the traditional goals and conservation strategies of protected areas, necessitating adaptation to changing conditions. Denali National Park and Preserve (Denali in south central Alaska, USA, is a vast landscape that is responding to climate change in ways that will impact both ecological resources and local communities. Local observations help to inform understanding of climate change and adaptation planning, but whose knowledge is most important to consider? For this project we interviewed long-term Denali staff, scientists, subsistence community members, bus drivers, and business owners to assess what types of observations each can contribute, how climate change is impacting each, and what they think the National Park Service should do to adapt. The project shows that each type of long-term observer has different types of observations, but that those who depend more directly on natural resources for their livelihoods have more and different observations than those who do not. These findings suggest that engaging multiple groups of stakeholders who interact with the park in distinct ways adds substantially to the information provided by Denali staff and scientists and offers a broader foundation for adaptation planning. It also suggests that traditional protected area paradigms that fail to learn from and foster appropriate engagement of people may be maladaptive in the context of climate change.

''House in park'' gold plated. Subsequent certification for the new office building; ''Haus im Park'' vergoldet. Nachtraegliche LEED-Zertifizierung fuer neues Buerogebaeude

Energy Technology Data Exchange (ETDEWEB)

Herzog, Kati; Wildhack, Alice [Bilfinger Berger AG, Mannheim (Germany). Abt. Nachhaltigkeit/Energieeffizienz

2011-07-01

In March 2011, the ''house in park'' received the signet LEED {sup registered} of the U.S. Green Building Council (Washington, North Carolina, U.S.A.) in ''gold''. In general, it is the second German project that was awarded with ''gold'' in the certification version ''New Construction, version 2009''. The special challenge: In the planning phase, no aspects relevant to planning and execution with regard to LEED were implemented. In total there are 15 LEED-certified buildings actually in Germany (worldwide: 7,894). 115 Projects are registered (worldwide: 23,238). The trend is increasing, both nationally as well as internationally.

32 CFR 634.31 - Parking.

Science.gov (United States)

2010-07-01

... 32 National Defense 4 2010-07-01 2010-07-01 true Parking. 634.31 Section 634.31 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) LAW ENFORCEMENT AND CRIMINAL INVESTIGATIONS MOTOR VEHICLE TRAFFIC SUPERVISION Traffic Supervision § 634.31 Parking. (a) The most efficient use of existing on- and off-street parking...

ORF Sequence: NC_004605 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available protein) (involved in swarmer cell regulation) [Vibrio parahaemolyticus RIMD 2210633] MKKAVKKISSKKIITISAIIV... NC_004605 gi|28901366 >gi|28901366|ref|NP_801021.1| ScrC (sensory box/GGDEF family

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available g protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica s... NC_006905 gi|62179085 >gi|62179085|ref|YP_215502.1| hemolysin expression modulatin

Philometrid nematodes infecting fishes from the Everglades National Park, Florida, USA, with description of two new species

Czech Academy of Sciences Publication Activity Database

Moravec, František; Bakenhaster, M.

2010-01-01

Roč. 57, č. 3 (2010), s. 213-222 ISSN 0015-5683 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometridae * Marine fish * USA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.533, year: 2010

75 FR 11169 - Reedsport OPT Wave Park Project; Reedsport OPT Wave Park; LLC Notice of Scoping Meetings and...

Science.gov (United States)

2010-03-10

... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 12713-002] Reedsport OPT Wave Park Project; Reedsport OPT Wave Park; LLC Notice of Scoping Meetings and Environmental Site...: Reedsport OPT Wave Park, LLC. e. Name of Project: Reedsport OPT Wave Park Project. [[Page 11170

Geochemical and biogeochemical investigations in national parks [Badania geochemiczne i biogeochemiczne w parkach narodowych

Science.gov (United States)

Migaszewski, Z.M.; Lamothe, P.J.; Crock, J.G.

1998-01-01

National parks hold a key position among nature protection areas including a diversity of resources - natural, cultural, recreational and scenic. These "inviolable sanctuaries" are simultaneosuly ecologic knots and pristine nature refuges due to the presence of a number of unique plant and animal species. These species make up a natural gene bank. Classically, the level of biologic degradation in national parks is determined on the basis of qualitative and quantitative studies of plant bioindicators. Their scope encompasses phytosociologic survey the purpose of which is to identify floral assemblages with a detailed list of species to record future changes in their number. The best biomonitors of air quality are epiphytic lichens, ground mosses and conifers. Geochemical and biogeochemical investigations are widely performed in the U.S.A. to evaluate the degree of pollution in the nature protection areas including national parks (Gough et al., 1988a, b; Crock et al., 1992a, 1993; Jackson et al., 1995). Variability of element concentrations in soils and plants is assessed by using unbalanced, nested analysis-of-variance (ANOVA). It enables obtaining important statistical information with a minimum number of samples. In some cases a combined grid and barbell sampling design is applied (Jackson et al., 1995). In specific mountainous parks a method of 2-3 transects parallel to the extent of range (crest) is recommended. To determine the impact of a single pollution source on a given park, traverse sampling beginning near the emitter is used (Crock et al., 1992, 1993). The obtained results are a "snapshot" of chemical composition of soils and plant bioindicators that can be a reference for any future changes in the concentration level of chemical elements and organics. In addition, baseline element and organics composition of the media mentioned above can be compared with that obtained for geochemical atlases of polluted urban and industrial areas. Geochemical and

De Novo Discovery of Structured ncRNA Motifs in Genomic Sequences

DEFF Research Database (Denmark)

Ruzzo, Walter L; Gorodkin, Jan

2014-01-01

De novo discovery of "motifs" capturing the commonalities among related noncoding ncRNA structured RNAs is among the most difficult problems in computational biology. This chapter outlines the challenges presented by this problem, together with some approaches towards solving them, with an emphas...... on an approach based on the CMfinder CMfinder program as a case study. Applications to genomic screens for novel de novo structured ncRNA ncRNA s, including structured RNA elements in untranslated portions of protein-coding genes, are presented.......De novo discovery of "motifs" capturing the commonalities among related noncoding ncRNA structured RNAs is among the most difficult problems in computational biology. This chapter outlines the challenges presented by this problem, together with some approaches towards solving them, with an emphasis...

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available erobacterial common antigen (ECA) [Escherichia coli K12] MKVLTVFGTRPEAIKMAPLVHALAKD... NC_000913 gi|49176409 >gi|49176409|ref|YP_026253.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

ORF Sequence: NC_003282 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003282 gi|17540144 >gi|17540144|ref|NP_500824.1| feminization 1 homolog a, FEMinization of XX and XO ani...mals FEM-1 (fem-1) [Caenorhabditis elegans] MTPNGHHFRTVIYNAAAVGNLQRIKVFTINSRNDRQWII

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16128606 >gi|16128606|ref|NP_415156.1| RNA chaperone, transcription antiterm...inator, affects expression of rpoS and uspA [Escherichia coli K12] MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL

ORF Sequence: NC_001137 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ull mutation has global effects on transcription; Yer064cp [Saccharomyces cerevisiae] MIDDTENSKIHLEGSHKTGKYT... NC_001137 gi|6320907 >gi|6320907|ref|NP_010986.1| Non-essential nuclear protein; n

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16128858 >gi|16128858|ref|NP_415411.1| periplasmic chaperone effects translocation of lipoprot...eins from inner membrane to outer membrane [Escherichia coli K12] MMKKIAITCALLSSLVA

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62179485 >gi|62179485|ref|YP_215902.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer membrane [Salmonella enterica subsp. enterica serov

THE SCHOOL PARK.

Science.gov (United States)

FISCHER, JOHN H.

TO ASSIST IN DESEGREGATION, VARIOUS MODELS FOR THE SCHOOL PARK ARE PROPOSED--(1) ASSEMBLING ALL STUDENTS AND SCHOOLS OF A SMALL OR MEDIUM-SIZED COMMUNITY ON A SINGLE CAMPUS, (2) SERVING ONE SECTION OF A LARGE CITY, (3) CENTERING ALL SCHOOL FACILITIES FOR A SINGLE LEVEL OF EDUCATION ON A SINGLE SITE, AND (4) ESTABLISHING RINGS OF SCHOOL PARKS ABOUT…

Explicit flow equations and recursion operator of the ncKP hierarchy

International Nuclear Information System (INIS)

He, Jingsong; Wang, Lihong; Tu, Junyi; Li, Xiaodong

2011-01-01

The explicit expression of the flow equations of the noncommutative Kadomtsev–Petviashvili (ncKP) hierarchy is derived. Compared with the flow equations of the KP hierarchy, our result shows that the additional terms in the flow equations of the ncKP hierarchy indeed consist of commutators of dynamical coordinates {u i }. The recursion operator for the flow equations under n-reduction is presented. Further, under 2-reduction, we calculate a nonlocal recursion operator Φ(2) of the noncommutative Korteweg–de Vries(ncKdV) hierarchy, which generates a hierarchy of local, higher-order flows. Thus we solve the open problem proposed by Olver and Sokolov (1998 Commun. Math. Phys. 193 245–68)

Testing the QCD string at large Nc from the thermodynamics of the hadronic phase

Science.gov (United States)

Cohen, Thomas D.

2007-02-01

It is generally believed that in the limit of a large number of colors (Nc) the description of confinement via flux tubes becomes valid and QCD can be modeled accurately via a hadronic string theory—at least for highly excited states. QCD at large Nc also has a well-defined deconfinement transition at a temperature Tc. In this talk it is shown how the thermodyanmics of the metastable hadronic phase of QCD (above Tc) at large NC can be related directly to properties of the effective QCD string. The key points in the derivation is the weakly interacting nature of hadrons at large Nc and the existence of a Hagedorn temperature TH for the effective string theory. From this it can be seen at large Nc and near TH, the energy density and pressure of the hadronic phase scale as E ˜ (TH - T)-(D⊥-6)/2 (for D⊥ TH - T)-(D⊥-4)/2 (for D⊥ TH > Tc this behavior is of relevance only to the metastable phase. The prospect of using this result to extract D⊥ via lattice simulations of the metastable hadronic phase at moderately large Nc is discussed.

Better parks through law and policy: a legal analysis of authorities governing public parks and open spaces.

Science.gov (United States)

Henderson, Ana; Fry, Christine R

2011-01-01

Improving parks in low income and minority neighborhoods may be a key way to increase physical activity and decrease overweight and obesity prevalence among children at the greatest risk. To advocate effectively for improved recreation infrastructure, public health advocates must understand the legal and policy landscape in which public recreation decisions are made. In this descriptive legal analysis, we reviewed federal, state, and local laws to determine the authority of each level of government over parks. We then examined current practices and state laws regarding park administration in urban California and rural Texas. We identified several themes through the analysis: (1) multiple levels of governments are often involved in parks offerings in a municipality, (2) state laws governing parks vary, (3) local authority may vary substantially within a state, and (4) state law may offer greater authority than local jurisdictions use. Public health advocates who want to improve parks need to (1) think strategically about which levels of government to engage; (2) identify parks law and funding from all levels of government, including those not typically associated with local parks; and (3) partner with advocates with similar interests, including those from active living and school communities.

36 CFR 7.25 - Hawaii Volcanoes National Park.

Science.gov (United States)

2010-07-01

... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Hawaii Volcanoes National Park. 7.25 Section 7.25 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR SPECIAL REGULATIONS, AREAS OF THE NATIONAL PARK SYSTEM § 7.25 Hawaii Volcanoes National Park. (a...

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MFYWILL... NC_006905 gi|62180070 >gi|62180070|ref|YP_216487.1| putative membrane transporter

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MQQFEWI... NC_006905 gi|62180071 >gi|62180071|ref|YP_216488.1| putative membrane transporter

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16131649 >gi|16131649|ref|NP_418241.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli K12] MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVR

ORF Sequence: NC_001147 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001147 gi|6324442 >gi|6324442|ref|NP_014511.1| Plasma membrane Mg(2+) transporter, expression and turnov...er are regulated by Mg(2+) concentration; overexpression confers increased toleranc

ORF Sequence: NC_001134 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ivery of heterogeneous nuclear ribonucleoproteins to the nucleoplasm, binds rg-nucl... NC_001134 gi|6319491 >gi|6319491|ref|NP_009573.1| Transportin, cytosolic karyopherin beta 2 involved in del

Maryon Park

OpenAIRE

Bertoli, Giasco

2018-01-01

Tiré du site Internet de Onestar Press: "Maryon Park is the place Michelangelo Antonioni chose, in 1966, to shoot the scenes that would become cult images from his film "Blow Up", and deservedly so. The park is located in Charlton, southeast of London, a place that's hardly changed since Antonioni shot there. I first went there to shoot a series of photos on March 7 and 8, 2007. I returned again on March 7, 2014. I called the series “Maryon Park”. I used a medium format, six by seven inch col...

Smart parking management and navigation system

KAUST Repository

Saadeldin, Mohamed

2017-01-01

Various examples are provided for smart parking management, which can include navigation. In one example, a system includes a base station controller configured to: receive a wireless signal from a parking controller located at a parking space

ORF Alignment: NC_002977 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002977 gi|53804693 >1fgjA 20 492 48 517 e-179 ... gb|AAU92745.1| hydroxylamine oxy...doreductase [Methylococcus capsulatus str. Bath] ... ref|YP_113436.1| hydroxylamine oxydoreductase ...

ORF Alignment: NC_006569 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006569 gi|56708985 >1fgjA 5 498 32 521 0.0 ... ref|YP_165030.1| hydroxylamine oxid...oreductase [Silicibacter pomeroyi DSS-3] ... gb|AAV97335.1| hydroxylamine oxidoreductase ... [

ORF Alignment: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23465117 >1g5aA 80 628 2 589 5e-59 ... gb|AAL05573.1| alpha-glucosidase [Bifidobacterium adolesce...ntis] ... Length = 588 ... Query: 1 ... MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEK

ORF Sequence: NC_002945 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002945 gi|31792282 >gi|31792282|ref|NP_854775.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium bovis AF2122/97] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

ORF Sequence: NC_000962 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000962 gi|57116825 >gi|57116825|ref|YP_177638.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium tuberculosis H37Rv] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62181272 >gi|62181272|ref|YP_217689.1| H inversion: regulation of fla...gellar gene expression by site-specific inversion of DNA [Salmonella enterica subsp. enterica serovar Choler

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546028 >1fjgR 2 71 22 91 5e-16 ... emb|CAD15011.1| PROBABLE PRIMOSOMAL REPLICATION... PROTEIN [Ralstonia solanacearum] ... ref|NP_519430.1| PROBABLE PRIMOSOMAL REPLICATION ...

ORF Alignment: NC_003228 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003228 gi|60681683 >1gntA 1 551 3 543 0.0 ... emb|CAH07898.1| hydroxylamine reduct...ase [Bacteroides fragilis NCTC 9343] ... ref|YP_211827.1| hydroxylamine reductase [Bacteroides ...

ORF Sequence: NC_003281 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003281 gi|25151987 >gi|25151987|ref|NP_499440.2| TRAnsformer : XX animals trans...formed into males TRA-1, HERmaphrodization of XO animals HER-2, sex determination zinc-finger protein, alter

ORF Sequence: NC_003282 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available inization of XX and XO animals FEM-3 (46.2 kD) (fem-3) [Caenorhabditis elegans] MEVDPGSDDVEADRETRAQKLKLKRNVK... NC_003282 gi|17540880 >gi|17540880|ref|NP_501587.1| sex determination protein, FEM

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...

ORF Alignment: NC_006155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006155 gi|51597538 >1kmoA 5 661 59 714 9e-71 ... ref|YP_071729.1| putative hydroxamate-type ferris...ive ... hydroxamate-type ferrisiderophore receptor. [Yersinia ... pseudotuberculosis IP 32953

ORF Alignment: NC_006274 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006274 gi|52142162 >1gpuA 4 663 4 663 0.0 ... ref|YP_084669.1| transketolase (glycoal...dehyde transferase) [Bacillus cereus ZK] ... gb|AAU17181.1| transketolase (glycoaldehyde transfera

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21219041 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

ORF Alignment: NC_003306 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003306 gi|17938860 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

ORF Alignment: NC_003064 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003064 gi|16119505 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

ORF Sequence: NC_001145 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001145 gi|6323710 >gi|6323710|ref|NP_013781.1| Protein required for nuclear mem...brane fusion during karyogamy, localizes to the membrane with a soluble portion in the endoplasmic reticulum

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003919 gi|21242752 >1iwlA 2 180 23 207 3e-47 ... gb|AAM36870.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas axonopodis pv. citr

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006370 gi|54308356 >1iwlA 4 181 22 199 2e-52 ... ref|YP_129376.1| hypothetical outer membrane lipoproteins... ... hypothetical outer membrane lipoproteins carrier protein ... [Photobacterium profundum] ... L

ORF Sequence: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002655 gi|15800754 >gi|15800754|ref|NP_286768.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer [Escherichia coli O157:H7 EDL933] MMKKIAITCALLSSLVA

IoT-Based Car's Parking Monitoring System

Directory of Open Access Journals (Sweden)

Dwiputra Albertus Ega

2018-01-01

Full Text Available Internet-of-things-based technologies have advanced so much and helped public necessities. The use of IoT at a parking lot will help vehicle users to know the availability of a parking location through smartphones. This IoT-based parking system is created by using controllers, sensors, servers and cloud. Controllers and sensors will be placed on the ceiling of each parking slots to detect the presence of a car. Server collect the results of the sensors and store them in Cloud. System test is conducted by installing three sensor circuits and server in a parking lot. The tests consist of measuring time that required for data transmission and the rate of success of data transmission from the parking lot to the Cloud. Based on above tests, it is observed that the sensor circuit and Radio Frequency Identification are able to transmit the parking lot data without error. This system require maximum 1 min to update parking lot data. The process of obtaining data until the data being stored in Cloud takes 12 s and the process of acquiring parking condition data from Cloud to smartphone takes 30 s. The accuracy level of parking lot data transfer is 100 %.

Aftermath of Griffith Park Fire

Science.gov (United States)

2007-01-01

In mid-May 2007, wind-driven flames raced through Griffith Park in Los Angeles, forcing hasty evacuations and threatening numerous famous landmarks and tourist spots, such as the Los Angeles Zoo and the Hollywood Sign. Ultimately, no one was injured in the fire, which may have been started by a cigarette. About 800 acres burned in the urban park, which is itself a Hollywood landmark, having been the location for several movies, including Rebel Without A Cause. This image of the park was captured by the Advanced Spaceborne Thermal Emission and Reflection Radiometer (ASTER) on NASA's Terra satellite on June 6, 2007, about a month after the fire. ASTER detects both visible and infrared wavelengths of light, and both kinds have been used to make this image. Vegetation appears in various shades of red, while the burned areas appear charcoal. Roads and dense urban areas appear purplish-gray or white. Water is dark blue. Large burned areas are evident in the northwest and southeast parts of the park, with scattered smaller patches along the southern margin. Some botanical gardens and parts of a bird sanctuary, as well as some park structures like restrooms, were destroyed. The park's unburned, natural vegetation appears brick red, while the irrigated golf courses adjacent to the park are bright red. NASA image created by Jesse Allen, using data provided courtesy of the NASA/GSFC/MITI/ERSDAC/JAROS, and U.S./Japan ASTER Science Team.

46 CFR 7.55 - Cape Henry, VA to Cape Fear, NC.

Science.gov (United States)

2010-10-01

... 46 Shipping 1 2010-10-01 2010-10-01 false Cape Henry, VA to Cape Fear, NC. 7.55 Section 7.55 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC BOUNDARY LINES Atlantic Coast § 7.55 Cape Henry, VA to Cape Fear, NC. (a) A line drawn from Rudee Inlet Jetty Light “2” to...

ORF Alignment: NC_006371 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006371 gi|54302237 >1r690 2 63 15 79 7e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

ORF Alignment: NC_002947 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002947 gi|26988182 >1rwrA 1 265 36 293 1e-50 ... ref|NP_743607.1| surface colonization... ... gb|AAN67071.1| surface colonization protein, putative ... [Pseudomonas putida KT2440] ...

ORF Sequence: NC_001139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001139 gi|6321518 >gi|6321518|ref|NP_011595.1| Protein of unknown function; deletion... mutant has synthetic fitness defect with an sgs1 deletion mutant; Slx9p [Saccharomyces cerevisiae] MVA

ORF Alignment: NC_004461 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004461 gi|27467238 >1kolA 35 391 30 342 2e-04 ... ref|NP_763875.1| xylitol dehydro...genase [Staphylococcus epidermidis ATCC 12228] ... gb|AAO03917.1| xylitol dehydrogenase [Staphylococc

ORF Sequence: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available erobacterial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSAKALAAYSKRIDV... NC_002655 gi|15804377 >gi|15804377|ref|NP_290417.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

ORF Alignment: NC_003075 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003075 gi|42566272 >1ogqA 3 270 31 261 6e-05 ... ref|NP_192248.2| leucine-rich repeat transme...ery: 151 XXXXXXXGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 210 ... GELPDVFQNLVGLINLDISSNNISGTLPPSME...NLLTLTTLRVQNNQLSGTLDV Sbjct: 121 LNDNLLSGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 180 ...

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546366 >1bxdA 1 144 297 447 7e-18 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...PROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546366 >1joyA 1 67 230 295 9e-16 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...ROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

ORF Alignment: NC_002928 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002928 gi|33596933 >1kmoA 7 661 65 702 8e-60 ... ref|NP_884576.1| putative ferrisi...derophore receptor [Bordetella parapertussis 12822] ... emb|CAE37631.1| putative ferrisiderophore rec

ORF Alignment: NC_003155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003155 gi|29832733 >1chkA 1 236 48 283 9e-87 ... dbj|BAC73902.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_827367.1| putative chitosanase [Streptomyces ...

ORF Alignment: NC_003155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003155 gi|29828557 >1chkA 1 236 35 270 4e-95 ... dbj|BAC69726.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_823191.1| putative chitosanase [Streptomyces ...

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available tide synthetase [Actinoplanes teichomyceticus] ... Length = 427 ... Query: 12 ... LSPLQEGMLFHNLFDEEELDAYNVQ... NC_003888 gi|32141196 >1l5aA 1 423 12 438 2e-57 ... emb|CAE53352.1| non-ribosomal pep

ORF Alignment: NC_005363 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005363 gi|42523916 >1a12A 35 375 64 376 3e-39 ... emb|CAE53335.1| putative RCC1 repeats protein [Actinoplan...es teichomyceticus] ... Length = 313 ... Query: 425 GVGFACALYDNNDLKCFGANDYGQLGD

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34558174 >1wcv1 4 239 4 244 2e-25 ... ref|NP_907989.1| SEPTUM SITE-DETERMINING...| SEPTUM ... SITE-DETERMINING PROTEIN MIND CELL DIVISION INHIBITOR ... MIND [Wolinella succino

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34557077 >1vdkA 1 459 5 463 e-135 ... ref|NP_906892.1| ASPARTATE AMMONIA...-LYASE [Wolinella succinogenes DSM 1740] ... emb|CAE09792.1| ASPARTATE AMMONIA-LYASE [Wolinella ...

ORF Alignment: NC_003450 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003450 gi|19553429 >1v4aA 22 435 620 1034 4e-69 ... ref|YP_226470.1| GLUTAMATE-AMMONIA...mb|CAF20569.1| ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERASE ... [Corynebacterium glutami

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17547365 >1gkmA 3 497 10 504 e-143 ... emb|CAD16353.1| PROBABLE HISTIDINE AMMONIA...-LYASE (HISTIDASE) PROTEIN [Ralstonia ... solanacearum] ref|NP_520767.1| PROBABLE HISTIDINE ... AMMONIA

ORF Alignment: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15966456 >1gkmA 2 501 3 499 e-107 ... emb|CAC47282.1| PUTATIVE HISTIDINE AMMONIA...-LYASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_386809.1| PUTATIVE HISTIDINE AMMONIA-LYASE

ORF Alignment: NC_003450 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003450 gi|19552717 >1vdkA 1 459 57 516 e-127 ... ref|YP_225787.1| ASPARTATE AMMONIA...ynebacterium glutamicum ATCC 13032] emb|CAF21511.1| ... ASPARTATE AMMONIA-LYASE (ASPARTASE) [Coryneba

Self-evaluation System for Low carbon Industrial Park--A Case Study of TEDA Industrial Park in Tianjin

Science.gov (United States)

Wenyan, W.; Fanghua, H.; Ying, C.; Ouyang, W.; Yuan, Q.

2013-12-01

Massive fossil fuel burning caused by industrialization development is one major reason of global climate change. After Copenhagen climate summit, the studies of low-carbon city gain attentions from many countries. On 25th Nov. 2009, the State Council executive meeting announced that by 2020 China will reduce the carbon dioxide emissions per unit of GDP by 40% to 45% compared with the level of 2005. Industrial Park as an important part of city, has developed rapidly in recent years, and turns into a key element and an alternative mechanism to achieve emission reduction target. Thus, establishing a low carbon development model for industrial park is one of the most effective ways to build sustainable low carbon cities. By adopting the self-evaluation system of low carbon industrial park, this research aims to summarize the low carbon concept in industrial park practice. According to The Guide for Low Carbon Industrial Development Zones, the quantitative evaluation system is divided into 4 separate categories with 23 different quantitative indicators. The 4 categories include: 1) energy and GHG management (weigh 60%), 2) circular economy and environmental protection (weigh 15%), 3) administration and incentive mechanisms of industrial parks (weigh 15%), and 4) planning and urban forms (weigh 10%). By going through the necessary stages and by leading continuous improvements low carbon development goals can be achieved. Tianjin TEDA industrial park is selected as one case study to conduct an assessment on TEDA low-carbon development condition. Tianjin TEDA Industrial Park is already an ecological demonstration industrial park in China, with good foundations on environmental protection, resource recycling, etc. Based on the self-evaluation system, the indicators, such as the energy using efficiency and the degree of land intensive utilization, are also analyzed and assessed. Through field survey and data collection, in accordance with the quantitative self

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34497787 >1f39A 3 98 107 198 1e-23 ... gb|AAQ60004.1| SOS mutagenesis [C...hromobacterium violaceum ATCC 12472] ... ref|NP_902002.1| SOS mutagenesis [Chromobacterium ...

ORF Alignment: NC_006840 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006840 gi|59712585 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

ORF Alignment: NC_004605 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004605 gi|28900550 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

ORF Alignment: NC_006085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006085 gi|50842772 >1qr0A 1 205 2 202 3e-27 ... ref|YP_055999.1| biosurfactants pr...oduction protein [Propionibacterium acnes ... KPA171202] gb|AAT83041.1| biosurfactants production ...

ORF Sequence: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002655 gi|15804385 >gi|15804385|ref|NP_290425.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSLLQFSGLFVVWLLCTLFIA

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13474471 >1gkpA 2 454 5 422 3e-10 ... ref|NP_106039.1| creatinine deamin...ase [Mesorhizobium loti MAFF303099] ... dbj|BAB51825.1| creatinine deaminase [Mesorhizobium loti ...

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27381528 >1uzbA 40 515 6 475 3e-74 ... ref|NP_773057.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC51682.1| vanillin: NAD oxidoreductase ...

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27377799 >1uzbA 40 515 5 474 3e-69 ... ref|NP_769328.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC47953.1| vanillin: NAD oxidoreductase ...

ORF Alignment: NC_006361 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006361 gi|54024866 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut

ORF Alignment: NC_003450 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003450 gi|19554128 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546367 >1kgsA 3 221 7 234 1e-40 ... emb|CAD15350.1| PROBABLE OXIDATIVE STRESS... ... solanacearum] ref|NP_519769.1| PROBABLE OXIDATIVE STRESS ... RESISTANCE TWO-COMPONENT RESPON

ORF Alignment: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32475765 >1zrn0 11 219 5 254 2e-04 ... ref|NP_868759.1| N-acetylglucosamine-6-phosha... ... N-acetylglucosamine-6-phoshatase or p-nitrophenyl ... phosphatase [Pirellula sp.] ... Len

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002939 gi|39996821 >1v7zA 3 252 1 232 3e-42 ... ref|NP_952772.1| creatinine amidoh...ydrolase [Geobacter sulfurreducens PCA] ... gb|AAR35099.1| creatinine amidohydrolase [Geobacter ...

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21225320 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative mycodextrana...se [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21225300 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative mycodextrana...se [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces

ORF Alignment: NC_002929 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002929 gi|33592999 >1kmoA 7 661 65 702 1e-60 ... ref|NP_880643.1| putative ferrisi...derophore receptor [Bordetella pertussis Tohama I] ... emb|CAE42244.1| putative ferrisiderophore rece

ORF Alignment: NC_002927 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002927 gi|33600770 >1kmoA 7 661 65 702 2e-60 ... ref|NP_888330.1| putative ferrisi...derophore receptor [Bordetella bronchiseptica RB50] ... emb|CAE32282.1| putative ferrisiderophore rec

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21219207 >1chkA 2 236 45 279 3e-87 ... ref|NP_624986.1| secreted chitosan...ase [Streptomyces coelicolor A3(2)] ... emb|CAB61194.1| secreted chitosanase [Streptomyces ...

ORF Alignment: NC_003911 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003911 gi|56696447 >1dlwA 19 115 21 125 4e-12 ... gb|AAV94850.1| protozoan/cyanoba...cterial globin family protein [Silicibacter ... pomeroyi DSS-3] ref|YP_166804.1| ... protozoan

ORF Alignment: NC_002977 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002977 gi|53804116 >1dlwA 19 113 26 120 5e-13 ... gb|AAU92168.1| protozoan/cyanoba...cterial globin family protein [Methylococcus ... capsulatus str. Bath] ref|YP_114018.1| ... protozoa

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39933534 >1rkd0 3 296 29 346 6e-36 ... emb|CAE25901.1| possible cabohydr...ate kinases [Rhodopseudomonas palustris CGA009] ... ref|NP_945810.1| possible cabohydrate kinases ...

ORF Alignment: NC_003296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003296 gi|17548586 >1gkmA 10 504 26 526 e-118 ... ref|NP_521926.1| PROBABLE HISTIDINE AMMONIA...-LYASE PROTEIN [Ralstonia solanacearum ... GMI1000] emb|CAD17516.1| PROBABLE HISTIDINE ... AMMONIA

ORF Alignment: NC_003902 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003902 gi|21231422 >1iwlA 2 180 23 207 3e-47 ... ref|NP_637339.1| outer-membrane lipoproteins... ... gb|AAM41263.1| outer-membrane lipoproteins carrier ... protein precursor [Xanthomonas campest

What's Ahead for our National Parks?

Science.gov (United States)

George, Jean Craighead

1972-01-01

To insure the future of our National Parks, sweeping changes must be made. Encroaching civilization at the expense of nature has forced National Park officials to consider alternatives to future development - limiting number of visitors, facilities outside the parks and curtailing vehicular traffic. (BL)

USA

DEFF Research Database (Denmark)

Nedergaard, Peter

http://www.systime.dk/ungdomsuddannelser/almen-studieforberedelse/usa-en-grundbog-i-politik-og-okonomi.html......http://www.systime.dk/ungdomsuddannelser/almen-studieforberedelse/usa-en-grundbog-i-politik-og-okonomi.html...

Advanced parking management systems : a cross-cutting study : taking the stress out of parking

Science.gov (United States)

2007-01-01

This study examines advanced parking management systems (APMSs) in three venues: airports, central business districts, and transit park-and-ride locations. Specifically, the systems examined in this study provide directional and space availability in...

The perception of visitors towards the level of satisfaction on park (Case study: Singha Merjosari Park Malang)

Science.gov (United States)

Priadaniswari, R.

2017-06-01

Park is one of the public spaces which is used by people to get happiness and comfort. Singha Merjosari Park is one of the parks in Malang that is functioned as a recreational and educational park for the citizen. In weekends and national holidays Singha Merjosari park get visited by so many visitors. But if we see the reality, there are still some problems regarding visitor satisfaction. Also, there are attributes that has performance levels decrease that will become another new problem. The purpose of this study is to analyze the perception of visitors about the level of visitor satisfaction and what attributes that need to be improved and developed by managers in the future. The approach method in this research is descriptive quantitative. Primary data is based on measurement and observation. The number of samples used is 100 respondents referring to the number of samples determination by Slovin formula with the sample selection used is accidental sampling technique. The analysis technique used is Importance Performance Analysis (IPA) and Costumer Satisfaction Index (CSI). Based on the results of IPA analysis, the things that should get important attention and should be improved is the aesthetics of lighting, cleanliness of parking area and toilet, shade in park area, and availability of clean water. While the result of CSI value analysis is 65,30%. This means visitors are satisfied, but visitors are still not satisfied overall. Implications or changes that should be given is the aesthetics of lighting should be more creative and become the identity of the park (for example, lamp lanterns should be suitable with the concept of the park). Also, the change of toilet look so that visitors can enjoy the look and it can be iconic (toilet concept according to local culture of Malang) and the prevalence of lighting in the park area at night.

Bioactive contaminants of emerging concern in National Park waters of the northern Colorado Plateau, USA.

Science.gov (United States)

Weissinger, Rebecca H; Blackwell, Brett R; Keteles, Kristen; Battaglin, William A; Bradley, Paul M

2018-05-02

Pharmaceuticals and personal care products (PPCPs), wastewater indicators (WWIs), and pesticides (herein, Contaminants of Emerging Concern [CECs]) have been documented in surface waters throughout the world and have associated risks to aquatic life. While much research has focused on temperate and urbanized watersheds, less is known about CEC presence in semi-arid landscapes, where water availability is limited and populations are low. CEC presence in water and sediment is reported for 21 sites in eight U.S. national parks in the northern Colorado Plateau region. From 2012 to 2016, at least one PPCP and/or WWI was detected at most sites on over half of sampling visits, indicating that CECs are not uncommon even in isolated areas. CEC detections were generally fewer and at lower concentrations than in urbanized or agricultural watersheds. Consistent with studies from other U.S. regions, the most frequently detected CECs in this study include DEET, caffeine, organophosphorus flame retardants, and bisphenol A in water and fecal indicators and polycyclic aromatic hydrocarbons in sediment. Maximum concentrations in this study were generally below available water quality benchmarks, sediment quality guidelines, and risk assessment thresholds associated with vertebrates. Additional work is needed to assess the potential activity of hormones, which had high reporting limits in our study, and potential bioactivity of environmental concentrations for invertebrates, microbial communities, and algae. Potential sources of CEC contamination include upstream wastewater effluent discharges and National Park Service invasive-plant-control herbicide applications. CEC occurrence patterns and similarities between continuous and isolated flow locations suggest that direct contamination from individual visitors may also occur. While our data indicate there is little aquatic health risk associated with CECs at our sites, our results demonstrate the ubiquity of CECs on the landscape and a

Neuropsychological assessment, neuroimaging, and neuropsychiatric evaluation in pediatric and adult patients with sickle cell disease (SCD

Directory of Open Access Journals (Sweden)

Christopher L Edwards

2007-01-01

Full Text Available Christopher L Edwards1, Renee Dunn Raynor1, Miriam Feliu1, Camela McDougald1, Stephanie Johnson2, Donald Schmechel3, Mary Wood1, Gary G Bennett4, Patrick Saurona5, Melanie Bonner1, Chante’ Wellington1, Laura M DeCastro6, Elaine Whitworth6, Mary Abrams6, Patrick Logue1, Lekisha Edwards1, Salutario Martinez7, Keith E Whitfield81Department of Psychiatry and Behavioral Sciences, Duke University Medical Center, Durham, NC, USA; 2American Psychological Association, Science Directorate, Washington, DC, USA; 3Department of Medicine, Division of Neurology, Duke University Medical Center, Durham, NC, USA; 4Department of Society, Human Development, and Health, Harvard School of Public Health, Boston, MA, USA; 5Taub Institute For Research on Alzheimer’s Disease and The Aging Brain, Columbia University, New York, NY, USA; 6Department of Medicine, Division of Hematology, Duke University Medical Center, Durham, NC, USA; 7Department of Radiology, Duke University Medical Center, Durham, NC, USA; 8Duke University, Durham, NC, USAAbstract: Traditionally, neuropsychological deficits due to Sickle Cell Disease (SCD have been understudied in adults. We have begun to suspect, however, that symptomatic and asymptomatic Cerebrovascular Events (CVE may account for an alarming number of deficits in this population. In the current brief review, we critically evaluated the pediatric and adult literatures on the neurocognitive effects of SCD. We highlighted the studies that have been published on this topic and posit that early detection of CVE via neurocognitive testing, neuropsychiatric evaluations, and neuroimaging may significantly reduce adult cognitive and functional morbidities.Keywords: cerebral vascular event, neuropsychological assessment, sickle cell disease, neuroimaging

Wireless based Smart Parking System using Zigbee

OpenAIRE

Hamzah Asyrani Bin Sulaiman; Mohd Fareez Bin Mohd Afif; Mohd Azlishah Bin Othman; Mohamad Harris Bin Misran; Maizatul Alice Binti Meor Said

2013-01-01

One of main issues of developing big parking space for shopping complexes, office complexes and other types of building that requires large parking space is to notify the visitors of occupied and nonoccupied parking space. Most of the visitors might spending up to 30 to 45 minutes just to find an empty parking space. In most recent technology, some parking lot system offered a system that could automatically count when the car entering the empty car space and blocking an infrared signal thus ...

ORF Alignment: NC_003902 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003902 gi|21232942 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21242877 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004663 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004663 gi|29348666 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004578 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004578 gi|28867366 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_005139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_005139 gi|37678876 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21241391 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006177 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006177 gi|51892124 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006349 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006349 gi|53716793 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006840 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006840 gi|59711756 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006370 gi|54310137 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21243399 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003869 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003869 gi|20807352 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006351 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006351 gi|53722013 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004459 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004459 gi|27363966 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004461 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004461 gi|27467672 >1pwgA 4 344 72 389 1e-36 ... ref|NP_764309.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... epidermidis ATCC 12228] gb|AAO04351.1| autolysis

ORF Alignment: NC_006834 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006834 gi|58583632 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Sequence: NC_001136 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001136 gi|6320573 >gi|6320573|ref|NP_010653.1| Nucleolar protein involved in pre-rRNA processing; deplet...ion causes severely decreased 18S rRNA levels; Esf1p [Saccharomyces cerevisiae] MAG

ORF Alignment: NC_000964 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000964 gi|16078891 >1jmkC 6 230 1056 1270 2e-59 ... ref|NP_389712.1| plipastatin s...ynthetase [Bacillus subtilis subsp. subtilis str. 168] ... emb|CAB13713.1| plipastatin synthetase [B

ORF Alignment: NC_006841 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006841 gi|59714046 >1gntA 1 552 1 553 0.0 ... ref|YP_206821.1| hydroxylamine reduc...tase [Vibrio fischeri ES114] gb|AAW87933.1| ... hydroxylamine reductase [Vibrio fischeri ES114] ...

ORF Alignment: NC_006677 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006677 gi|58039331 >1hxhA 1 247 2 262 8e-39 ... pir||JC7939 xylitol dehydrogenase ...(EC 1.1.1.-) - Gluconobacter oxydans (Strain ... ATCC621) dbj|BAC16227.1| xylitol dehydrogenase ...

ORF Alignment: NC_002570 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002570 gi|15612789 >1v7zA 3 254 1 238 1e-53 ... dbj|BAB03945.1| creatinine amidohy...drolase [Bacillus halodurans C-125] ... ref|NP_241092.1| creatinine amidohydrolase [Bacillus ...

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27377041 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000909 gi|15669839 >1gxlA 2 204 475 685 1e-34 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

ORF Alignment: NC_003237 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003237 gi|19075000 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000909 gi|15669839 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus jannaschii ... DSM 2661] gb|AAB99663.1| chromosome segreta

ORF Alignment: NC_003485 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003485 gi|19746967 >1g5aA 98 625 11 538 6e-94 ... gb|AAL98602.1| putative dextran ...glucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608103.1| putative dextran glucosidase ...

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34556965 >1mzbA 1 134 1 130 7e-21 ... ref|NP_906780.1| PEROXIDE STRESS R...EGULATOR [Wolinella succinogenes DSM 1740] ... emb|CAE09680.1| PEROXIDE STRESS REGULATOR [Wolinella ...

ORF Alignment: NC_006395 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006395 gi|55376664 >1v7zA 1 249 5 243 8e-44 ... ref|YP_134515.1| creatinine amidoh...ydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV44809.1| creatinine amidohydrolase [Haloarcula

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39933548 >1v7zA 10 254 14 256 2e-44 ... emb|CAE25915.1| putative creatin...e amidohydrolase [Rhodopseudomonas palustris ... CGA009] ref|NP_945824.1| putative creatine ...

ORF Alignment: NC_002928 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002928 gi|33596750 >1v7zA 3 253 1 251 8e-40 ... ref|NP_884393.1| putative creatini...ne amidohydrolase [Bordetella parapertussis 12822] ... emb|CAE37436.1| putative creatinine amidohydro

ORF Alignment: NC_006576 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006576 gi|56750058 >1v7zA 4 251 11 256 7e-49 ... ref|YP_170759.1| creatinine amido...hydrolase [Synechococcus elongatus PCC 6301] ... dbj|BAD78239.1| creatinine amidohydrolase [Synechoco

ORF Alignment: NC_006395 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006395 gi|55376890 >1v7zA 5 250 13 257 5e-37 ... ref|YP_134741.1| creatinine amido...hydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV45035.1| creatinine amidohydrolase [Haloarcul

ORF Alignment: NC_004311 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004311 gi|23500710 >1v7zA 10 254 1 242 2e-43 ... gb|AAN34155.1| creatinine amidohy...drolase, putative [Brucella suis 1330] ... ref|NP_700150.1| creatinine amidohydrolase, putative ...

ORF Alignment: NC_002771 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002771 gi|15829246 >1nm8A 15 579 43 592 3e-82 ... ref|NP_326606.1| CARNITINE O-ACE...TYLTRANSFERASE [Mycoplasma pulmonis UAB CTIP] ... emb|CAC13948.1| CARNITINE O-ACETYLTRANSFERASE ...

ORF Alignment: NC_006677 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006677 gi|58039110 >1kmoA 11 661 79 730 2e-52 ... ref|YP_191074.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60418.1| Hydroxamate-type ferrisid

ORF Alignment: NC_006677 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006677 gi|58039006 >1kmoA 12 661 92 773 1e-43 ... ref|YP_190970.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60314.1| Hydroxamate-type ferrisid

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006370 gi|54310050 >1r0wC 43 281 30 288 6e-50 ... ref|YP_131070.1| putative ABC-type oligopeptide transport...putative ... ABC-type oligopeptide transportsystem, ATPase component ... [Photobacterium profu

ORF Alignment: NC_006361 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006361 gi|54022220 >1y7yA 7 68 12 73 3e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

ORF Sequence: NC_001141 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001141 gi|6322114 >gi|6322114|ref|NP_012189.1| Part of a heptameric protein complex that regulates retro...grade Golgi-to-ER protein traffic in eukaryotic cells; coatomer forms the COP I ves

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34499386 >1qgiA 1 259 102 360 4e-95 ... gb|AAQ61593.1| probable chitosan...ase A [Chromobacterium violaceum ATCC 12472] ... ref|NP_903601.1| probable chitosanase A [Chromobacte

ORF Alignment: NC_006274 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006274 gi|52142820 >1kwfA 3 362 53 435 5e-85 ... ref|YP_084010.1| chitosanase; gly...cosyl hydrolases family 8; endoglucanase [Bacillus ... cereus ZK] gb|AAU17839.1| chitosanase; glycosy

ORF Alignment: NC_006348 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006348 gi|53725407 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

ORF Alignment: NC_002976 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002976 gi|57866545 >1dlwA 19 115 47 146 6e-19 ... ref|YP_188173.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... epidermidis RP62A] gb|AAW53991.1| ... protozoa

ORF Alignment: NC_002951 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002951 gi|57650195 >1dlwA 19 115 21 120 3e-19 ... ref|YP_185875.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus COL] gb|AAW36475.1| ... protozoa

ORF Alignment: NC_006350 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006350 gi|53718816 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

ORF Alignment: NC_006087 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006087 gi|50955733 >1exqA 11 145 176 318 6e-09 ... ref|YP_063021.1| transposase, undefined... [Leifsonia xyli subsp. xyli str. CTCB07] ... gb|AAT89916.1| transposase, undefined [Leifsoni

ORF Alignment: NC_004668 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004668 gi|29376585 >1pq4B 1 288 29 305 1e-52 ... ref|NP_815739.1| endocarditis spe...cific antigen [Enterococcus faecalis V583] ... gb|AAO81809.1| endocarditis specific antigen ...

ORF Alignment: NC_000921 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000921 gi|15612352 >1mwmA 3 314 14 329 4e-45 ... ref|NP_224005.1| ROD SHAPE-DETERMINING... PROTEIN [Helicobacter pylori J99] ... gb|AAD06861.1| ROD SHAPE-DETERMINING PROTEIN ... [

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17544778 >1mwmA 4 314 14 329 3e-49 ... emb|CAD13587.1| PROBABLE ROD SHAPE-DETERMINING... PROTEIN [Ralstonia solanacearum] ... ref|NP_518180.1| PROBABLE ROD SHAPE-DETERMINING PR

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17548082 >1wcv1 2 241 2 249 7e-27 ... emb|CAD16862.1| PROBABLE SEPTUM SITE-DETERMINING... PROTEIN MIND [Ralstonia ... solanacearum] ref|NP_521484.1| PROBABLE SEPTUM ... SITE-DETERMINING

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17547375 >1v4aA 29 433 25 452 2e-95 ... emb|CAD16363.1| PROBABLE GLUTAMATE-AMMONIA... ... [Ralstonia solanacearum] ref|NP_520777.1| PROBABLE ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERAS

ORF Alignment: NC_003317 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003317 gi|17987610 >1v4aA 20 435 2 420 e-106 ... gb|AAL52508.1| GLUTAMATE-AMMONIA-...LIGASE ADENYLYLTRANSFERASE [Brucella melitensis ... 16M] ref|NP_540244.1| GLUTAMATE-AMMONIA-LIGASE ...

ORF Alignment: NC_005126 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005126 gi|37525549 >1iwlA 1 182 22 203 4e-57 ... ref|NP_928893.1| outer-membrane lipoproteins... ... emb|CAE13895.1| outer-membrane lipoproteins carrier ... protein precursor (P20) [Photorhabdus

ORF Alignment: NC_004603 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004603 gi|28897880 >1iwlA 4 181 30 207 4e-54 ... ref|NP_797485.1| outer membrane lipoproteins... carrier protein [Vibrio ... parahaemolyticus RIMD 2210633] dbj|BAC59369.1| outer ... membrane lipoproteins

ORF Alignment: NC_005966 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005966 gi|50085964 >1iwlA 2 180 37 230 6e-44 ... ref|YP_047474.1| outer-membrane lipoproteins... carrier protein [Acinetobacter sp. ... ADP1] emb|CAG69652.1| outer-membrane lipoproteins

ORF Alignment: NC_005139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005139 gi|37679507 >1iwlA 4 181 20 197 6e-54 ... ref|NP_934116.1| outer membrane lipoproteins...tein ... carrier protein precursor dbj|BAC94087.1| outer membrane ... lipoproteins carrier pro

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34497069 >1iwlA 2 178 25 203 1e-46 ... gb|AAQ59290.1| outer membrane lipoproteins... carrier protein [Chromobacterium ... violaceum ATCC 12472] ref|NP_901284.1| outer membrane ... lipoproteins

Performance comparison of wind park configurations

Energy Technology Data Exchange (ETDEWEB)

Lundberg, Stefan

2003-07-01

In this report, layouts of various large-scale wind parks, both AC as well as DC, are investigated. Loss modelling of the wind park components as well as calculations of the energy capture of the turbines using various electrical systems are performed, and the energy production cost of the various park configurations is determined. It was found that from an energy capture point of view, the difference in energy production between various wind turbine systems is very small. In addition, a study of the suitability of various DC/DC-converters is made. Three DC/DC-converters, Boost, Full Bridge and Full Bridge Isolated Boost, are found to be interesting candidates as the 'transformer' component in potential DC-based wind parks. Of all the investigated wind park configurations, the wind park with the series connected DC wind turbines seems to have the best potential to give the lowest energy production cost, if the transmission distance is longer then 10-20 km.

Using ecological indicators and a decision support system for integrated ecological assessment at two national park units in the Mid-Atlantic region, U.S.A.

Science.gov (United States)

Mahan, Carolyn G.; Young, John A.; Miller, Bruce; Saunders, Michael C.

2014-01-01

We implemented an integrated ecological assessment using a GIS-based decision support system model for Upper Delaware Scenic and Recreational River (UPDE) and Delaware Water Gap National Recreation Area (DEWA)—national park units with the mid-Atlantic region of the United States. Our assessment examined a variety of aquatic and terrestrial indicators of ecosystem components that reflect the parks’ conservation purpose and reference condition. Our assessment compared these indicators to ecological thresholds to determine the condition of park watersheds. Selected indicators included chemical and physical measures of water quality, biologic indicators of water quality, and landscape condition measures. For the chemical and physical measures of water quality, we used a water quality index and each of its nine components to assess the condition of water quality in each watershed. For biologic measures of water quality, we used the Ephemeroptera, Plecoptera, Trichoptera aquatic macroinvertebrate index and, secondarily, the Hilsenhoff aquatic macroinvertebrate index. Finally, for the landscape condition measures of our model, we used percent forest and percent impervious surface. Based on our overall assessment, UPDE and DEWA watersheds had an ecological assessment score of 0.433 on a −1 to 1 fuzzy logic scale. This score indicates that, in general, the natural resource condition within watersheds at these parks is healthy or ecologically unimpaired; however, we had only partial data for many of our indicators. Our model is iterative and new data may be incorporated as they become available. These natural parks are located within a rapidly urbanizing landscape—we recommend that natural resource managers remain vigilant to surrounding land uses that may adversely affect natural resources within the parks.

PARK-IT! Elementary School Land Laboratories in Toledo City Parks. Curriculum Activity Guide, Grades K-1.

Science.gov (United States)

DuFour, Marilyn Berry; Courter, Linda Kothera; Garvin, Dennis M.

The project PARK-IT! represents a unique partnership between a public elementary school and a city park in which students and teachers utilize a small naturalized area of the park as a Land Laboratory, and in return become its stewards. The project also includes this curriculum activity guide which can assist teachers in using the Land Lab with…

PARK-IT! Elementary School Land Laboratories in Toledo City Parks. Curriculum Activity Guide, Grades 2-3.

Science.gov (United States)

DuFour, Marilyn Berry; Courter, Linda Kothera; Garvin, Dennis M.

The project PARK-IT! represents a unique partnership between a public elementary school and a city park in which students and teachers utilize a small naturalized area of the park as a Land Laboratory, and in return become its stewards. The project also includes this curriculum activity guide which can assist teachers in using the Land Lab with…

PARK-IT! Elementary School Land Laboratories in Toledo City Parks. Curriculum Activity Guide, Grades 4-6.

Science.gov (United States)

DuFour, Marilyn Berry; Courter, Linda Kothera; Garvin, Dennis M.

The project PARK-IT! represents a unique partnership between a public elementary school and a city park in which students and teachers utilize a small naturalized area of the park as a Land Laboratory, and in return become its stewards. The project also includes this curriculum activity guide which can assist teachers in using the Land Lab with…

Mode choice and shopping mall parking

OpenAIRE

Ersoy, Fulya Yüksel; Ersoy, Fulya Yuksel

2012-01-01

In this thesis, I analyze individuals' mode choice decisions and shopping mall's parking space pricing behavior. Individuals have three choices: first they may come to the mall by car in which case they have to park, second they may come by public transportation, or they do not visit the mall and go for their outside option. The mall determines the price of the good and the parking fee after the government sets public transportation fare. I find that the equilibrium parking fees are always le...

ORF Alignment: NC_004331 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004331 gi|23619306 >1wfiA 3 125 209 328 1e-34 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putativ

ORF Alignment: NC_003911 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003911 gi|56698151 >1wy2A 3 347 27 396 7e-44 ... gb|AAV96554.1| creatinase [Silici...bacter pomeroyi DSS-3] ref|YP_168523.1| ... creatinase [Silicibacter pomeroyi DSS-3] ... Length

ORF Alignment: NC_003366 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003366 gi|18309739 >1v7zA 1 255 3 250 3e-61 ... dbj|BAB80463.1| creatinase [Clostr...idium perfringens str. 13] ref|NP_561673.1| ... creatinase [Clostridium perfringens str. 13] ...

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34557929 >1kmoA 12 661 39 664 3e-52 ... ref|NP_907744.1| RECEPTOR PRECURSOR-Most...ly Fe transport [Wolinella succinogenes DSM ... 1740] emb|CAE10644.1| RECEPTOR PRECURSOR-Most

ORF Alignment: NC_003155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003155 gi|29828632 >1w1oA 22 489 11 408 6e-19 ... dbj|BAC69801.1| putative xylitol... oxidase [Streptomyces avermitilis MA-4680] ... ref|NP_823266.1| putative xylitol oxidase [Streptomyc

ORF Alignment: NC_004605 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004605 gi|28900808 >1l3wA 6 536 1265 1798 3e-11 ... ref|NP_800463.1| putative biofilm...-associated surface protein [Vibrio parahaemolyticus ... RIMD 2210633] dbj|BAC62296.1| putative biofilm

ORF Alignment: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|15221381 >1bq00 2 77 15 90 4e-20 ... ref|NP_177004.1| gravity-responsive... protein / altered response to gravity protein ... (ARG1) [Arabidopsis thaliana] gb|AAD13758.1| Altere

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000909 gi|15669839 >1ii8A 3 194 4 202 2e-10 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

ORF Alignment: NC_002947 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002947 gi|26990072 >1uzbA 37 513 3 472 6e-68 ... ref|NP_745497.1| vanillin dehydro...genase [Pseudomonas putida KT2440] gb|AAN68961.1| ... vanillin dehydrogenase [Pseudomonas putida KT24

ORF Alignment: NC_002737 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002737 gi|15675767 >1g5aA 89 627 2 535 3e-86 ... gb|AAK34662.1| dextran glucosidas...e [Streptococcus pyogenes M1 GAS] ... ref|NP_269941.1| dextran glucosidase [Streptococcus ...

ORF Alignment: NC_003485 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003485 gi|19746879 >1g5aA 89 627 2 535 1e-86 ... gb|AAL98514.1| putative dextran g...lucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608015.1| putative dextran glucosidase ...

ORF Alignment: NC_002737 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002737 gi|15675852 >1g5aA 98 625 11 538 9e-95 ... gb|AAK34747.1| putative dextran ...glucosidase [Streptococcus pyogenes M1 GAS] ... ref|NP_270026.1| putative dextran glucosidase ...

ORF Alignment: NC_002927 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002927 gi|33600518 >1v7zA 3 253 1 251 1e-39 ... ref|NP_888078.1| putative creatini...ne amidohydrolase [Bordetella bronchiseptica RB50] ... emb|CAE32030.1| putative creatinine amidohydro

ORF Alignment: NC_000853 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000853 gi|15643179 >1v7zA 3 256 7 270 9e-43 ... ref|NP_228223.1| creatinine amidoh...ydrolase, putative [Thermotoga maritima MSB8] ... gb|AAD35498.1| creatinine amidohydrolase, putative

ORF Alignment: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23464642 >1v7zA 5 255 7 250 1e-55 ... ref|NP_695245.1| creatinine amidohydrolase; creatin...inase [Bifidobacterium longum ... NCC2705] gb|AAN23881.1| creatinine amidohydrolase; ... creatin

ORF Alignment: NC_002944 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002944 gi|41407994 >4uagA 7 413 12 470 1e-38 ... ref|NP_960830.1| MurC [Mycobacter... ... ligase (UDP-N-acetylmuramoyl-L-alanine synthetase) ... gb|AAS04213.1| MurC [Mycobacterium

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...

ORF Alignment: NC_000117 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000117 gi|15605507 >2bjiA 3 266 5 313 9e-29 ... ref|NP_220293.1| Sulfite Synthesis.../biphosphate phosphatase [Chlamydia trachomatis ... D/UW-3/CX] gb|AAC68369.1| Sulfite Synthesis/bipho

ORF Alignment: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003280 gi|25149956 >1qauA 5 99 56 151 2e-04 ... gb|AAN38752.1| axon identity speci...rm b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity

ORF Alignment: NC_004722 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004722 gi|30021592 >1vkpA 12 368 2 333 2e-83 ... ref|NP_833223.1| Agmatine deimina...se [Bacillus cereus ATCC 14579] gb|AAP10424.1| ... Agmatine deiminase [Bacillus cereus ATCC 14579] ...

ORF Alignment: NC_002952 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002952 gi|49483165 >1dlwA 19 115 21 120 3e-19 ... ref|YP_040389.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG39975.1| ... protozoa

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34556511 >1mwmA 3 314 14 327 1e-46 ... ref|NP_906326.1| PUTATIVE ROD SHAPE-DETERMINING... PROTEIN [Wolinella succinogenes DSM ... 1740] emb|CAE09226.1| PUTATIVE ROD SHAPE-DETERMINING

ORF Alignment: NC_000921 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000921 gi|15611661 >1vdkA 1 460 2 461 e-141 ... ref|NP_223312.1| ASPARTATE AMMONIA...-LYASE [Helicobacter pylori J99] gb|AAD06167.1| ... ASPARTATE AMMONIA-LYASE [Helicobacter pylori J99

ORF Alignment: NC_003317 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003317 gi|17986393 >1vdkA 1 459 12 469 e-123 ... gb|AAL51291.1| ASPARTATE AMMONIA-...LYASE [Brucella melitensis 16M] ref|NP_539027.1| ... ASPARTATE AMMONIA-LYASE [Brucella melitensis 16M

ORF Alignment: NC_006348 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006348 gi|53726032 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur

ORF Alignment: NC_006840 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006840 gi|59711513 >1iwlA 4 181 21 198 9e-49 ... ref|YP_204289.1| outer-membrane lipoproteins... carrier protein [Vibrio fischeri ES114] ... gb|AAW85401.1| outer-membrane lipoproteins ca

ORF Alignment: NC_006350 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006350 gi|53720213 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur

Parks and their users

Directory of Open Access Journals (Sweden)

Barbara Goličnik

2008-01-01

Full Text Available This paper is concerned with urban parks and their use(rs. It focuses on usage-spatial relationships from two different angles. Firstly, it discusses the actual uses mapped in places, using repeated observation on different days, times and weather conditions. Secondly, it addresses designers’ views and beliefs about usage and design of urban parks. However, the paper shows that designers’ beliefs and awareness about uses in places, in some aspects, differ from actual use. It stresses the use of empirical knowledge about usage-spatial relationships, which can be gained by using observation and behavioural mapping, in decision-making processes for parks design.

Geology of National Parks

Science.gov (United States)

Stoffer, Philip W.

2008-01-01

This is a set of two sheets of 3D images showing geologic features of many National Parks. Red-and-cyan viewing glasses are need to see the three-dimensional effect. A search on the World Wide Web will yield many sites about anaglyphs and where to get 3D glasses. Red-blue glasses will do but red-cyan glasses are a little better. This publication features a photo quiz game: Name that park! where you can explore, interpret, and identify selected park landscapes. Can you identify landscape features in the images? Can you explain processes that may have helped form the landscape features? You can get the answers online.

Park Accessibility Impacts Housing Prices in Seoul

Directory of Open Access Journals (Sweden)

Jin Han Park

2017-01-01

Full Text Available Housing prices are determined by a variety of factors, including the features of the building and the neighborhood environment, and a potential buyer decides to buy a house after reviewing these factors and concluding that it is worth the price. We used Hedonic Price Methods to find the relationship between monetary value of house and access conditions to urban parks. Two meaningful results were discovered in this study: first, as the distance from the park increases, the value of the park inherent in the housing price decreases; second, the greater walking accessibility, to the park, the higher the park value inherent in housing prices. Despite presenting shorter distances to walk and more entrances, poorly accessible zones were deemed as such due to the necessity of crossing an arterial road. This indicates that the results can define accessibility not as the Euclidian distance but as the shortest walking distance while considering crossroads and park entrances. The results of this study have significant implications for urban park economic impact analyses in Seoul. Also, the increase in housing prices closer to parks supports the idea that access is dependent on the residents’ socioeconomic status. Lastly, the results of this study can improve walking accessibility to the park.

Bicycle Parking and Locking

DEFF Research Database (Denmark)

Larsen, Jonas

2017-01-01

. This article contributes with new insights into parking and locking - ‘moorings’ - to cycling literature. It presents an ethnography of ‘design moorings’ and practices associated with parking and locking bikes. The main case study is the very pro-cycling city of Copenhagen. Yet to explore what is unique about...

36 CFR 7.39 - Mesa Verde National Park.

Science.gov (United States)

2010-07-01

... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Mesa Verde National Park. 7... SPECIAL REGULATIONS, AREAS OF THE NATIONAL PARK SYSTEM § 7.39 Mesa Verde National Park. (a) Visiting of... the admission of commercial automobiles and buses to Mesa Verde National Park, contained in § 5.4 of...

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34495619 >1t06A 1 193 1 205 2e-24 ... gb|AAQ57843.1| DNA alkylation repa...ir enzyme [Chromobacterium violaceum ATCC 12472] ... ref|NP_899834.1| DNA alkylation repair enzyme ...

ORF Alignment: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23466169 >1u94A 19 326 67 387 5e-28 ... ref|NP_696772.1| alkylation dama...ge repair protein [Bifidobacterium longum NCC2705] ... gb|AAN25408.1| alkylation damage repair protei

ORF Alignment: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32477023 >1t06A 1 191 9 220 1e-24 ... ref|NP_870017.1| probable DNA alkylation... repair enzyme [Rhodopirellula baltica SH 1] ... emb|CAD79170.1| probable DNA alkylation repair

ORF Alignment: NC_004350 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004350 gi|24378587 >1t06A 1 191 11 210 3e-32 ... gb|AAN57848.1| DNA alkylation rep...air enzyme [Streptococcus mutans UA159] ... ref|NP_720542.1| DNA alkylation repair enzyme ...

ORF Alignment: NC_002945 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002945 gi|31791180 >1ii8A 1 187 1 168 2e-14 ... ref|NP_853673.1| DNA REPLICATION A...D92865.1| ... DNA REPLICATION AND REPAIR PROTEIN RECF (SINGLE-STRAND ... DNA BINDING PROTEIN)

ORF Alignment: NC_003317 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003317 gi|17987645 >1j1vA 4 94 20 109 8e-10 ... gb|AAL52543.1| CHROMOSOMAL REPLICATION... INITIATOR PROTEIN DNAA [Brucella melitensis ... 16M] ref|NP_540279.1| CHROMOSOMAL REPLICATION IN

ORF Alignment: NC_003232 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003232 gi|19173617 >1ltlE 7 224 22 242 3e-38 ... ref|NP_597420.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY (MCM6) ... [Encephalitozoon cuniculi] emb|CAD26597.1| DNA ... REPLICATION

ORF Alignment: NC_003071 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003071 gi|18403860 >1rl1A 4 90 215 300 7e-09 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putative

ORF Alignment: NC_003902 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003902 gi|21229523 >1p6rA 5 81 4 80 4e-10 ... ref|NP_635440.1| methicillin resista...nce protein [Xanthomonas campestris pv. ... campestris str. ATCC 33913] gb|AAM39364.1| methicillin ...

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003919 gi|21240843 >1p6rA 5 81 4 80 8e-10 ... gb|AAM34961.1| methicillin resistanc...e protein [Xanthomonas axonopodis pv. citri ... str. 306] ref|NP_640425.1| methicillin resistance ...

ORF Alignment: NC_002952 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002952 gi|49483221 >1pwgA 4 329 74 373 1e-38 ... ref|YP_040445.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG40034.1| autolysis

ORF Alignment: NC_002947 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002947 gi|26990378 >1wy2A 3 347 23 393 2e-45 ... ref|NP_745803.1| creatinase [Pseu...domonas putida KT2440] gb|AAN69267.1| creatinase ... [Pseudomonas putida KT2440] ... Length = 3

ORF Alignment: NC_002946 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002946 gi|59800954 >1ub4B 4 109 2 113 3e-22 ... ref|YP_207666.1| putative plasmid stable inheritance... ... gb|AAW89254.1| putative plasmid stable inheritance ... protein putative phage associated prote

ORF Alignment: NC_002745 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002745 gi|15925959 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol

ORF Alignment: NC_002758 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002758 gi|15923246 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

ORF Alignment: NC_003075 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003075 gi|30692533 >3ullA 5 115 1 104 8e-18 ... ref|YP_063478.1| ssb1 [Campylobact...er jejuni] gb|AAR29567.1| ssb1 [Campylobacter ... jejuni] ... Length = 104 ... Query: 31 ... GQDSDVS

ORF Alignment: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|42572131 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

ORF Alignment: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|42563264 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

ORF Alignment: NC_003106 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003106 gi|15922820 >1n62B 24 793 4 684 e-115 ... ref|NP_378489.1| hypothetical nicotine... dehydrogenase subunit C [Sulfolobus tokodaii ... str. 7] dbj|BAB67598.1| 685aa long hypothetical nicotine

ORF Alignment: NC_006509 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006509 gi|56410456 >1n62C 1 286 1 287 4e-70 ... ref|YP_145830.1| nicotine dehydrog...enase chain A [Geobacillus kaustophilus HTA426] ... dbj|BAD74262.1| nicotine dehydrogenase chain A ...

ORF Alignment: NC_004310 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004310 gi|23502014 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON

ORF Alignment: NC_003317 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003317 gi|17987131 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006370 gi|54310056 >1r0wC 45 273 39 283 1e-54 ... ref|YP_131076.1| putative ABC-type metal ion transports...ative ... ABC-type metal ion transportsystem, ATPase component ... [Photobacterium profundum

ORF Alignment: NC_001137 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ograde regulon which ... consists of genes whose expression is stimulated by... NC_001137 gi|6320764 >1wvfA 13 508 29 496 1e-67 ... ref|NP_010843.1| D-lactate dehydrogenase, part of the retr

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

ORF Alignment: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003280 gi|25149956 >1tx4A 1 170 679 853 1e-24 ... gb|AAN38752.1| axon identity spe...form b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity

ORF Alignment: NC_006348 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006348 gi|53726196 >1umqA 5 59 22 76 8e-06 ... ref|ZP_00216666.1| COG2901: Factor for inversion...ef|ZP_00221526.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator ...

ORF Alignment: NC_004459 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004459 gi|27364633 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

ORF Alignment: NC_004603 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004603 gi|28899659 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

ORF Alignment: NC_004061 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004061 gi|21672661 >1etoB 1 98 1 99 3e-23 ... ref|NP_660728.1| factor-for-inversion... stimulation protein [Buchnera aphidicola ... str. Sg (Schizaphis graminum)] gb|AAM67939.1| ... factor-for-inversion

ORF Alignment: NC_006350 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006350 gi|53720503 >1umqA 5 59 22 76 8e-06 ... ref|ZP_00216666.1| COG2901: Factor for inversion...ef|ZP_00221526.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator ...

ORF Alignment: NC_005139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005139 gi|37681323 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006370 gi|54310477 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

ORF Alignment: NC_004578 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004578 gi|28871348 >1dlwA 1 114 25 138 3e-25 ... ref|NP_793967.1| protozoan/cyanob...acterial globin family protein [Pseudomonas ... syringae pv. tomato str. DC3000] gb|AAO57662.1| ... protozoa

ORF Sequence: NC_001146 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001146 gi|6324141 >gi|6324141|ref|NP_014211.1| Essential protein involved in karyoga...he spindle pole body, interacts with Spc72p during karyogamy, also interacts with Cdc31p; Kar1p [Saccharomyc

ORF Sequence: NC_001139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001139 gi|50593217 >gi|50593217|ref|NP_011747.2| Subunit of the prohibitin complex (Phb1p-Phb2p...sized proteins; determinant of replicative life span; involved in mitochondrial segregation; Phb2p [Saccharo

ORF Alignment: NC_004917 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004917 gi|32265815 >1iwlA 11 178 23 174 4e-23 ... gb|AAP76913.1| outer membrane lipoproteins... carrier protein LolA [Helicobacter ... hepaticus ATCC 51449] ref|NP_859847.1| outer membrane ... lipoprotein

Bydlení v USA po roce 1945

OpenAIRE

Dočekalová, Lenka

2014-01-01

Příspěvek se zabývá tématem moderního bydlení v USA v poválečném období, které bylo soustředěno kolem časopisu Arts and Architecture. Tato část je doplněna o další dva příklady realizovaných prototypových domků z období stavebního boomu poválečných let, které jsou ale svým přístupem naprosto odlišné. První z nich byl realizován v městské části Lakewood Park u Los Angeles, a dokládá masivní rozrůstání stereotypní zástavby samostatně stojících domů do okolí měst. Druhý příklad představuje monto...

Enhancing Visitor Experiences Using Thematic Interpretation in Park Guiding Service in Sarawak National Parks

Directory of Open Access Journals (Sweden)

Amin Victor Luna

2014-01-01

Full Text Available Enhancing visitor experiences is arguably the primary and most important goal for interpretation by many protected area managers and tourism business. However, little research has been conducted in Sarawak, Malaysia to directly quantify the effects of thematic interpretation has on tourist experiences. Drawing on the TORE-model of interpretation and through the inception of Park Guiding Training and Licensing System in Sarawak since 2007, this quantitative study examines the effectiveness of thematic interpretive guided tours delivered by park guides at Bako National Park, Sarawak, with the assumption that it will further enhance visitor experiences. A descriptive analysis and Pearson's product-moment correlation analysis of sub-indicators of the global evaluation of interpretation of site, and sub-indicators of elaboration surveyed from visitors of purposively sampled park guides revealed a strong measurement and correlation coefficients of visitors’ overall quality of thematic intepretive guided tours effecting visitor satisfaction and experiences. These findings provide empirical evidence that good thematic interpretive guided tour makes a positive impacts on visitor experiences, thus making training of tourism businesses' employees as park guides as a good investment. The suggestions for further research in influencing visitor attitude and shaping visitor behaviour are offered.

Assessing the risk of foliar injury from ozone on vegetation in parks in the U.S. National Park Service's Vital Signs Network

International Nuclear Information System (INIS)

Kohut, Robert

2007-01-01

The risk of ozone injury to plants was assessed in support of the National Park Service's Vital Signs Monitoring Network program. The assessment examined bioindicator species, evaluated levels of ozone exposure, and investigated soil moisture conditions during periods of exposure for a 5-year period in each park. The assessment assigned each park a risk rating of high, moderate, or low. For the 244 parks for which assessments were conducted, the risk of foliar injury was high in 65 parks, moderate in 46 parks, and low in 131 parks. Among the well-known parks with a high risk of ozone injury are Gettysburg, Valley Forge, Delaware Water Gap, Cape Cod, Fire Island, Antietam, Harpers Ferry, Manassas, Wolf Trap Farm Park, Mammoth Cave, Shiloh, Sleeping Bear Dunes, Great Smoky Mountains, Joshua Tree, Sequoia and Kings Canyon, and Yosemite. - An assessment of the risk of foliar ozone injury on plants was conducted for 269 parks in support of the U.S. National Park Service's Vital Signs Monitoring Network Program

Comparative Evaluation of Ultrafiltration/Microfiltration Membranes for Removal of Nitrocellulose (NC) Fines from Wastewater

National Research Council Canada - National Science Library

Kim, Byung

1997-01-01

.... In Phase II, a pilot-scale crossflow membrane filtration system was constructed to: (1) investigate the concentration polarization and fouling mechanism caused by NC fines during crossflow filtration of NC wastewater, (2...

Ecological Resilience of Small Urban Parks

DEFF Research Database (Denmark)

JasmaniI, Zanariah Binti

consists of several sub-variables or attributes. The attributes of physical characteristics include park size, land use, park shape, proximity to a road and the presence of a water element. Elements relating to vegetation diversity, such as the presence and share of native and exotic species, presence....... Birds and butterflies react differently to various park maintenance practices (e.g. mowing). Based on the overall results, findings and discussion of the key features for bird and butterfly richness and abundance, study IV proposes nine recommendations for small urban parks to improve their ecological...

The counsellor's guide to parks inner child therapy The counsellor's guide to parks inner child therapy Parks P Souvenir 266pp £10.66 0-258-63172-1.

Science.gov (United States)

1994-07-13

The Counsellor's Guide to Parks Inner Child Therapy is the second book by Penny Parks about working with survivors of childhood abuse, the first being Rescuing the Inner Child, published in 1990, which introduced Parks Inner Child Therapy (PICT) as a specifically structured approach to inner child work.

DES-ncRNA: A knowledgebase for exploring information about human micro and long noncoding RNAs based on literature-mining

KAUST Repository

Salhi, Adil

2017-04-07

Noncoding RNAs (ncRNAs), particularly microRNAs (miRNAs) and long ncRNAs (lncRNAs), are important players in diseases and emerge as novel drug targets. Thus, unraveling the relationships between ncRNAs and other biomedical entities in cells are critical for better understanding ncRNA roles that may eventually help develop their use in medicine. To support ncRNA research and facilitate retrieval of relevant information regarding miRNAs and lncRNAs from the plethora of published ncRNA-related research, we developed DES-ncRNA ( www.cbrc.kaust.edu.sa/des_ncrna ). DES-ncRNA is a knowledgebase containing text- and data-mined information from public scientific literature and other public resources. Exploration of mined information is enabled through terms and pairs of terms from 19 topic-specific dictionaries including, for example, antibiotics, toxins, drugs, enzymes, mutations, pathways, human genes and proteins, drug indications and side effects, mutations, diseases, etc. DES-ncRNA contains approximately 878,000 associations of terms from these dictionaries of which 36,222 (5,373) are with regards to miRNAs (lncRNAs). We provide several ways to explore information regarding ncRNAs to users including controlled generation of association networks as well as hypotheses generation. We show an example how DES-ncRNA can aid research on Alzheimer\\'s disease and suggest potential therapeutic role for Fasudil. DES-ncRNA is a powerful tool that can be used on its own or as a complement to the existing resources, to support research in human ncRNA. To our knowledge, this is the only knowledgebase dedicated to human miRNAs and lncRNAs derived primarily through literature-mining enabling exploration of a broad spectrum of associated biomedical entities, not paralleled by any other resource.

DES-ncRNA: A knowledgebase for exploring information about human micro and long noncoding RNAs based on literature-mining.

Science.gov (United States)

Salhi, Adil; Essack, Magbubah; Alam, Tanvir; Bajic, Vladan P; Ma, Lina; Radovanovic, Aleksandar; Marchand, Benoit; Schmeier, Sebastian; Zhang, Zhang; Bajic, Vladimir B

2017-07-03

Noncoding RNAs (ncRNAs), particularly microRNAs (miRNAs) and long ncRNAs (lncRNAs), are important players in diseases and emerge as novel drug targets. Thus, unraveling the relationships between ncRNAs and other biomedical entities in cells are critical for better understanding ncRNA roles that may eventually help develop their use in medicine. To support ncRNA research and facilitate retrieval of relevant information regarding miRNAs and lncRNAs from the plethora of published ncRNA-related research, we developed DES-ncRNA ( www.cbrc.kaust.edu.sa/des_ncrna ). DES-ncRNA is a knowledgebase containing text- and data-mined information from public scientific literature and other public resources. Exploration of mined information is enabled through terms and pairs of terms from 19 topic-specific dictionaries including, for example, antibiotics, toxins, drugs, enzymes, mutations, pathways, human genes and proteins, drug indications and side effects, mutations, diseases, etc. DES-ncRNA contains approximately 878,000 associations of terms from these dictionaries of which 36,222 (5,373) are with regards to miRNAs (lncRNAs). We provide several ways to explore information regarding ncRNAs to users including controlled generation of association networks as well as hypotheses generation. We show an example how DES-ncRNA can aid research on Alzheimer disease and suggest potential therapeutic role for Fasudil. DES-ncRNA is a powerful tool that can be used on its own or as a complement to the existing resources, to support research in human ncRNA. To our knowledge, this is the only knowledgebase dedicated to human miRNAs and lncRNAs derived primarily through literature-mining enabling exploration of a broad spectrum of associated biomedical entities, not paralleled by any other resource.

DES-ncRNA: A knowledgebase for exploring information about human micro and long noncoding RNAs based on literature-mining

KAUST Repository

Salhi, Adil; Essack, Magbubah; Alam, Tanvir; Bajic, Vladan P.; Ma, Lina; Radovanovic, Aleksandar; Marchand, Benoit; Schmeier, Sebastian; Zhang, Zhang; Bajic, Vladimir B.

2017-01-01

Noncoding RNAs (ncRNAs), particularly microRNAs (miRNAs) and long ncRNAs (lncRNAs), are important players in diseases and emerge as novel drug targets. Thus, unraveling the relationships between ncRNAs and other biomedical entities in cells are critical for better understanding ncRNA roles that may eventually help develop their use in medicine. To support ncRNA research and facilitate retrieval of relevant information regarding miRNAs and lncRNAs from the plethora of published ncRNA-related research, we developed DES-ncRNA ( www.cbrc.kaust.edu.sa/des_ncrna ). DES-ncRNA is a knowledgebase containing text- and data-mined information from public scientific literature and other public resources. Exploration of mined information is enabled through terms and pairs of terms from 19 topic-specific dictionaries including, for example, antibiotics, toxins, drugs, enzymes, mutations, pathways, human genes and proteins, drug indications and side effects, mutations, diseases, etc. DES-ncRNA contains approximately 878,000 associations of terms from these dictionaries of which 36,222 (5,373) are with regards to miRNAs (lncRNAs). We provide several ways to explore information regarding ncRNAs to users including controlled generation of association networks as well as hypotheses generation. We show an example how DES-ncRNA can aid research on Alzheimer's disease and suggest potential therapeutic role for Fasudil. DES-ncRNA is a powerful tool that can be used on its own or as a complement to the existing resources, to support research in human ncRNA. To our knowledge, this is the only knowledgebase dedicated to human miRNAs and lncRNAs derived primarily through literature-mining enabling exploration of a broad spectrum of associated biomedical entities, not paralleled by any other resource.

ORF Alignment: NC_004547 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004547 gi|50121646 >1kmoA 14 661 37 705 8e-56 ... ref|YP_050813.1| exogenous ferri...c siderophore TonB-dependent receptor [Erwinia ... carotovora subsp. atroseptica SCRI1043] emb|CAG75622.1| ... exogenou

ORF Alignment: NC_003364 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003364 gi|18312259 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING

ORF Alignment: NC_003236 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003236 gi|19074669 >1jmcA 1 238 213 445 1e-62 ... emb|CAD25779.1| DNA REPLICATION ...FACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PRO

ORF Alignment: NC_002607 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002607 gi|15791012 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING

ORF Alignment: NC_005861 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005861 gi|46446610 >1f39A 5 95 55 141 1e-16 ... ref|YP_007975.1| probable SOS mutagenesis... and repair protein UmuD [Parachlamydia sp. ... UWE25] emb|CAF23700.1| probable SOS mutagenesis

ORF Alignment: NC_005070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005070 gi|33865578 >1f39A 4 97 54 143 4e-22 ... ref|NP_897137.1| putative SOS mutagenesis... protein UmuD [Synechococcus sp. WH 8102] ... emb|CAE07559.1| putative SOS mutagenesis protein

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13472874 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

ORF Alignment: NC_006177 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006177 gi|51893967 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

ORF Alignment: NC_002967 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002967 gi|42528039 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

ORF Alignment: NC_002945 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002945 gi|31792055 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_002945 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002945 gi|31793631 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_002755 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002755 gi|15841974 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_002755 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002755 gi|15840280 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_000962 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000962 gi|15609587 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_003155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003155 gi|29830077 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_000962 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000962 gi|15608007 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_006582 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006582 gi|56962048 >1sd4A 2 99 6 103 1e-24 ... ref|YP_173770.1| methicillin resist...ance regulatory protein MecI [Bacillus clausii ... KSM-K16] dbj|BAD62809.1| methicillin resistance ...

ORF Alignment: NC_005363 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005363 gi|42524871 >1tjlA 27 144 16 133 6e-10 ... ref|NP_970251.1| dnaK deletion s...uppressor protein [Bdellovibrio bacteriovorus HD100] ... emb|CAE78310.1| dnaK deletion suppressor pro

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27380945 >1tjlA 26 141 1 116 7e-32 ... ref|NP_772474.1| dnaK deletion su...ppressor protein [Bradyrhizobium japonicum USDA ... 110] dbj|BAC51099.1| dnaK deletion suppressor pro

ORF Alignment: NC_003921 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003921 gi|21264213 >1ub4C 1 63 1 63 4e-10 ... gb|AAM39232.1| plasmid stable inheritance... protein I [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644714.1| plasmid stable ... inheritance

ORF Alignment: NC_003921 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003921 gi|21264212 >1m1fA 1 109 2 110 1e-34 ... gb|AAM39231.1| plasmid stable inheritance... protein K [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644713.1| plasmid stable ... inheritance

ORF Alignment: NC_005791 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005791 gi|45358156 >1wcv1 4 241 4 235 5e-21 ... ref|NP_987713.1| walker type ATPas...e [Methanococcus maripaludis S2] emb|CAF30149.1| ... walker type ATPase [Methanococcus maripaludis S2

ORF Alignment: NC_003283 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003283 gi|17561408 >1bor0 2 53 282 342 3e-04 ... ref|NP_757385.1| synoviolin 1 iso...form b [Homo sapiens] gb|AAH30530.1| Synoviolin 1, ... isoform b [Homo sapiens] ... Length = 61

ORF Alignment: NC_002745 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002745 gi|15925955 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol

ORF Alignment: NC_002758 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002758 gi|15923242 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol

ORF Alignment: NC_003284 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003284 gi|17551448 >1rw3A 32 443 156 555 3e-25 ... gb|AAF64414.1| Pol [equine foam...y virus] ref|NP_054716.1| Pol [equine foamy virus] ... Length = 400 ... Query: 980 ... KLRIVLD--ASSPPGPEPSL

ORF Alignment: NC_005126 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005126 gi|37527217 >1b12A 1 247 78 326 7e-74 ... ref|NP_930561.1| Signal peptidase I (SPase I) (Leader...| ... Signal peptidase I (SPase I) (Leader peptidase I) ... [Photorhabdus luminescens subsp. l

ORF Alignment: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62179485 >1iwlA 1 182 23 204 2e-69 ... ref|YP_215902.1| periplasmic protein effects...ica ... subsp. enterica serovar Choleraesuis str. SC-B67] ... gb|AAX64821.1| periplasmic protein effects

ORF Alignment: NC_004557 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004557 gi|28211518 >1v7zA 1 255 3 250 2e-62 ... ref|NP_782462.1| creatininase [Clo...stridium tetani E88] gb|AAO36399.1| creatininase ... [Clostridium tetani E88] ... Length = 248

ORF Sequence: NC_001136 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001136 gi|6320230 >gi|6320230|ref|NP_010310.1| Component of the GARP (Golgi-associated retrograde... protein) complex, Vps51p-Vps52p-Vps53p-Vps54p, which is required for retrograde transport

ORF Alignment: NC_006300 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006300 gi|52425721 >1p3dA 1 463 15 477 e-153 ... ref|YP_088858.1| MurC protein [Ma...nnheimia succiniciproducens MBEL55E] gb|AAU38273.1| ... MurC protein [Mannheimia succiniciproducens M

ORF Alignment: NC_006300 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006300 gi|52425669 >4uagA 6 428 2 453 3e-46 ... ref|YP_088806.1| MurC protein [Man...nheimia succiniciproducens MBEL55E] gb|AAU38221.1| ... MurC protein [Mannheimia succiniciproducens MB

ORF Alignment: NC_002663 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002663 gi|15602008 >1p3dA 1 463 17 479 e-156 ... ref|NP_245080.1| MurC [Pasteurell...a multocida subsp. multocida str. Pm70] ... gb|AAK02227.1| MurC [Pasteurella multocida subsp. ...

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13473528 >1u07A 4 89 172 254 2e-09 ... ref|NP_105096.1| energy transduce...r TonB [Mesorhizobium loti MAFF303099] ... dbj|BAB50882.1| energy transducer; TonB [Mesorhizobium ...

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39935198 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy