Managing exploratory innovation
Charue-Duboc , Florence; Aggeri , Franck; Chanal , Valérie; Garel , Gilles
2010-01-01
Although the concept of exploration has been widely used in management research since James March's seminal article, the literature on exploration remains rather fuzzy. The question of exploration is dominated by the literature on ambidexterity but this research actually says little about concretely managing exploratory innovation itself, although this appears to be a central concern of most industrial firms today. Based on a material (twenty presentations made in a research seminar the autho...
Adoption d'innovations agricoles par le truchement de services ...
International Development Research Centre (IDRC) Digital Library (Canada)
L'agriculture est le fer de lance de nombreuses économies en développement, mais la capacité des petits agriculteurs privés de ressources à adopter des innovations agricoles est freinée par le manque d'accès à des services financiers adéquats. Des experts internationaux estiment qu'il existe un manque à gagner ...
An Exploratory Account of Incentives for Underexploitation in an Open Innovation Environment
DEFF Research Database (Denmark)
Piirainen, Kalle; Raivio, Tuomas; Lähteenmäki-smith, Kaisa
2014-01-01
This paper presents an empirical account of incentives for underexploiting intellectual property in an open innovation setting. In this exploratory empirical account the phenomenon is observed in a research, development and innovation program where participants are required to share intellectual...... such an event is not only costly in terms of time and resources, but can in fact render IPR effectively worthless in terms of commercial exploitation and block innovation. This finding is pertinent to policy makers designing research, development and innovation instruments, as well as for managers who need...... to make choices how to implement open practices in innovation....
Workplace Innovation: Exploratory and Confirmatory Factor Analysis for Construct Validation
Directory of Open Access Journals (Sweden)
Wipulanusat Warit
2017-06-01
Full Text Available Workplace innovation enables the development and improvement of products, processes and services leading simultaneously to improvement in organisational performance. This study has the purpose of examining the factor structure of workplace innovation. Survey data, extracted from the 2014 APS employee census, comprising 3,125 engineering professionals in the Commonwealth of Australia’s departments were analysed using exploratory factor analysis (EFA and confirmatory factor analysis (CFA. EFA returned a two-factor structure explaining 69.1% of the variance of the construct. CFA revealed that a two-factor structure was indicated as a validated model (GFI = 0.98, AGFI = 0.95, RMSEA = 0.08, RMR = 0.02, IFI = 0.98, NFI = 0.98, CFI = 0.98, and TLI = 0.96. Both factors showed good reliability of the scale (Individual creativity: α = 0.83, CR = 0.86, and AVE = 0.62; Team Innovation: α = 0.82, CR = 0.88, and AVE = 0.61. These results confirm that the two factors extracted for characterising workplace innovation included individual creativity and team innovation.
Ambroise Paré (1510-1590) and His Innovative Work on the Treatment of War Injuries.
Markatos, Konstantinos; Tzivra, Anna; Tsoutsos, Spyridon; Tsourouflis, Gerasimos; Karamanou, Marianna; Androutsos, Georgios
2018-04-01
The purpose of this study is to summarize the innovations of Ambroise Paré (1510-1590) on the treatment of war wounds and improving amputation technique through ligature in arteries and veins. Ambroise Paré debunked the widely accepted idea that gun powder was poisonous for wounds. He also minimized the use of cautery of wounds by his dressing methods and the application of ligature during amputations. All these innovative rationales revolutionized the practice of war surgery during the Renaissance and paved the way for the introduction of modern surgery. Nevertheless, although his wound dressing innovations became widely accepted, the same did not happen with ligature and amputation; those techniques could become widely applicable if one could somehow control bleeding until the blood vessels had been tied. This became possible much later in the 18th century when Jean Louis Petit invented the first useful and efficient tourniquet.
INNOVATION NETWORKS AND MARKETING MIX: AN EXPLORATORY STUDY ON PRODUCT'S DEVELOPMENT
Directory of Open Access Journals (Sweden)
Thel Augusto Monteiro
2013-12-01
Full Text Available The purpose of this paper is to present how innovation networks can be used to develop a new product or service, using the marketing compound. The study methodology consists of an exploratory research from literature review on this subject. After an initial discussion of the characteristics of innovation networks and marketing functions, the study presents proposals that allow adequately addressing the main difficulties in the management of marketing in innovation networks. Through this study it can be stated that these networks have been identified as an attractive alternative for the development of new products, when using the marketing mix, given the dynamics of the contemporary market. Innovation networks bring a lot of benefits to companies that embrace the relationship between these networks and marketing. The discussion reveals that the structure in the form of innovation networks can bring effective results in the organization which adopt it, providing competitiveness and adaptability in the face of its target market.
Exploring leadership styles for innovation: an exploratory factor analysis
Directory of Open Access Journals (Sweden)
Wipulanusat Warit
2017-03-01
Full Text Available Leadership plays a vital role in building the process, structures, and climate for an organisation to become innovative and to motivate team expectations toward innovations. This study explores the leadership styles that engineers regard as significant for innovation in the public sector. Exploratory factor analysis (EFA was conducted to identify the principal leadership styles influencing innovation in the Australian Public Service (APS, using survey data extracted from the 2014 APS employee census comprising 3 125 engineering professionals in Commonwealth of Australia departments. EFA returned a two-factor structure explaining 77.6% of the variance of the leadership for innovation construct. In this study, the results from the EFA provided a clear estimation of the factor structure of the measures for leadership for innovation. From the results, the two factors extracted were transformational leadership and consideration leadership. In transformational leadership, a leader values organisational objectives, inspires subordinates to perform, and motivates followers beyond expected levels of work standards. Consideration leadership refers to the degree to which a leader shows concern and expressions of support for subordinates, takes care of their welfare, treats members as equals, and displays warmth and approachability. These findings highlight the role of leadership as the most critical predictor when considering the degree to which subordinates strive for creativity and innovation. Both transformational and consideration leadership styles are recommended to be incorporated into management training and development programs. This study also recommends that Commonwealth departments recruit supervisors who have both of these leadership styles before implementing innovative projects.
An exploratory study to identify critical factors of innovation culture in organizations
Directory of Open Access Journals (Sweden)
Hamed Asgari
2013-07-01
Full Text Available During the past two decades, there has been a growing trend on knowledge-based organizations. Innovation, on the other hand, plays essential role on building competitive business units. In this paper, we present an exploratory study to identify critical factors of innovation culture in organizations. We detect important factors influencing innovation culture in construction industry based on the implementation of factor analysis. The proposed study designs a questionnaire and distributes it among 400 experts who are involved in construction industry. Cronbach alpha has been calculated as 0.779, which validates the overall questionnaire. The results of factor analysis have indicated that six factors of building cultural infrastructures, education, organizational vision, established culture, strategic culture and flexible culture are the most important items influencing innovation culture.
Global innovation networks and university-firm interactions: an exploratory survey analysis
Directory of Open Access Journals (Sweden)
Gustavo Britto
2015-02-01
Full Text Available The literature on Global Innovation Networks has contributed to identify changes in the innovation activities of multinational corporations. Although university-firm interactions are seen as an important factor for the emergence of GINs, their role has received limited attention. This paper aims to fill this gap in two ways. First, it carries out an exploratory analysis of an original survey dataset, of firms in three industrial sectors from nine developed and developing countries. Second, the paper analyses whether the role of universities in global innovation networks is related to national systems of innovation with varying degrees of maturity. Multiple correspondence analysis and a Probit model are used to establish the relevance of key factors in driving GINs. The results identify distinctive profiles constructed mainly according to firm characteristics, but reflecting country specific patterns of association. The Probit model confirms that internationalization processes and the existence of local interactions substantially increase the probability of interactions with international institutions.
Customer Integration in Service Innovation: An Exploratory Study
Directory of Open Access Journals (Sweden)
Tim Straub
2013-09-01
Full Text Available Prominent industry projects, as well as an extensive literature suggest the importance of customer integration for companies’ innovation success. This appears to be especially true for service firms, which inherently build on customer interaction. Despite this appreciation of the approach, there are comparably few empirical analyses of the positive and negative effects of customer integration. In this exploratory study, we build on established customer role concepts to study the status quo of customer integration in industry, as well as reservations against the roles and negative experiences from customer integration projects. The study reveals a gap between reservations and actual negative experiences in losing know-how, as well as a positive effect of experience in customer integration on perceived benefits for the company.
L'innovation au service d'économies du savoir caractérisées par l ...
International Development Research Centre (IDRC) Digital Library (Canada)
L'innovation au service d'économies du savoir caractérisées par l'inclusion en Asie - phase II. Learning Initiatives for Network Economies in Asia (LIRNEasia) cherche à cerner les obstacles institutionnels à l'utilisation efficace des technologies de l'information et de la communication (TIC) pour améliorer les conditions de ...
Johansson, Marlene; Abrahamsson, Jan
2014-01-01
Purpose: The purpose of this article is to investigate how business models are used by born global firms to act upon new business opportunities and how they manage business model innovation over time to prosper and grow. Design/Methodology: The study is based on three exploratory case studies of born global firms in mobile communication, financial services and digital music distribution. Findings: Three interrelated capabilities to manage business model innovation are articulated in...
40 CFR 59.411 - Circumvention.
2010-07-01
... 40 Protection of Environment 5 2010-07-01 2010-07-01 false Circumvention. 59.411 Section 59.411 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NATIONAL... Compound Emission Standards for Architectural Coatings § 59.411 Circumvention. Each manufacturer and...
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC411 (Link to dictyBase) - - - Contig-U16272-1 SLC411Z (Link... to Original site) - - SLC411Z 486 - - - - Show SLC411 Library SL (Link to library) Clone ID SLC411 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC411Q.Seq.d/ Representative seq. ID SLC41...1Z (Link to Original site) Representative DNA sequence >SLC411 (SLC411Q) /CSM/SL/SLC4-A/SLC411Q.Seq.d/ XXXXX...vacuolar 4.0 %: peroxisomal >> prediction for SLC411 is nuc 5' end seq. ID - 5' e
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Reporting. 411.210 Section 411.210 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING Activities by Own Employees § 411.210 Reporting. No reporting is required with respect to payments of reasonable compensation made...
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Penalties. 411.400 Section 411.400 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING Penalties and Enforcement § 411.400 Penalties. (a) Any person who makes an expenditure prohibited herein shall be subject to a...
An exploratory study of innovation strategies of the internet of things SMEs in South Korea
Directory of Open Access Journals (Sweden)
Dong-Il Shin
2017-08-01
Full Text Available Purpose - This study aims to suggest directions for innovation-driving paths for sustainable growth through an in-depth case analysis of a successful Internet of Things (IoT in small- and medium-sized enterprise (SME in South Korea. IoT is expected to play a significant role in the future industry 4.0 platform. Yet, little is known about how SMEs in the IoT industry (IoT-SMEs hereafter pursue innovation in alignment with attributes inherent in the IoT. Design/methodology/approach - This study addresses relatively unexplored key research questions on innovation strategies of IoT-SMEs. To do so, we employ an exploratory research methodology, along with an extensive review of the literature in the areas of the IoT, SMEs innovation and sustainable growth strategy. Specifically, we conduct intensive individual interviews to find IoT inherent innovation attributes and a case study to explore the process of linking these attributes to innovation-driving paths. Findings - The analysis results reveal that there exist disruptive and open innovation attributes in the IoT industry that enable IoT-SMEs to enhance their structure and process related capabilities, to create business models for products and services and to collaborate with external parties in marketing to enter the market. We excavate practical insights into driving innovation based on IoT attributes and suggest enabling paths for pursuing innovation and entering overseas markets for IoT-SMEs. Originality/value - This study investigates an underexplored significant area of research on the relationship between IoT attributes and innovation paths. The findings provide profound theoretical and practical implications. To the best of the author’s knowledge, it is the first attempt to link disruptive and open IoT attributes to innovation paths of IoT-SMEs. The results provide directions for pursuing effective innovation in responding to the IoT market for sustainable growth.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Enforcement. 411.410 Section 411.410 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING Penalties and Enforcement § 411.410 Enforcement. The head of each agency shall take such actions as are necessary to ensure that...
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Definitions. 411.105 Section 411.105 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING General § 411.105 Definitions. For purposes of this part: (a) Agency, as defined in 5 U.S.C. 552(f), includes Federal executive...
EUFEMED London Conference 2017: Exploratory Medicines Development: Innovation and Risk Management
Directory of Open Access Journals (Sweden)
Luc Van Bortel
2018-01-01
Full Text Available The first formal conference of the EUropean Federation for Exploratory MEdicines Development (EUFEMED held in London was the result of a collaborative effort of its founding associations: the Association for Applied Human Pharmacology (AGAH; Germany, the Association for Human Pharmacology in the Pharmaceutical Industry (AHPPI; UK, the Belgian Association of Phase-I Units (BAPU; Belgium, and Club Phase-I (France. The conference focused on innovation and risk management in early clinical drug development. Among other innovations, immunotherapy in oncology and inflammatory diseases were discussed as well as the importance of adaptive trial designs in early clinical drug development. Consideration was given to assessing and mitigating risk in early clinical drug development, and included a preconference workshop. Different measures to minimize risks in healthy volunteers and patients in first-in-human trials were discussed in addition to the importance of non-clinical data, the need for reliable biomarkers, improved communication on adverse events (AEs and well-trained study sites with ready access to intensive care units and clinical specialists. The need for a European-wide system for prevention of over-volunteering was also discussed. The conference provided opportunity to discuss these developments and concerns and the changing regulatory environment with stakeholders from academia, industry, and regulatory agencies including the European Medicines Agency (EMA. Presentations given by invited speakers are published on http://www.eufemed.eu/london-conference-2017/.
EUFEMED London Conference 2017: Exploratory Medicines Development: Innovation and Risk Management.
Van Bortel, Luc; Sourgens, Hildegard; Breithaupt-Grögler, Kerstin; Caplain, Henri; Donazzolo, Yves; Klingmann, Ingrid; Hammond, Michael; Hardman, Timothy C; Stringer, Steffan; de Hoon, Jan
2017-01-01
The first formal conference of the EUropean Federation for Exploratory MEdicines Development (EUFEMED) held in London was the result of a collaborative effort of its founding associations: the Association for Applied Human Pharmacology (AGAH; Germany), the Association for Human Pharmacology in the Pharmaceutical Industry (AHPPI; UK), the Belgian Association of Phase-I Units (BAPU; Belgium), and Club Phase-I (France). The conference focused on innovation and risk management in early clinical drug development. Among other innovations, immunotherapy in oncology and inflammatory diseases were discussed as well as the importance of adaptive trial designs in early clinical drug development. Consideration was given to assessing and mitigating risk in early clinical drug development, and included a preconference workshop. Different measures to minimize risks in healthy volunteers and patients in first-in-human trials were discussed in addition to the importance of non-clinical data, the need for reliable biomarkers, improved communication on adverse events (AEs) and well-trained study sites with ready access to intensive care units and clinical specialists. The need for a European-wide system for prevention of over-volunteering was also discussed. The conference provided opportunity to discuss these developments and concerns and the changing regulatory environment with stakeholders from academia, industry, and regulatory agencies including the European Medicines Agency (EMA). Presentations given by invited speakers are published on http://www.eufemed.eu/london-conference-2017/.
2012-01-01
Présenté par FutuRIS, plate-forme prospective sur la recherche, l’innovation et la société animée par l’Association Nationale de la Recherche et de la Technologie, ce volume livre un panorama du système français de recherche et d’innovation dans son environnement européen. Sont abordés dans une première partie les champs décisionnels concernés, les politiques nationales menées en matière de R&D, les relations entre enseignement supérieur et recherche et l’Espace européen de la recherche à l’h...
12 CFR 411.405 - Penalty procedures.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Penalty procedures. 411.405 Section 411.405 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING Penalties and Enforcement § 411.405 Penalty procedures. Agencies shall impose and collect civil penalties pursuant to the...
30 CFR 7.411 - New technology.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false New technology. 7.411 Section 7.411 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR TESTING, EVALUATION, AND APPROVAL OF... Kits § 7.411 New technology. MSHA may approve cable products or splice kits that incorporate technology...
International Nuclear Information System (INIS)
Trianni, Andrea; Cagno, Enrico; Worrell, Ernst
2013-01-01
Additional efforts will be needed by European countries to improve the energy efficiency, as with current trends the 20% objective will be missed. Small and medium-sized enterprises (SMEs) manufacturing sector is a promising field, as SMEs are less energy-efficient than larger enterprises. Several studies investigated the barriers to the diffusion of technologies and practices for industrial energy efficiency, but little attention has been paid to understand the factors affecting the perception of such barriers by SMEs. In this multiple case-study, we have investigated 20 Primary Metal manufacturing SMEs in Northern Italy. Economic and information barriers are perceived as the major issues. Interestingly, firm's size, innovativeness of the market in which enterprises operate, as well as product and process innovation are factors affecting barriers to energy efficiency. Differences have been observed within SMEs, especially for information and competence-related barriers. In particular, a more innovative external context in which enterprises operate and a greater production process complexity seem to reduce barriers. Moreover, more product innovative enterprises seem to have a lower perception of behavioral and technology-related barriers. The results of this exploratory investigation provide useful suggestions for policy design and further research on industrial energy efficiency. - highlights: • Economic and Information emerge as the most relevant barriers to energy efficiency. • Market, product and process innovation seem relevant factors affecting barriers. • Firm's size is a factor affecting barriers' perception
48 CFR 9904.411-40 - Fundamental requirement.
2010-10-01
... ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.411-40 Fundamental requirement. (a) The contractor shall... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Fundamental requirement. 9904.411-40 Section 9904.411-40 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD...
The influence of market orientation on innovation strategies
Newman, Alexander; Prajogo, Daniel; Atherton, Andrew
2016-01-01
Purpose This study examines the effects of market orientation on exploratory and exploitative innovation, and the moderating effects of family ownership on these relationships. Design/methodology/approach This study utilizes multi-group path analysis and confirmatory factor analysis in LISREL on data from 228 firms in the Australian service sector. Findings This study establishes that both customer and competitor innovation are positively related to exploitative and exploratory innovation. Ho...
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Stipulations. 4.11 Section 4.11 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE RULES OF PRACTICE GOVERNING PROCEEDINGS UNDER THE ANIMAL WELFARE ACT Supplemental Rules of...
12 CFR 411.110 - Certification and disclosure.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Certification and disclosure. 411.110 Section 411.110 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING General § 411.110 Certification and disclosure. (a) Each person shall file a certification, and a disclosure...
46 CFR 108.411 - Smoke detection system.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Smoke detection system. 108.411 Section 108.411 Shipping... EQUIPMENT Fire Extinguishing Systems § 108.411 Smoke detection system. Each smoke accumulator in a smoke detection system must be located on the overhead of the compartment protected by the system in a location...
12 CFR 411.605 - Inspector General report.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Inspector General report. 411.605 Section 411.605 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING Agency Reports § 411.605 Inspector General report. (a) The Inspector General, or other official as specified in...
12 CFR 411.600 - Semi-annual compilation.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Semi-annual compilation. 411.600 Section 411.600 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING Agency Reports § 411.600 Semi-annual compilation. (a) The head of each agency shall collect and compile the...
12 CFR 411.500 - Secretary of Defense.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Secretary of Defense. 411.500 Section 411.500 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING Exemptions § 411.500 Secretary of Defense. (a) The Secretary of Defense may exempt, on a case-by-case basis, a covered...
DEFF Research Database (Denmark)
Persson, Morten; Skovgaard, Dorthe; Brandt-Larsen, Malene
2015-01-01
A first-in-human clinical trial with Positron Emission Tomography (PET) imaging of the urokinase-type plasminogen activator receptor (uPAR) in patients with breast, prostate and bladder cancer, is described. uPAR is expressed in many types of human cancers and the expression is predictive...... for targeted molecular imaging with PET. The safety, pharmacokinetic, biodistribution profile and radiation dosimetry after a single intravenous dose of (64)Cu-DOTA-AE105 were assessed by serial PET and computed tomography (CT) in 4 prostate, 3 breast and 3 bladder cancer patients. Safety assessment...... of invasion, metastasis and indicates poor prognosis. uPAR PET imaging therefore holds promise to be a new and innovative method for improved cancer diagnosis, staging and individual risk stratification. The uPAR specific peptide AE105 was conjugated to the macrocyclic chelator DOTA and labeled with (64)Cu...
Innovative problem solving by wild spotted hyenas
Benson-Amram, Sarah; Holekamp, Kay E.
2012-01-01
Innovative animals are those able to solve novel problems or invent novel solutions to existing problems. Despite the important ecological and evolutionary consequences of innovation, we still know very little about the traits that vary among individuals within a species to make them more or less innovative. Here we examine innovative problem solving by spotted hyenas (Crocuta crocuta) in their natural habitat, and demonstrate for the first time in a non-human animal that those individuals exhibiting a greater diversity of initial exploratory behaviours are more successful problem solvers. Additionally, as in earlier work, we found that neophobia was a critical inhibitor of problem-solving success. Interestingly, although juveniles and adults were equally successful in solving the problem, juveniles were significantly more diverse in their initial exploratory behaviours, more persistent and less neophobic than were adults. We found no significant effects of social rank or sex on success, the diversity of initial exploratory behaviours, behavioural persistence or neophobia. Our results suggest that the diversity of initial exploratory behaviours, akin to some measures of human creativity, is an important, but largely overlooked, determinant of problem-solving success in non-human animals. PMID:22874748
de la nature de l’innovation (The nature of innovation)
Rémy Volpi
2006-01-01
Marx par la lutte des classes, Schumpeter par l’innovation, concluent que le capitalisme par nature s’autodétruit. Mais, alors que pour Marx le capitalisme rend les riches plus riches tandis que leurs rangs s’étiolent, et les pauvres plus pauvres et plus nombreux, pour Schumpeter, le capitalisme démocratise la consommation. Et pour Galbraith, l’opulence est réelle, mais obtenue au prix de l’instrumentalisation du consommateur. D’autres auteurs imaginent que pour faire reprendre des couleurs à...
77 FR 25469 - Applications for New Awards; Investing in Innovation Fund, Validation
2012-04-30
... DEPARTMENT OF EDUCATION Applications for New Awards; Investing in Innovation Fund, Validation Catalog of Federal Domestic Assistance (CFDA) Number: 84.411B (Validation grants). AGENCY: Office of... fiscal year 2012 for the Investing in Innovation (i3) Validation grant competition (March 27 i3...
50 CFR 660.411 - Notification and publication procedures.
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Notification and publication procedures. 660.411 Section 660.411 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC... West Coast Salmon Fisheries § 660.411 Notification and publication procedures. (a) Notification and...
Crowdsourcing business model innovation
DEFF Research Database (Denmark)
Waldner, Florian; Poetz, Marion Kristin; Bogers, Marcel
2016-01-01
Successfully adapting existing business models or developing new ones significantly influences a firm’s ability to generate profits and develop competitive advantages. However, business model innovation is perceived as a complex, risky and uncertain process and its success strongly depends...... on whether or not the firm is capable of understanding and addressing their customers’ needs. We conduct a quantitative exploratory case study to investigate how crowdsourcing-based search approaches among user communities can contribute to developing business model innovation. Drawing on data from...... a crowdsourcing initiative designed to develop ideas for new business models in the podcast industry, we provide first exploratory insights into the value of crowdsourcing for innovating a firm’s way of creating, delivering and capturing value, and discuss characteristics of crowd-contributors that influence...
Directory of Open Access Journals (Sweden)
Marlene Johansson
2014-08-01
Full Text Available Purpose: The purpose of this article is to investigate how business models are used by born global firms to act upon new business opportunities and how they manage business model innovation over time to prosper and grow. Design/Methodology: The study is based on three exploratory case studies of born global firms in mobile communication, financial services and digital music distribution. Findings: Three interrelated capabilities to manage business model innovation are articulated in the context of born global firms; sensing capabilities, entrepreneurial capabilities and relational capabilities and four propositions are formulated. We find that business model innovations are used as a tool by maturing born global firms to navigate the value chains and achieve international growth. We further propose that born global need the capabilities to balance different business model designs simultaneously and to manage its business model innovation in a timely manner. Originality: This article contributes to both the business model literature and research of international entrepreneurship. By putting business model research into the dynamic context of rapidly internationalizing born global firms, we contribute to the field of business model research with findings of how business models are used in the internationalization processes. Certain capabilities are needed to manage business model innovation for born global firms to dynamically use business models as a tool in the international growth overtime.
Innovations in the restaurant industry: An exploratory study
Directory of Open Access Journals (Sweden)
Ivkov Milan
2016-01-01
Full Text Available This paper tends to identify managers' current innovation activities and attitudes, and also perceptions of what might become future trends and the prospective course in the restaurant industry. Additionally, this paper analyses linkage between sociodemographic profile of managers and a type of innovation they prefer/apply. Full service casual dining restaurant managers from three different countries were interviewed in order to examine their attitudes towards innovations, and to reveal their perceptions of future trends. ANOVA was used to reveal differences between managers' attitudes towards the area of innovation. The results of qualitative study highlight five areas of innovation that could help managers create value based service and increase competitiveness. It is found that age, education level and experience of the restaurant managers affect the innovation type they apply. Additionally, this paper is the first to examine the linkage between socio-demographic profile of restaurant managers and a type of innovation they apply. It offers useful guidelines for hospitality managers.
12 CFR 411.300 - Professional and technical services.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Professional and technical services. 411.300 Section 411.300 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING Activities by Other Than Own Employees § 411.300 Professional and technical services. (a) The prohibition on...
12 CFR 411.205 - Professional and technical services.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Professional and technical services. 411.205 Section 411.205 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING Activities by Own Employees § 411.205 Professional and technical services. (a) The prohibition on the use of...
12 CFR 411.200 - Agency and legislative liaison.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Agency and legislative liaison. 411.200 Section 411.200 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING Activities by Own Employees § 411.200 Agency and legislative liaison. (a) The prohibition on the use of...
42 CFR 411.361 - Reporting requirements.
2010-10-01
... information concerning his or her financial relationships in accordance with this section is subject to a... 42 Public Health 2 2010-10-01 2010-10-01 false Reporting requirements. 411.361 Section 411.361... PROGRAM EXCLUSIONS FROM MEDICARE AND LIMITATIONS ON MEDICARE PAYMENT Financial Relationships Between...
30 CFR 77.411 - Compressed air and boilers; general.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Compressed air and boilers; general. 77.411 Section 77.411 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL MINE... COAL MINES Safeguards for Mechanical Equipment § 77.411 Compressed air and boilers; general. All...
Creative Climate: A Leadership Lever for Innovation
Isaksen, Scott G.; Akkermans, Hans J.
2011-01-01
The working atmosphere within an organization has an important influence on its level of innovative productivity. Organizational leaders influence innovative productivity as well as the climate for creativity and innovation. This exploratory study included 140 respondents from 103 different organizations, 31 industries, and 10 countries, all of…
CFD analysis of PAR performance as function of inlet design
International Nuclear Information System (INIS)
Park, Kweonha; Khor, Chong Lee
2016-01-01
Highlights: • The new concept of PAR (passive autocatalytic recombiner) was proposed and analyzed. • Guidance wall was added at the bottom of PAR to enhance the flow rate through the catalyst. • The new concept of PAR was proved to have a better hydrogen removal performance. - Abstract: Passive autocatalytic recombiner (PAR) is very useful hydrogen mitigation measurement. It is widely implemented in the current and advanced light water reactors (ALWRs). The design of the PARs should be optimized for the specific use under severe accident scenarios. Several techniques and innovations have been fused into the PAR, as an effort to increase its efficiency of hydrogen mitigation. This study proposes different concepts of PAR, which applied some changes to the honeycomb catalyst PAR made by the Korea Nuclear Technology (KNT) Inc. Two slices of plate are added to the bottom of PAR model, which intended to act as a reflection wall and promote the gas flow into PAR. Hydrogen volume fraction was given 4 vol. % which tested by KNT to investigate the performance of PAR in different direction gas flow conditions to see maximum hydrogen recombination rate. The new concept of PAR was proved to have a better hydrogen removal performance compared to the original honeycomb catalyst PAR.
CFD analysis of PAR performance as function of inlet design
Energy Technology Data Exchange (ETDEWEB)
Park, Kweonha, E-mail: khpark@kmou.ac.kr [Division of Mechanical and Energy systems Engineering, Korea Maritime University, Dongsam-dong, Yeongdo-gu, Busan 606-791 (Korea, Republic of); Khor, Chong Lee, E-mail: itachi_829@hotmail.com [Department of Mechanical Engineering, Korea Maritime University (Korea, Republic of)
2016-01-15
Highlights: • The new concept of PAR (passive autocatalytic recombiner) was proposed and analyzed. • Guidance wall was added at the bottom of PAR to enhance the flow rate through the catalyst. • The new concept of PAR was proved to have a better hydrogen removal performance. - Abstract: Passive autocatalytic recombiner (PAR) is very useful hydrogen mitigation measurement. It is widely implemented in the current and advanced light water reactors (ALWRs). The design of the PARs should be optimized for the specific use under severe accident scenarios. Several techniques and innovations have been fused into the PAR, as an effort to increase its efficiency of hydrogen mitigation. This study proposes different concepts of PAR, which applied some changes to the honeycomb catalyst PAR made by the Korea Nuclear Technology (KNT) Inc. Two slices of plate are added to the bottom of PAR model, which intended to act as a reflection wall and promote the gas flow into PAR. Hydrogen volume fraction was given 4 vol. % which tested by KNT to investigate the performance of PAR in different direction gas flow conditions to see maximum hydrogen recombination rate. The new concept of PAR was proved to have a better hydrogen removal performance compared to the original honeycomb catalyst PAR.
42 CFR 411.386 - CMS's advisory opinions as exclusive.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false CMS's advisory opinions as exclusive. 411.386... Relationships Between Physicians and Entities Furnishing Designated Health Services § 411.386 CMS's advisory... described in § 411.370. CMS has not and does not issue a binding advisory opinion on the subject matter in...
42 CFR 411.379 - When CMS accepts a request.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false When CMS accepts a request. 411.379 Section 411.379... Physicians and Entities Furnishing Designated Health Services § 411.379 When CMS accepts a request. (a) Upon receiving a request for an advisory opinion, CMS promptly makes an initial determination of whether the...
Paradoxes and Innovation in Family Firms
DEFF Research Database (Denmark)
Ingram, Amy E.; Lewis, Marianne W.; Barton, Sid
2016-01-01
thinkers are more likely to manage these tensions and fuel innovative behavior. Leveraging family business and organizational paradox literatures, this multi-stage exploratory study develops measures of paradoxical tensions and paradoxical thinking in family firms, and tests these propositions. Findings...... indicate that paradoxical tensions may stymie innovative behavior, but that leaders' paradoxical thinking is positively related to innovative behavior....
47 CFR 90.411 - Civil defense communications.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Civil defense communications. 90.411 Section 90... PRIVATE LAND MOBILE RADIO SERVICES Operating Requirements § 90.411 Civil defense communications. The... necessary for the implementation of civil defense activities assigned such station by local civil defense...
12 CFR 411.100 - Conditions on use of funds.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Conditions on use of funds. 411.100 Section 411.100 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING General § 411.100 Conditions on use of funds. (a) No appropriated funds may be expended by the recipient of a...
40 CFR 411.20 - Applicability; description of the leaching subcategory.
2010-07-01
... leaching subcategory. 411.20 Section 411.20 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS CEMENT MANUFACTURING POINT SOURCE CATEGORY Leaching Subcategory § 411.20 Applicability; description of the leaching subcategory. The provisions of this subpart are...
77 FR 25469 - Applications for New Awards; Investing in Innovation Fund, Scale-Up Grants
2012-04-30
... DEPARTMENT OF EDUCATION Applications for New Awards; Investing in Innovation Fund, Scale- Up Grants Catalog of Federal Domestic Assistance (CFDA) Number: 84.411A (Scale-up grants). AGENCY: Office of... fiscal year 2012 for the Investing in Innovation (i3) Scale-up grant competition (March 27 i3 Scale-up...
Innovation clusters and determinants of innovativeness in manufacturing industries
Sevinç, M.; Ulusoy, G.
2016-01-01
Innovation is an important source of competitiveness and is studied extensively by both the academicians and the practitioners particularly in the last decades. This study is based on the results of an exploratory study conducted in the Northern Marmara region of Turkey covering 184 manufacturing
12 CFR Appendix A to Part 411 - Certification Regarding Lobbying
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Certification Regarding Lobbying A Appendix A to Part 411 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING Pt. 411, App. A Appendix A to Part 411—Certification Regarding Lobbying Certification for Contracts...
Open innovation in SMEs : trends, motives and management challenges
Vrande, van de V.J.A.; Jong, de J.P.J.; Vanhaverbeke, W.P.M.; Rochemont, de M.H.
2009-01-01
Open innovation has so far been studied mainly in high-tech, multinational enterprises. This exploratory paper investigates if open innovation practices are also applied by small- and medium-sized enterprises (SMEs). Drawing on a database collected from 605 innovative SMEs in the Netherlands, we
Directory of Open Access Journals (Sweden)
Delin Zeng
2017-11-01
Full Text Available To achieve sustainable development, focal firms should balance two paradoxical kinds of innovation activities: exploitative and exploratory ones. Published works found that ambidexterity is an effective way to resolve paradoxical tensions, but few in-depth studies have been conducted to explore the innovation paradox of focal firms in the innovation ecosystem from an ambidextrous capability perspective. This paper takes China Spacesat Co., Ltd. as the case to study focal firms’ management of innovation paradoxes in the sustainable innovation ecosystem and finds that: (1 Sustainable innovation is an ecosystem in which focal firms’ internal functional departments, including the product department, technical center, and Makers’ groups, cooperate with external organizations, including component suppliers, scientific research institutes, and government departments, closely and complementarily; (2 In the exploitative and exploratory innovations of complex products, focal firms in the sustainable innovation ecosystem mainly confront three paradoxes: profit drive vs. breakthroughs in the strategic intent of sustainable innovation of the profit-driven model, tight vs. loose coupling of sustainable innovation, and sustainable innovation driven by discipline vs. that by passion; (3 Focal firms in the innovation ecosystem resolve these three innovation paradoxes with structural, contextual, and coordinated ambidextrous capabilities, and build innovation paradox management mechanisms with three steps in sequence, namely by establishing dual sustainable strategic innovation units, strengthening sustainable organizational ties between the internal and external, while co-creating and sharing innovation values, and, finally, promoting the formation and development of their sustainable innovation ecosystem. This paper complements and enriches the innovation ecosystem and ambidextrous capability theory, providing significant practical guidance to the
5 CFR 843.411 - Direct payments to children.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Direct payments to children. 843.411... REGULATIONS (CONTINUED) FEDERAL EMPLOYEES RETIREMENT SYSTEM-DEATH BENEFITS AND EMPLOYEE REFUNDS Child Annuities § 843.411 Direct payments to children. For purposes of section 8466(c) of title 5, United States...
48 CFR 411.170 - Brand name or equal.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Brand name or equal. 411... ACQUISITION PLANNING DESCRIBING AGENCY NEEDS Selecting and Developing Requirements Documents 411.170 Brand name or equal. (a) A “brand name or equal” purchase description shall include the following type of...
THE CONTRIBUTION OF INNOVATION SYSTEMS AND ORGANIZATIONAL CULTURE FOR INNOVATION GENERATION
Directory of Open Access Journals (Sweden)
Elaine da Silva
2018-04-01
Full Text Available Introduction: Emphasizes the role of innovation in the Information and Knowledge Society as a favorable element of developing regional, national and global levels. Objective: The aim is reflect about the coming of innovation in the context of production systems and their respective role for the development of society. Methodology: The research sets up a qualitative approach to literature and exploratory nature. Results: As from selected literature review, presents conceptual aspects of innovation in the context of production systems and analyzes its contribution to the national innovation system and the role of organizational culture focused on innovation. Conclusions: Think about innovation from the systemic approach, based on the interaction of the different relevant agents to influence and contribute to the generation of innovation is fundamental in the current conjuncture, characterized by the agility of the transformations in social, economic, political and technological contexts.
17 CFR 256.411.5 - Investment tax credit.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Investment tax credit. 256.411... HOLDING COMPANY ACT OF 1935 Income and Expense Accounts § 256.411.5 Investment tax credit. (a) This account shall be debited with the amounts of investment tax credits related to service company property...
International Nuclear Information System (INIS)
Gorbunov, N.V.; Karev, A.G.; Mal'tsev, Eh.I.; Morozov, B.A.
1985-01-01
The VD-411 branch driver for CAMAC moduli control by the SM-4 computer is described. The driver realizes data exchange with moduli disposed in 28 crates grouped in 4 branches. Data exchange can be carried out either in the program regime or in the regime of direct access to the memory. Fulfilment of 11 block regimes and one program regime is provided for. A possibility of individual programming of exchange methods in block regimes is left for users for organisation of quicker and most flexible data removal from the CAMAC moduli. In the regime of direct access the driver provides data transmission at the size up to 64 Kwords placing it in the computer memory of 2 M byte. High rate of data transmission and the developed system of interruptions ensure efficient utilization of the VD-411 branch driver at data removal from facilities in high energy physics experiments
42 CFR 411.51 - Beneficiary's responsibility with respect to no-fault insurance.
2010-10-01
...-fault insurance. 411.51 Section 411.51 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES... PAYMENT Limitations on Medicare Payment for Services Covered Under Liability or No-Fault Insurance § 411.51 Beneficiary's responsibility with respect to no-fault insurance. (a) The beneficiary is...
48 CFR 32.411 - Agreement for special account at a financial institution.
2010-10-01
... account at a financial institution. 32.411 Section 32.411 Federal Acquisition Regulations System FEDERAL... Items 32.411 Agreement for special account at a financial institution. The contracting officer must use... Contractor), and ____, a financial institution operating under the laws of ____, located at ____ (the...
Constellations-driven innovation
DEFF Research Database (Denmark)
Hansbøl, Mikala
2011-01-01
The paper presents a science and technology studies and actor-network-theory inspired approach to understanding the development and ongoing re-didactication and re-design of a Danish developed presentation tool called the Theme Board (Tematavlen.dk). It is argued that this approach provides a par...... a particularly useful point of departure for engaging in researching innovation and didactic design of digital teaching and learning instruments such as the Theme Board that are programmed and serviced 'in the sky'. I call this approach: constellation-driven innovations....
Bogers, Marcel; Sproedt, Henrik
2012-01-01
This article explores how playing games can be used to teach intangible social interaction across boundaries, in particular within open collaborative innovation. We present an exploratory case study of how students learned from playing a board game in a graduate course of the international and interdisciplinary Innovation and Business master's…
Evaluating effectiveness of project start-ups: an exploratory study
Halman, Johannes I.M.; Burger, G.T.N.
In this paper an exploratory study is reported about the effectiveness of project start-up (PSU) practices within a world-scale operating, high technology innovating and manufacturing company. The emphasis is on the focal position of both project owner and project manager. To uncover potential
Cederman, L.-E.; Conte, R.; Helbing, D.; Nowak, A.; Schweitzer, F.; Vespignani, A.
2012-11-01
A huge flow of quantitative social, demographic and behavioral data is becoming available that traces the activities and interactions of individuals, social patterns, transportation infrastructures and travel fluxes. This has caused, together with innovative computational techniques and methods for modeling social actions in hybrid (natural and artificial) societies, a qualitative change in the ways we model socio-technical systems. For the first time, society can be studied in a comprehensive fashion that addresses social and behavioral complexity. In other words we are in the position to envision the development of large data and computational cyber infrastructure defining an exploratory of society that provides quantitative anticipatory, explanatory and scenario analysis capabilities ranging from emerging infectious disease to conflict and crime surges. The goal of the exploratory of society is to provide the basic infrastructure embedding the framework of tools and knowledge needed for the design of forecast/anticipatory/crisis management approaches to socio technical systems, supporting future decision making procedures by accelerating the scientific cycle that goes from data generation to predictions.
Women Entrepreneurship and Innovations in India: An Exploratory Study
Directory of Open Access Journals (Sweden)
Hemantkumar P. Bulsara
2014-06-01
Full Text Available Increased female entrepreneurial activity heralds a progress for women’s rights and optimization of their economic and social living index. Women entrepreneurship is synonymous with women empowerment. Parallel to the male counterparts, female entrepreneurs are catalytic in job creation, innovation and more than tangible contribution to the GNP of the country. An economy thrives when women get a level playing field as men. Innovation works as a catalyst or an instrument for Entrepreneurship. Indian Women, despite all the social hurdles stand tall from the rest of the crowd and are applauded for their achievements in their respective field. The transformation of social fabric of the Indian society, in terms of increased educational status of women and varied aspirations for better living, necessitated a change in the life style of Indian women. This paper endeavors to explore studies related to Women Entrepreneurship and Innovation in India. Few examples from Gujarat, India have been taken to understand the study in a better way. Keywords: Women Entrepreneurship; Innovation; Entrepreneurship; India; Economy; Gujarat.
40 CFR 411.30 - Applicability; description of the materials storage piles runoff subcategory.
2010-07-01
... materials storage piles runoff subcategory. 411.30 Section 411.30 Protection of Environment ENVIRONMENTAL... Materials Storage Piles Runoff Subcategory § 411.30 Applicability; description of the materials storage piles runoff subcategory. The provisions of this subpart are applicable to discharges resulting from the...
Innovation pedagogy in the MARIHE program : A case study on faculty perceptions
Godonoga, Ana; Güney, Isil; Kopelyan, Sofya; Yasmin, Nowreen; Holz, Oliver; Aleksandrovich, Maria; Zoglowek, Herbert
2016-01-01
The paper promotes awareness of innovation pedagogy in European higher education by presenting the results of a mixed methods exploratory case study on faculty perceptions of innovation pedagogy standards in a Joint Master Degree program in Research and Innovation in Higher Education (MaRIHE) and on
12 CFR Appendix B to Part 411 - Disclosure Form To Report Lobbying
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Disclosure Form To Report Lobbying B Appendix B to Part 411 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING Pt. 411, App. B Appendix B to Part 411—Disclosure Form To Report Lobbying EC23SE91.003 EC23SE91.004...
Engel, P.G.H.
1995-01-01
This study focuses upon the social organization of innovation. It makes use of insights from knowledge and information systems research, development sociology, management science and applied philosophy and seeks answers to the following questions: What do social actors, individuals and/or organizations, actually do to innovate their practices? How do they organize themselves? Can this be managed or facilitated, and if so, how? The research is exploratory rather than concl...
26 CFR 1.411(d)-1 - Coordination of vesting and discrimination requirements. [Reserved
2010-04-01
... 26 Internal Revenue 5 2010-04-01 2010-04-01 false Coordination of vesting and discrimination requirements. [Reserved] 1.411(d)-1 Section 1.411(d)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF... Plans, Etc. § 1.411(d)-1 Coordination of vesting and discrimination requirements. [Reserved] ...
Directory of Open Access Journals (Sweden)
Andre Grutzmann
2013-04-01
Full Text Available Online social networks made up of actors with different degrees of innovativeness may allow knowledge management to collect new ideas and measure their acceptance. This research investigates consumer innovativeness and relationships with the uses and participation in social networks. This research has a quantitative exploratory scope, and among the main findings, we can mention that the dimensions of the adopted scale were corroborated by using factor analysis. The findings cannot be generalized, but there are evidences that relationship between social networking and innovative consumer behavior exists. Although there are limitations, correlations were found between the social dimension of innovativeness and information search in the networks and also the use of social networking information for the decision to purchase new products.
17 CFR 256.411 - Provision for deferred income taxes-credit.
2010-04-01
... taxes-credit. 256.411 Section 256.411 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... deferred income taxes—credit. This account shall be credited and Accumulated Deferred Income Taxes debited with an amount equal to the portion of taxes on income payable for the year which is attributable to a...
18 CFR 367.105 - Accounts 411.4, and 411.5, Investment tax credit adjustments.
2010-04-01
....5, Investment tax credit adjustments. 367.105 Section 367.105 Conservation of Power and Water... tax credit adjustments. (a) Account 411.4 (§ 367.4114) must be debited with the amounts of investment tax credits related to service company property that are credited to account 255, Accumulated deferred...
42 CFR 411.382 - CMS's right to rescind advisory opinions.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false CMS's right to rescind advisory opinions. 411.382... Relationships Between Physicians and Entities Furnishing Designated Health Services § 411.382 CMS's right to rescind advisory opinions. Any advice CMS gives in an opinion does not prejudice its right to reconsider...
Energy Technology Data Exchange (ETDEWEB)
Cook, M.; Maggs, H.; Neame, C.; Lemon, M. [The School of Applied Sciences, Cranfield University, Cranfield, Bedfordshire (United Kingdom)
2006-09-15
The need to improve the environmental performance of production and consumption practices within advanced industrialised nations is widely accepted. Finding ways to satisfy demand using far fewer resources is central to research in this field. For many, the trajectories of service orientated products are thought to provide an opportunity to address this need and anticipate futures in which economic growth is de-coupled from resource use. This paper presents the findings of exploratory research in the air-conditioning and cooling sector, which sought to understand how these benefits might be realised. It suggests that these benefits will not arise as a result of economic restructuring but rather that a deeper understanding of the process of service innovation, which underpins trajectories of service orientated products, is required to develop effective policy.
The marketing function in exploratory product innovation : contrasting different project types
Smits, A.A.J.; Dankbaar, B.; Vissers, G.
2011-01-01
This paper focuses on the marketing function in product innovation projects in established b-t-b firms. The marketing function in an innovation project is a term to denote both the project members that connect the project to customers or, more broadly, the market, and their activities in innovation
Directory of Open Access Journals (Sweden)
Silvye Ane Massaini
2015-01-01
Full Text Available Innovation networks have been identified in the literature as a way to complement firms’ innovative capabilities through collaboration with other partners. To provide empirical evidence for this assertion, this paper investigates the contribution of partners established in innovation networks for innovative performance of firms in the Brazilian electricalelectronics industry. For this purpose, we carried out an exploratory and descriptive survey among 185 companies. The data were analyzed using structural equation modeling (SEM. As the main findings, we observed that the establishment of collaborative relationships with customers, competitors and universities/research institutions can contribute to organizational and process innovation. However, despite obtaining some significant results concerning the contribution of different partners in the network, electrical-electronics industry companies also attach great importance to internal activities to develop their innovations.
Business Model Innovation in Airlines
Directory of Open Access Journals (Sweden)
Bruno Alencar Pereira
2017-03-01
Full Text Available The business models innovation in airlines can contribute to the creation of value, competitive advantage and profitability with new possibilities of action. The proposed paper aimed to identify the business models adopted by airlines and identify how the innovation occurs at these organizations. The methodology adopted is characterized as empirical, exploratory and descriptive research by multiple case study with three major Brazilian airlines. The results demonstrate that the search for paradigm breaks, related to the dichotomic traditional models of low-cost and full-service, toward hybrid business models occur linearly, as examples highlighted by companies, in which internal changes in business models are considered major organizational innovations.
40 CFR 98.411 - Reporting threshold.
2010-07-01
...) MANDATORY GREENHOUSE GAS REPORTING Suppliers of Industrial Greenhouse Gases § 98.411 Reporting threshold. Any supplier of industrial greenhouse gases who meets the requirements of § 98.2(a)(4) must report GHG...
An economic and financial exploratory
Cincotti, S.; Sornette, D.; Treleaven, P.; Battiston, S.; Caldarelli, G.; Hommes, C.; Kirman, A.
2012-11-01
This paper describes the vision of a European Exploratory for economics and finance using an interdisciplinary consortium of economists, natural scientists, computer scientists and engineers, who will combine their expertise to address the enormous challenges of the 21st century. This Academic Public facility is intended for economic modelling, investigating all aspects of risk and stability, improving financial technology, and evaluating proposed regulatory and taxation changes. The European Exploratory for economics and finance will be constituted as a network of infrastructure, observatories, data repositories, services and facilities and will foster the creation of a new cross-disciplinary research community of social scientists, complexity scientists and computing (ICT) scientists to collaborate in investigating major issues in economics and finance. It is also considered a cradle for training and collaboration with the private sector to spur spin-offs and job creations in Europe in the finance and economic sectors. The Exploratory will allow Social Scientists and Regulators as well as Policy Makers and the private sector to conduct realistic investigations with real economic, financial and social data. The Exploratory will (i) continuously monitor and evaluate the status of the economies of countries in their various components, (ii) use, extend and develop a large variety of methods including data mining, process mining, computational and artificial intelligence and every other computer and complex science techniques coupled with economic theory and econometric, and (iii) provide the framework and infrastructure to perform what-if analysis, scenario evaluations and computational, laboratory, field and web experiments to inform decision makers and help develop innovative policy, market and regulation designs.
20 CFR 411.595 - What oversight procedures are planned for the EN payment systems?
2010-04-01
... EN payment systems? 411.595 Section 411.595 Employees' Benefits SOCIAL SECURITY ADMINISTRATION THE TICKET TO WORK AND SELF-SUFFICIENCY PROGRAM Employment Network Payment Systems § 411.595 What oversight procedures are planned for the EN payment systems? We use audits, reviews, studies and observation of daily...
2010-01-01
... COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY FAIR CREDIT REPORTING General Provisions § 41.1 Purpose. (a) Purpose. The purpose of this part is to establish standards for national banks regarding consumer report information. In addition, the purpose of this part is to specify the extent to which...
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Reports. 4.11 Section 4... Reports. Representatives of the Commission will inspect the project works, engineering reports, and other... report of their findings with respect to the inventory, appraisal, original cost, accrued depreciation...
2010-10-01
... Under Group Health Plans: General Provisions § 411.101 Definitions. As used in this subpart and in... individual States, Puerto Rico, the Virgin Islands, Guam, American Samoa, the Northern Mariana Islands, and... taxes on employers and employees under section 21 of the Internal Revenue Code. Group health plan (GHP...
Crowdsourcing Business Model Innovation
DEFF Research Database (Denmark)
Waldner, Florian; Poetz, Marion
Successfully adapting existing business models or developing new ones significantly influences a firm?s ability to generate profits and develop competitive advantages. However, business model innovation is perceived as a complex, risky and uncertain process and its success strongly depends...... on whether or not firms are capable of understanding and addressing their customers? needs. This study explores how crowdsourcing-based search approaches can contribute to the process of business model innovation. Drawing on data from a crowdsourcing initiative designed to develop ideas for new business...... models in the podcast industry, we provide first exploratory insights into the value of crowdsourcing for innovating a firm?s business model, and discuss which characteristics of crowd-contributors increase the quantity and quality of the outcome....
miR-411-5p inhibits proliferation and metastasis of breast cancer cell via targeting GRB2
International Nuclear Information System (INIS)
Zhang, Yunda; Xu, Guoxing; Liu, Gang; Ye, Yongzhi; Zhang, Chuankai; Fan, Chuannan; Wang, Haibin; Cai, Huali; Xiao, Rui; Huang, Zhengjie; Luo, Qi
2016-01-01
miR-411-5p (previously called miR-411) is severely involved in human diseases, however, the relationship between miR-411-5p and breast cancer has not been investigated thoroughly. Here, we found that the expression of miR-411-5p was downregulated in breast cancer tissues compared with their matched adjacent non-neoplastic tissues. In addition, the expression of miR-411-5p was also lower in breast cancer cell lines in contrast with MCF-10A. Moreover, we investigated the target and mechanism of miR-411-5p in breast cancer using mimic and inhibitor, and demonstrated the involvement of GRB2 and Ras activation. Ectopic expression of miR-411-5p suppressed the breast cancer cell proliferation, migration and invasion while low expression of miR-411-5p exhibited the opposite effect. Furthermore, GRB2 was demonstrated to be significantly overexpressed in breast cancer tissues compared with normal tissues, and low expression of GRB2 had a longer overall survival compared with high expression of GRB2 in breast cancer. In general, our study shed light on the miR-411-5p related mechanism in the progression of breast cancer and, miR-411-5p/GRB2/Ras axis is potential to be molecular target for breast cancer therapy. - Highlights: • miR-411-5p is downregulated in breast cancer tissues and cell lines. • miR-411-5p inhibits breast cancer cells growth, migration and invasion in vitro. • GRB2 is a direct target of miR-411-5p in breast cancer. • GRB2 is overexpressed in breast cancer and associates with disease outcome. • miR-411-5p suppresses breast cancer progression though GRB2-SOS-Ras pathway.
miR-411-5p inhibits proliferation and metastasis of breast cancer cell via targeting GRB2
Energy Technology Data Exchange (ETDEWEB)
Zhang, Yunda [Department of Gastrointestinal Surgery, First Affiliated Hospital of Xiamen University, Xiamen 361003 (China); State Key Laboratory of Cellular Stress Biology, Innovation Center for Cell Signaling Network, School of Life Sciences, Xiamen University, Xiamen 361102 (China); Xu, Guoxing [Department of Gastrointestinal Surgery, First Affiliated Hospital of Xiamen University, Xiamen 361003 (China); Department of Gastrointestinal Surgery, First Clinical Medical College of Fujian Medical University, Fuzhou 350005 (China); Liu, Gang; Ye, Yongzhi [Department of Gastrointestinal Surgery, First Affiliated Hospital of Xiamen University, Xiamen 361003 (China); Zhang, Chuankai [Department of Gastrointestinal Surgery, First Affiliated Hospital of Xiamen University, Xiamen 361003 (China); State Key Laboratory of Cellular Stress Biology, Innovation Center for Cell Signaling Network, School of Life Sciences, Xiamen University, Xiamen 361102 (China); Fan, Chuannan [State Key Laboratory of Cellular Stress Biology, Innovation Center for Cell Signaling Network, School of Life Sciences, Xiamen University, Xiamen 361102 (China); Wang, Haibin; Cai, Huali; Xiao, Rui [Department of Gastrointestinal Surgery, First Affiliated Hospital of Xiamen University, Xiamen 361003 (China); Department of Gastrointestinal Surgery, First Clinical Medical College of Fujian Medical University, Fuzhou 350005 (China); Huang, Zhengjie, E-mail: huangzhengjie@xmu.edu.cn [Department of Gastrointestinal Surgery, First Affiliated Hospital of Xiamen University, Xiamen 361003 (China); Department of Gastrointestinal Surgery, First Clinical Medical College of Fujian Medical University, Fuzhou 350005 (China); Luo, Qi, E-mail: luoqixmzsh@126.com [Department of Gastrointestinal Surgery, First Affiliated Hospital of Xiamen University, Xiamen 361003 (China); Department of Gastrointestinal Surgery, First Clinical Medical College of Fujian Medical University, Fuzhou 350005 (China)
2016-08-05
miR-411-5p (previously called miR-411) is severely involved in human diseases, however, the relationship between miR-411-5p and breast cancer has not been investigated thoroughly. Here, we found that the expression of miR-411-5p was downregulated in breast cancer tissues compared with their matched adjacent non-neoplastic tissues. In addition, the expression of miR-411-5p was also lower in breast cancer cell lines in contrast with MCF-10A. Moreover, we investigated the target and mechanism of miR-411-5p in breast cancer using mimic and inhibitor, and demonstrated the involvement of GRB2 and Ras activation. Ectopic expression of miR-411-5p suppressed the breast cancer cell proliferation, migration and invasion while low expression of miR-411-5p exhibited the opposite effect. Furthermore, GRB2 was demonstrated to be significantly overexpressed in breast cancer tissues compared with normal tissues, and low expression of GRB2 had a longer overall survival compared with high expression of GRB2 in breast cancer. In general, our study shed light on the miR-411-5p related mechanism in the progression of breast cancer and, miR-411-5p/GRB2/Ras axis is potential to be molecular target for breast cancer therapy. - Highlights: • miR-411-5p is downregulated in breast cancer tissues and cell lines. • miR-411-5p inhibits breast cancer cells growth, migration and invasion in vitro. • GRB2 is a direct target of miR-411-5p in breast cancer. • GRB2 is overexpressed in breast cancer and associates with disease outcome. • miR-411-5p suppresses breast cancer progression though GRB2-SOS-Ras pathway.
Norm for betonkonstruktioner DS411
DEFF Research Database (Denmark)
Hertz, Kristian
The fire chapter of the Danish Code of Practice for the structural use of concrete DS 411 contains methods and data for design of fire exposed concrete structures, all of them derived and documented by Kristian Hertz, who is a member of the two project teams writing the chapter. A considerable do...
MCSA Windows Server 2012 R2 administration study guide exam 70-411
Panek, William
2015-01-01
Complete exam coverage, hands-on practice, and interactive studytools for the MCSA: Administering Windows Server 2012 R2 exam70-411 MCSA: Windows Server 2012 R2 Administration Study Guide: Exam70-411 provides comprehensive preparation for exam 70-411:Administering Windows Server 2012 R2. With full coverage of allexam domains, this guide contains everything you need to know to befully prepared on test day. Real-world scenarios illustrate thepractical applications of the lessons, and hands-on exercises allowyou to test yourself against everyday tasks. You get access to aninteractive practice te
Building an Integrative Model for Managing Exploratory Innovation
DEFF Research Database (Denmark)
Zarmeen, Parisha; Turri, Vanessa Gina; Sanchez, Ron
2014-01-01
central problems” organizations face when trying to manage innovation processes (Van de Ven, 1986). We develop an enhanced version of O’Connor’s (2008) Discovery, Incubation and Acceleration (DIA) model by integrating elements of Sanchez’ (2012) theory of architectural isomorphism as well as Markides...
42 CFR 411.380 - When CMS issues a formal advisory opinion.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false When CMS issues a formal advisory opinion. 411.380... Relationships Between Physicians and Entities Furnishing Designated Health Services § 411.380 When CMS issues a formal advisory opinion. (a) CMS considers an advisory opinion to be issued once it has received payment...
20 CFR 411.525 - What payments are available under each of the EN payment systems?
2010-04-01
... EN payment systems? 411.525 Section 411.525 Employees' Benefits SOCIAL SECURITY ADMINISTRATION THE TICKET TO WORK AND SELF-SUFFICIENCY PROGRAM Employment Network Payment Systems § 411.525 What payments are available under each of the EN payment systems? (a) For payments for outcome payment months, both...
2010-10-01
... measurement and assignment of costs to cost objectives. (b) This Cost Accounting Standard does not cover... Section 9904.411-20 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING...
GUNJAN BHARDWAJ; ANSHIT AGRAWAL; RUPESH TYAGI
2015-01-01
Innovation is key to the pharma model, from an initial discovery to the final development of a marketable drug. Here, we explore the innovation options in the fiercely contested therapeutic area of Oncology. We studied clinical development of drugs targeting PD-1 and PD-L1 pathway. In this interesting contest, companies seem to be focusing on standalone interventions (exploratory innovation) and combination therapy (exploitative innovation) in clinical development. Merck Sharp and Dohme, havi...
42 CFR 411.375 - Fees for the cost of advisory opinions.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Fees for the cost of advisory opinions. 411.375... Relationships Between Physicians and Entities Furnishing Designated Health Services § 411.375 Fees for the cost... revised the amount of the initial fee in a program issuance, in which case, the requestor must include the...
49 CFR 238.411 - Rear end structures of power car cabs.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Rear end structures of power car cabs. 238.411... II Passenger Equipment § 238.411 Rear end structures of power car cabs. The rear end structure of the cab of a power car shall be designed to include the following elements, or their structural equivalent...
25 CFR 39.411 - How will the auditor report its findings?
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false How will the auditor report its findings? 39.411 Section... EQUALIZATION PROGRAM Accountability § 39.411 How will the auditor report its findings? (a) The auditor selected... to the findings, where submitted, in the final audit report. (b) The auditor must submit a final...
Business Model Innovation Portfolio Strategy for Growth Under Product-Market Configurations
Bert Verhoeven; Lester W. Johnson
2017-01-01
Purpose: The research links three concepts: product market growth strategy, the magnitude of innovation and Business Model Innovation, merging them together into a dynamic Business Model Innovation strategy framework. Design/Methodology/Approach: The paper is conceptual and exploratory in nature and builds on existing literature and the author’s experience with developing business models. Findings: The BMI strategy framework can help managers establish a BMI portfolio strategy followi...
42 CFR 411.10 - Services required as a result of war.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Services required as a result of war. 411.10... and Exclusion of Particular Services § 411.10 Services required as a result of war. Medicare does not pay for services that are required as a result of war, or an act of war, that occurs after the...
Aspara, Jaakko; Klein, Jan; Luo, Xueming; Tikkanen, Henrikki
2017-01-01
We conduct a systematic exploratory investigation of the effects of firms’ existing service productivity on the success of their new service innovations. Although previous research extensively addresses service productivity and service innovation, respectively, this is the first empirical study that
First-in-human uPAR PET: Imaging of Cancer Aggressiveness
Persson, Morten; Skovgaard, Dorthe; Brandt-Larsen, Malene; Christensen, Camilla; Madsen, Jacob; Nielsen, Carsten H.; Thurison, Tine; Klausen, Thomas Levin; Holm, Søren; Loft, Annika; Berthelsen, Anne Kiil; Ploug, Michael; Pappot, Helle; Brasso, Klaus; Kroman, Niels; Højgaard, Liselotte; Kjaer, Andreas
2015-01-01
A first-in-human clinical trial with Positron Emission Tomography (PET) imaging of the urokinase-type plasminogen activator receptor (uPAR) in patients with breast, prostate and bladder cancer, is described. uPAR is expressed in many types of human cancers and the expression is predictive of invasion, metastasis and indicates poor prognosis. uPAR PET imaging therefore holds promise to be a new and innovative method for improved cancer diagnosis, staging and individual risk stratification. The uPAR specific peptide AE105 was conjugated to the macrocyclic chelator DOTA and labeled with 64Cu for targeted molecular imaging with PET. The safety, pharmacokinetic, biodistribution profile and radiation dosimetry after a single intravenous dose of 64Cu-DOTA-AE105 were assessed by serial PET and computed tomography (CT) in 4 prostate, 3 breast and 3 bladder cancer patients. Safety assessment with laboratory blood screening tests was performed before and after PET ligand injection. In a subgroup of the patients, the in vivo stability of our targeted PET ligand was determined in collected blood and urine. No adverse or clinically detectable side effects in any of the 10 patients were found. The ligand exhibited good in vivo stability and fast clearance from plasma and tissue compartments by renal excretion. In addition, high uptake in both primary tumor lesions and lymph node metastases was seen and paralleled high uPAR expression in excised tumor tissue. Overall, this first-in-human study therefore provides promising evidence for safe use of 64Cu-DOTA-AE105 for uPAR PET imaging in cancer patients. PMID:26516369
42 CFR 411.354 - Financial relationship, compensation, and ownership or investment interest.
2010-10-01
... investment interest by one common owner or investor in another common owner or investor. (iv) An indirect... to, the distribution of profits, dividends, proceeds of sale, or similar returns on investment. (iii... or investment interest. 411.354 Section 411.354 Public Health CENTERS FOR MEDICARE & MEDICAID...
Gadrey , Jean; Gallouj , Faïz; Lhuillery , Stéphane; Weinstein , Olivier
1994-01-01
International audience; Bien que les services soient largement majoritaires dans les grands agrégats économiques, ils ne représentent qu'une faible proportion des dépenses ou des effectifs de R-D des entreprises tels qu'ils sont évalués par les organismes nationaux et internationaux. Par ailleurs, les théories économiques de l'innovation tendent à négliger les services ou à considérer que l'innovation y est pour l'essentiel réduite à l'adoption d'innovations produites dans l'industrie. Dans c...
25 CFR 170.411 - What may a long-range transportation plan include?
2010-04-01
...) Social and economic development planning to identify transportation improvements or needs to accommodate... 25 Indians 1 2010-04-01 2010-04-01 false What may a long-range transportation plan include? 170.411 Section 170.411 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER INDIAN...
INNOVATIVE CLUSTER OR COMPETITIVENESS POLE?
Directory of Open Access Journals (Sweden)
Liliana Scutaru
2015-02-01
Full Text Available The paper analyzes the situation of clusters in Romania and their areas of activity and innovation in entrepreneurship Romanian state. It is made also a territorial distribution of clusters on the eight regions. The findings lead to the conclusion that there are some clusters that have the vocation to become poles of competitiveness in areas such as renewable energy, automotive, electronics, health, biotechnology, mechatronics or ICT (Information and Communication Technology which represent the resources for future of the Romanian economy. Regarding the degree of innovation of Romanian Small and Medium Enterprises (SMEs, the level is relatively modest, 30.8% of all enterprises being innovative. If we were to answer the question the title suggests, we would say "yes" to both since the innovative cluster as well as the competitiveness pole promotes par excellence, innovation through study, research and stimulation of creativity. And this is more than enough to support economic growth of Romania and maintain the competitiveness worldwide.
Hutchinson, Mark R; Lewis, Susannah S; Coats, Benjamen D; Skyba, David A; Crysdale, Nicole Y; Berkelhammer, Debra L; Brzeski, Anita; Northcutt, Alexis; Vietz, Christine M; Judd, Charles M; Maier, Steven F; Watkins, Linda R; Johnson, Kirk W
2009-02-01
Morphine-induced glial proinflammatory responses have been documented to contribute to tolerance to opioid analgesia. Here, we examined whether drugs previously shown to suppress glial proinflammatory responses can alter other clinically relevant opioid effects; namely, withdrawal or acute analgesia. AV411 (ibudilast) and minocycline, drugs with distinct mechanisms of action that result in attenuation of glial proinflammatory responses, each reduced naloxone-precipitated withdrawal. Analysis of brain nuclei associated with opioid withdrawal revealed that morphine altered expression of glial activation markers, cytokines, chemokines, and a neurotrophic factor. AV411 attenuated many of these morphine-induced effects. AV411 also protected against spontaneous withdrawal-induced hyperactivity and weight loss recorded across a 12-day timecourse. Notably, in the spontaneous withdrawal study, AV411 treatment was delayed relative to the start of the morphine regimen so to also test whether AV411 could still be effective in the face of established morphine dependence, which it was. AV411 did not simply attenuate all opioid effects, as co-administering AV411 with morphine or oxycodone caused three-to-five-fold increases in acute analgesic potency, as revealed by leftward shifts in the analgesic dose response curves. Timecourse analyses revealed that plasma morphine levels were not altered by AV411, suggestive that potentiated analgesia was not simply due to prolongation of morphine exposure or increased plasma concentrations. These data support and extend similar potentiation of acute opioid analgesia by minocycline, again providing converging lines of evidence of glial involvement. Hence, suppression of glial proinflammatory responses can significantly reduce opioid withdrawal, while improving analgesia.
38 CFR 18.411 - Discrimination prohibited.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Discrimination prohibited... Practices § 18.411 Discrimination prohibited. (a) General. (1) No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity to which...
Thriving Organizational Sustainability through Innovation: Incivility Climate and Teamwork
Directory of Open Access Journals (Sweden)
Jaewan Yang
2016-08-01
Full Text Available The present study examines the association between team incivility climate and team members’ perceived support for innovation. To extend findings on the negative effects of incivility (which are low intensity deviant behaviors, such as rudeness in studies focusing on the individual level, the effects of organizational incivility are examined at the work team level. Drawing on the spiral model of incivility and the literature on teams, this study suggests that team incivility climate has a negative impact on perceived support for innovation through team members’ teamwork behaviors. Using data collected from 411 subordinates on 62 work teams, the hypothesized mediation model is tested. The results show a negative effect of team incivility climate on teamwork and a positive effect of teamwork on perceived support for innovation, supporting the hypothesized negative indirect effect. Research and practical implications for organizational sustainability are discussed.
STRATEGY FORMULATION PROCESS AND INNOVATION PERFORMANCE NEXUS
Directory of Open Access Journals (Sweden)
Chijioke Nwachukwu
2018-03-01
Full Text Available The purpose of this study is to examine the link between strategy formulation process and innovation performance indicators in microfinance banks in Nigeria (MFBs. 100 employees of leading microfinance banks were randomly selected for this study. 80 questionnaires were returned but only 76 were found usable for the analysis. Regression analysis technique was used in examining the nature of the relationships of the variables and for hypotheses testing. The authors used exploratory factor analysis and Cronbach's alpha to test for the validity and reliability of the questionnaires. The results show that strategy formulation process has a positive effect on process innovation performance, product innovation performance and marketing innovation performance. Thus, all the three hypotheses tested were supported. The authors, therefore, concludes that a systematic strategy formulation process is necessary for firms to achieve and sustain process innovation performance, product innovation performance and marketing innovation performance. This study proposed suggestion for further studies.
IMAGE AND PRESS IN THE AMAZON: the configuration of the photograph in the newspaper Estado do Pará
Directory of Open Access Journals (Sweden)
Netilia Silva dos Anjos Seixas
2016-12-01
Full Text Available Este estudo busca contribuir para o entendimento da trajetória da fotografia nos jornais paraenses, a partir de um dos principais impressos do Estado, o Estado do Pará (1911-1980. Trata-se de um estudo exploratório, com base em pesquisa bibliográfica, documental e análise dos dados empíricos, usando os métodos iconográfico e iconológico, de Erwin Panofsky e Boris Kossoy. Foram observadas as fotografias publicadas em 1912, quando uma das primeiras fotografias jornalísticas foi encontrada no impresso, 1920, 1960 e 1980, nos meses de janeiro, abril, julho e outubro, correspondendo a cerca de 30 por cento do total de edições de cada ano selecionado. O jornal Estado do Pará iniciou sua edição com apresentação gráfica inovadora, destacando-se, mais tarde, com a publicação de imagens fotográficas e participando do estabelecimento da imprensa na Amazônia. PALAVRAS-CHAVE: Fotografia de imprensa; Jornal Estado do Pará; Amazônia. ABSTRACT This study seeks to contribute to the understanding of the trajectory of photography in the newspapers of Pará, from one of the main printed forms of the country, the State of Pará (1911-1980. It is an exploratory study, based on bibliographical research, documentary and empirical data analysis, using the iconographic and iconological methods of Erwin Panofsky and Boris Kossoy. Photographs published in 1912 were observed, when one of the first journalistic photographs was found on the press, 1920, 1960 and 1980, in the months of January, April, July and October, corresponding to about 30 percent of the total editions of each year selected. The newspaper Estado do Pará began its edition with an innovative graphic presentation, highlighting, later, with the publication of photographic images and participating in the establishment of the press in the Amazon. KEYWORDS: Press photography; Newspaper Estado do Pará; Amazon. RESUMEN Este estudio pretende contribuir a la comprensi
Phenotype abnormality: 411 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 411 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u915i lethal (sensu genetics...) in period of stem elongation stage ... stem elongation stage ... lethal (sensu genetics) ...
The spatial dimensions of innovation
DEFF Research Database (Denmark)
Lorentzen, Anne
2005-01-01
This article takes a critical look at assumptions and ideas fundamental to theories of ‘regional innovation systems’ and ‘learning regions’. First the original theories and their roots are presented briefly. Then a number of key concepts and assumptions will be discussed. After that two trends...... of development of the original theories will be discussed. One trend is the diversification of the notion of proximity. The other is the inclusion of the global or extralocal linkages in the models. The concluding part suggests a change in perspective in the study of innovation towards a focus on the actors...... of this process and their societal embeddedness on different scales. More exploratory methods of research would be useful for the creation of relevant scientific knowledge on social processes of innovation....
Energy Technology Data Exchange (ETDEWEB)
Angel M, E. del; Nunez C, A.; Amador G, R. [CNSNS, Dr. Barragan No. 779, 03020 Mexico D.F. (Mexico)]. e-mail: edangelm@cnsns.gob.mx
2003-07-01
The present work describes the pattern of the called Quench installation developed and used by the National Commission of Nuclear Security and Safeguards (CNSNS) for their participation in the International Standard Problem 45 (ISP), organized by the Nuclear Energy Agency (NEA). The exercise consisted on the simulation of the denominated experiment Quench-06 carried out in the experimental installation Quench located in the Forschungszentrum laboratory in Karlsruhe, Germany. The experiment Quench-06 consisted on simulating the sudden and late injection of water in a fuel assemble for a pressurized reactor (PWR). The CNSNS uses the version bd of the SCDAPSIM code developed by the company Innovative Software Systems (ISS) to simulate this experiment. The obtained results showed that the code is able to predict the experiment partially when overestimating the hydrogen production and of the partial fused of some fuel pellets, but predicting correctly the damage in the shroud. (Author)
48 CFR 9904.411 - Cost accounting standard-accounting for acquisition costs of material.
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Cost accounting standard-accounting for acquisition costs of material. 9904.411 Section 9904.411 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND...
How can strategic philanthropy contribute to innovation for companies
Matteucci, Alessandro
2014-01-01
This investigation proposes to explore the existing link between a strategic conception of philanthropy and innovation. Indeed, the nature of the research question relies on an unexplored field in the CSR and Innovation management academic literature. It starts with the interest to know which the benefits are for a firm encouraged to invest strategically in philanthropy. In this regard, the analysis contributes in fitting this gap by following different objectives in an exploratory perspectiv...
Ranga, Liana Marina; Miedema, Joost; Jorna, Rene
2008-01-01
This paper presents the results of a recent exploratory study aiming to enhance the innovative capacity of small firms in the Northern Netherlands, a region lagging behind the rest of the country in terms of economic growth and innovative capacity. The triple helix perspective is adopted to examine
Directed and persistent movement arises from mechanochemistry of the ParA/ParB system.
Hu, Longhua; Vecchiarelli, Anthony G; Mizuuchi, Kiyoshi; Neuman, Keir C; Liu, Jian
2015-12-22
The segregation of DNA before cell division is essential for faithful genetic inheritance. In many bacteria, segregation of low-copy number plasmids involves an active partition system composed of a nonspecific DNA-binding ATPase, ParA, and its stimulator protein ParB. The ParA/ParB system drives directed and persistent movement of DNA cargo both in vivo and in vitro. Filament-based models akin to actin/microtubule-driven motility were proposed for plasmid segregation mediated by ParA. Recent experiments challenge this view and suggest that ParA/ParB system motility is driven by a diffusion ratchet mechanism in which ParB-coated plasmid both creates and follows a ParA gradient on the nucleoid surface. However, the detailed mechanism of ParA/ParB-mediated directed and persistent movement remains unknown. Here, we develop a theoretical model describing ParA/ParB-mediated motility. We show that the ParA/ParB system can work as a Brownian ratchet, which effectively couples the ATPase-dependent cycling of ParA-nucleoid affinity to the motion of the ParB-bound cargo. Paradoxically, this resulting processive motion relies on quenching diffusive plasmid motion through a large number of transient ParA/ParB-mediated tethers to the nucleoid surface. Our work thus sheds light on an emergent phenomenon in which nonmotor proteins work collectively via mechanochemical coupling to propel cargos-an ingenious solution shaped by evolution to cope with the lack of processive motor proteins in bacteria.
The Influencing Factors of Enterprise Sustainable Innovation: An Empirical Study
Directory of Open Access Journals (Sweden)
Si-Hua Chen
2016-04-01
Full Text Available Sustainable innovation is the inexhaustible source of development of enterprises. Within fierce market competition, only by depending on continuous innovation can an enterprise exist and develop. By conducting an exploratory factor analysis and a confirmatory factor analysis, this paper proposes a theoretical model, dividing enterprise sustainable innovation ability into three aspects: knowledge innovation capability, production innovation capability, and market innovation capability, and analyzes the influencing factors respectively. Finally, applying this theoretical model to a practical case, with system dynamics method, the simulation results show that they are consistent with real enterprise facts. Therefore, the framework of determinants of sustainable innovation built in this paper has already been verified theoretically and practically. It not only lays a theoretical foundation for further research, but also provides a clear ground for firms to improve their sustainable innovation.
Fonds d'innovation pour le développement (FID) aux fins de la ...
International Development Research Centre (IDRC) Digital Library (Canada)
innovation en santé dans le but d'améliorer les conditions de vie des pauvres dans le monde entier. Le Fonds d'innovation pour le développement (FID) appuiera des scientifiques et des établissements voués à la recherche en santé par le ...
Directory of Open Access Journals (Sweden)
Krause, Willie
2015-05-01
Full Text Available This paper provides key results from an exploratory research study aimed at understanding the current landscape in small- and medium-sized enterprises (SMEs in South Africa with regard to their appetite for, and use of, open innovation. The survey, which was conducted within a contained group of SMEs that belong to business network groups on LinkedIn, explored the current use and perception of open innovation. It was found that collaboration is the approach most preferred by the SMEs surveyed, with customers and suppliers as their preferred innovation partners. Based on the findings of the survey, this paper proposes 25 design requirements, grouped into five functional categories, for an open innovation approach. The design requirements have been developed as a primer to a more complete open innovation approach for SMEs.
Experimental Design Strategy As Part of an Innovative Construction Industry
Rogier Laterveer
2013-01-01
This exploratory and conceptual article sets out to research what arguments and possibilities for experimentation in construction exists and if experimentation can contribute towards more innovative construction as a whole. Traditional, -western- construction is very conservative and regional, often
La co-conception en partenariat de systèmes agricoles innovants
Directory of Open Access Journals (Sweden)
Vall Eric
2016-01-01
Full Text Available La co-conception de systèmes agricoles innovants est une piste prometteuse pour répondre au défi de l’innovation, notamment pour les exploitations agricoles familiales africaines confrontées à de multiples changements. Mais il faut penser à la place et aux rôles tenus par de multiples acteurs (agriculteurs, conseillers, chercheurs pour produire les changements souhaités par toutes les parties, et donc réfléchir à la question du partenariat dans le processus. Cet article présente la démarche de conception en partenariat de systèmes agricoles innovants (CPSAI élaborée entre 2005 et 2015 dans l’ouest du Burkina Faso, notamment sur la gestion de la fumure organique des cultures. La CPSAI s’appuie sur un dispositif partenarial formalisé et sur une démarche progressive en trois phases itératives : (1 exploration et formalisation du partenariat, (2 conceptions et test des options de changement, (3 bilan et désengagement. Les résultats obtenus montrent que l’innovation est plus efficace et durable quand elle est le produit d’un travail partenarial.
Directory of Open Access Journals (Sweden)
Andreja Pirc Barčić
2016-03-01
Full Text Available Corporate leaders often view innovation as a key contributor to superior profits, market sharing, and competitive positioning. However, confusion regarding the definition of innovation, how to create it, and how to implement it remains. In countries that are recent European Union members, little research has been done on innovation and how innovation is related to corporate management activities. In this study, the linkages were examined in the Croatian furniture industry. The first part of the study was to deconstruct innovation into three components: product innovation, production process innovation, and human resource innovation. The second part of the study evaluates the relationships between these innovation components and four company management activities/factors (research and development investments, company flexibility, export activity, and the Internet usage were examined. Scale testing resulted in valid deconstruction measures of innovation. Hypothesized correlations between innovation components and company management factors were supported, although the results were not fully consistent with those of previous studies.
2010-04-01
... reconciliation payment under the outcome-milestone payment system? 411.536 Section 411.536 Employees' Benefits... Systems § 411.536 Under what circumstances can we make a reconciliation payment under the outcome-milestone payment system? When the beneficiary's outcome payment period begins before the beneficiary has...
Exploring Innovation: A Qualitative Study of Academic Libraries
Beninghove, Linda Scanlon
2016-01-01
As academic libraries evolve to affirm their place as key partners in research, teaching, and learning in university communities, the process of innovation is one of great importance in the intentional design of library services, resources, and staffing. This dissertation was a qualitative, exploratory research study in which the conceptual…
Services financiers et déploiement d'innovations agricoles au Sahel ...
International Development Research Centre (IDRC) Digital Library (Canada)
Services financiers et déploiement d'innovations agricoles au Sahel. Au cours des vingt dernières années, plusieurs innovations visant à améliorer les rendements des cultures vivrières ont été développées dans les centres de recherche agronomique d'Afrique de l'Ouest et par les chercheurs de la communauté ...
31 CFR 411.1 - Color illustrations authorized.
2010-07-01
... SERVICE, DEPARTMENT OF THE TREASURY COLOR ILLUSTRATIONS OF UNITED STATES CURRENCY § 411.1 Color... necessary plates or items for such printing or publishing, of color illustrations of U.S. currency provided... storage devices, and any other thing used in the making of the illustration that contain an image of the...
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Will SSA periodically review the outcome payment system and the outcome-milestone payment system for possible modifications? 411.597 Section 411... Employment Network Payment Systems § 411.597 Will SSA periodically review the outcome payment system and the...
L’innovation sociale et l’entrepreneur schumpétérien : deux lectures théoriques
Directory of Open Access Journals (Sweden)
Dennis Harrisson
2012-05-01
Full Text Available Le rôle de l’entrepreneur est fondamental dans la théorie de l’innovation conçue par Schumpeter. Toutefois, le concept d’entrepreneur est toujours un sujet de controverse. D’une part, il ne semble pas guidé par un intérêt égoïste tel que le proposent les tenants de la théorie du choix rationnel; d’autre part, il n’est pas non plus contraint entièrement par les barrières institutionnelles selon les préceptes de la théorie institutionnaliste. L’entrepreneur est capable de lever les obstacles afin d’innover. Dans cet article, nous traitons de la place de l’entrepreneur dans la conception de l’innovation sociale. Les connaissances développées sur le processus d’innovation sont complétées par des avancées dans la théorie du choix rationnel et dans la théorie institutionnaliste. Ainsi, le rôle de l’entrepreneur est mieux compris comme étant l’objet d’une tension entre l’intérêt individuel et le bien commun.The entrepreneur's role is fundamental in the theory of innovation devised by Schumpeter. However, the concept of entrepreneur is still controversial. On the one hand, it does not seem guided by an egoistic interest as proposed by the advocates of rational choice theory, and secondly, it is not entirely constrained across institutional boundaries according to the principles of institutionalist theory. The entrepreneur is able to remove barriers to innovation. In this paper, we discuss the role of the entrepreneur in the development of social innovation. The knowledge acquired in the innovation process are complemented by advances in the rational choice theory of and the institutionalist theory. Thus, the role of the entrepreneur is better understood as being subject to a tension between individual interest and common good.
DEFF Research Database (Denmark)
Hargreaves, F. P.; Merkle, D.
2013-01-01
We present FooPar, an extension for highly efficient Parallel Computing in the multi-paradigm programming language Scala. Scala offers concise and clean syntax and integrates functional programming features. Our framework FooPar combines these features with parallel computing techniques. Foo......, results based on a empirical analysis on two supercomputers are given. We achieve close-to-optimal performance wrt. theoretical peak performance. Based on this result we conclude that FooPar allows programmers to fully access Scalas design features without suffering from performance drops when compared...
Livestock Vaccine Innovation Fund: Strengthening of Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
This project creates the authorization for capacity building support to develop and manage the Livestock Vaccine Innovation Fund (LVIF). The fund aims to support the ... Des chercheurs appuyés par le CRDI parlent de leurs expériences au Comité sur les ONG lors du forum de la Commission de la condition de la femme.
Par@Graph - a parallel toolbox for the construction and analysis of large complex climate networks
Tantet, A.J.J.
2015-01-01
In this paper, we present Par@Graph, a software toolbox to reconstruct and analyze complex climate networks having a large number of nodes (up to at least 106) and edges (up to at least 1012). The key innovation is an efficient set of parallel software tools designed to leverage the inherited hybrid
Exploring the Enablers of Organizational and Marketing Innovations in SMEs
Directory of Open Access Journals (Sweden)
Oluseyi Moses Ajayi
2015-02-01
Full Text Available Previous research studies on innovation tend to focus on process and product innovations. Recent theoretical opinions reveal that Organizational and Marketing Innovations (OMIs could be the necessary prerequisites to optimally utilize and deploy such process and product innovations. It is important to note that there is a dearth of information on the enablers of OMIs capabilities among small and medium-sized enterprises (SMEs. Despite their closeness to their customers, many SMEs are finding it difficult to achieve successful and effective innovations; these are innovations that have a positive impact on the business growth and returns. This study presents findings from exploratory qualitative research conducted in South-Western Nigeria. Drawing upon information-rich evidence from 13 in-depth interviews with the owners and the managers of SMEs, this study identifies some enablers that can promote SMEs’ OMIs capabilities, effective innovations, and organizational survival.
Baronian, Grégory; Ginda, Katarzyna; Berry, Laurence; Cohen-Gonsaud, Martin; Zakrzewska-Czerwińska, Jolanta; Jakimowicz, Dagmara; Molle, Virginie
2015-01-01
Here, we present for the first time that Mycobacterium tuberculosis ParB is phosphorylated by several mycobacterial Ser/Thr protein kinases in vitro. ParB and ParA are the key components of bacterial chromosome segregation apparatus. ParB is a cytosolic conserved protein that binds specifically to centromere-like DNA parS sequences and interacts with ParA, a weak ATPase required for its proper localization. Mass spectrometry identified the presence of ten phosphate groups, thus indicating that ParB is phosphorylated on eight threonines, Thr32, Thr41, Thr53, Thr110, Thr195, and Thr254, Thr300, Thr303 as well as on two serines, Ser5 and Ser239. The phosphorylation sites were further substituted either by alanine to prevent phosphorylation or aspartate to mimic constitutive phosphorylation. Electrophoretic mobility shift assays revealed a drastic inhibition of DNA-binding by ParB phosphomimetic mutant compared to wild type. In addition, bacterial two-hybrid experiments showed a loss of ParA-ParB interaction with the phosphomimetic mutant, indicating that phosphorylation is regulating the recruitment of the partitioning complex. Moreover, fluorescence microscopy experiments performed in the surrogate Mycobacterium smegmatis ΔparB strain revealed that in contrast to wild type Mtb ParB, which formed subpolar foci similar to M. smegmatis ParB, phoshomimetic Mtb ParB was delocalized. Thus, our findings highlight a novel regulatory role of the different isoforms of ParB representing a molecular switch in localization and functioning of partitioning protein in Mycobacterium tuberculosis.
Directory of Open Access Journals (Sweden)
Grégory Baronian
Full Text Available Here, we present for the first time that Mycobacterium tuberculosis ParB is phosphorylated by several mycobacterial Ser/Thr protein kinases in vitro. ParB and ParA are the key components of bacterial chromosome segregation apparatus. ParB is a cytosolic conserved protein that binds specifically to centromere-like DNA parS sequences and interacts with ParA, a weak ATPase required for its proper localization. Mass spectrometry identified the presence of ten phosphate groups, thus indicating that ParB is phosphorylated on eight threonines, Thr32, Thr41, Thr53, Thr110, Thr195, and Thr254, Thr300, Thr303 as well as on two serines, Ser5 and Ser239. The phosphorylation sites were further substituted either by alanine to prevent phosphorylation or aspartate to mimic constitutive phosphorylation. Electrophoretic mobility shift assays revealed a drastic inhibition of DNA-binding by ParB phosphomimetic mutant compared to wild type. In addition, bacterial two-hybrid experiments showed a loss of ParA-ParB interaction with the phosphomimetic mutant, indicating that phosphorylation is regulating the recruitment of the partitioning complex. Moreover, fluorescence microscopy experiments performed in the surrogate Mycobacterium smegmatis ΔparB strain revealed that in contrast to wild type Mtb ParB, which formed subpolar foci similar to M. smegmatis ParB, phoshomimetic Mtb ParB was delocalized. Thus, our findings highlight a novel regulatory role of the different isoforms of ParB representing a molecular switch in localization and functioning of partitioning protein in Mycobacterium tuberculosis.
Roberta Rodrigues Faoro; Mírian Oliveira; Marcelo Faoro de Abreu
2017-01-01
Introduction: this paper presents an analysis of the sharing of knowledge and innovation in the inter-relationships of the type outsourcing of Information Technology. Objective: analyze the existence of relationship between knowledge sharing and innovation in the inter-relationships of the type of outsourcing information technology (IT). Methodology: research is exploratory, qualitative and using as a strategy the multiple case study, which analyzed 12 companies in IT outsourci...
20 CFR 411.550 - How are the outcome payments calculated under the outcome payment system?
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false How are the outcome payments calculated under the outcome payment system? 411.550 Section 411.550 Employees' Benefits SOCIAL SECURITY ADMINISTRATION... the outcome payments calculated under the outcome payment system? The amount of each monthly outcome...
Key Mechanisms for Employee-Driven Innovation in Governmental Client Organisations
DEFF Research Database (Denmark)
Sørensen, Henrik; Faber, Lene; Wandahl, Søren
2018-01-01
the mechanisms of organisational trust, innovation safety, organisational practices, cultural settings and the recognition and rewards structure to motivate employees. The decision-making procedures should be transparent especially to the idea-owner and the employees involved, and the implementation and putting......In order to ensure that knowledge and ideas are transformed into innovative contributions, a systematic approach is important. The aim of this research was to identify the specific mechanisms that are key to implementing an innovation process model when conducting Employee-driven Innovation...... in a governmental client organisation. The methodological approach was an exploratory case study of a governmental client organisation within the Danish construction industry. The units of analysis were groups of employees and managers within the case organisation. The primary mechanisms identified were...
Universities and Councils Network on Innovation for Inclusive ...
International Development Research Centre (IDRC) Digital Library (Canada)
The recently completed IDRC-supported project, 104904 Science and Technology Innovation for the Base of the Pyramid (Southeast Asia), supported research on ... Des chercheurs appuyés par le CRDI parlent de leurs expériences au Comité sur les ONG lors du forum de la Commission de la condition de la femme.
26 CFR 1.401(a)(4)-11 - Additional rules.
2010-04-01
... (CONTINUED) INCOME TAXES Pension, Profit-Sharing, Stock Bonus Plans, Etc. § 1.401(a)(4)-11 Additional rules...., prevents the employee from being disadvantaged with respect to benefits by a change in job or employer or...
75 FR 18492 - Investing in Innovation Fund; Correction
2010-04-12
... DEPARTMENT OF EDUCATION [Docket ID ED-2009-OII-0012] RIN 1855-AA06 Investing in Innovation Fund... 12072) a notice inviting applications for new awards for FY 2010 (NIA) for the Investing in Innovation... Anderson. Telephone: (202) 453- 7122; or by e-mail: [email protected] ; or by mail: (Attention: Investing in...
Directory of Open Access Journals (Sweden)
Nico Martins
2015-11-01
Full Text Available Innovation has become prominent within the leadership literature as an underlying and important aspect of service delivery. This study set out to determine the perceptions and nature of service delivery innovation among employees of a South African government department, using a sample of 289 participants. Statistical analysis was conducted to analyse the data which indicate that innovation is an important aspect of service delivery. This study suggests that to enhance service delivery employees should be encouraged to be innovative. The implications of the findings are discussed and recommendations for future research are made.
27 CFR 41.1 - Importation of tobacco products, cigarette papers and tubes, and processed tobacco.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Importation of tobacco products, cigarette papers and tubes, and processed tobacco. 41.1 Section 41.1 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY (CONTINUED) TOBACCO...
20 CFR 411.245 - What are a PM's responsibilities under the Ticket to Work program?
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false What are a PM's responsibilities under the Ticket to Work program? 411.245 Section 411.245 Employees' Benefits SOCIAL SECURITY ADMINISTRATION THE... formats. For purposes of this section, accessible format means by media that is appropriate to a...
Donczew, Magdalena; Mackiewicz, Paweł; Wróbel, Agnieszka; Flärdh, Klas; Zakrzewska-Czerwińska, Jolanta
2016-01-01
In unicellular bacteria, the ParA and ParB proteins segregate chromosomes and coordinate this process with cell division and chromosome replication. During sporulation of mycelial Streptomyces, ParA and ParB uniformly distribute multiple chromosomes along the filamentous sporogenic hyphal compartment, which then differentiates into a chain of unigenomic spores. However, chromosome segregation must be coordinated with cell elongation and multiple divisions. Here, we addressed the question of whether ParA and ParB are involved in the synchronization of cell-cycle processes during sporulation in Streptomyces. To answer this question, we used time-lapse microscopy, which allows the monitoring of growth and division of single sporogenic hyphae. We showed that sporogenic hyphae stop extending at the time of ParA accumulation and Z-ring formation. We demonstrated that both ParA and ParB affect the rate of hyphal extension. Additionally, we showed that ParA promotes the formation of massive nucleoprotein complexes by ParB. We also showed that FtsZ ring assembly is affected by the ParB protein and/or unsegregated DNA. Our results indicate the existence of a checkpoint between the extension and septation of sporogenic hyphae that involves the ParA and ParB proteins. PMID:27248800
2010-10-01
... this section. (1) They are either— (i) Listed for trading on the New York Stock Exchange, the American Stock Exchange, or any regional exchange in which quotations are published on a daily basis, or foreign... ownership or investment interests. 411.356 Section 411.356 Public Health CENTERS FOR MEDICARE & MEDICAID...
International Nuclear Information System (INIS)
Hiergesell, R.A.; Dixon, K.L.
1996-06-01
A water budget for the Par Pond hydrologic system was established in order to estimate the rate of groundwater influx to Par Pond. This estimate will be used in modeling exercises to predict Par Pond reservoir elevation and spillway discharge in the scenario where Savannah River water is no longer pumped and discharged into Par Pond. The principal of conservation of mass was used to develop the water budget, where water inflow was set equal to water outflow. Components of the water budget were identified, and the flux associated with each was determined. The water budget was considered balanced when inflow and outflow summed to zero. The results of this study suggest that Par Pond gains water from the groundwater system in the upper reaches of the reservoir, but looses water to the groundwater system near the dam. The rate of flux of groundwater from the water table aquifer into Par Pond was determined to be 13 cfs. The rate of flux from Par Pond to the water table aquifer near the dam was determined to be 7 cfs
Laminin-411 Is a Vascular Ligand for MCAM and Facilitates TH17 Cell Entry into the CNS
Flanagan, Ken; Fitzgerald, Kent; Baker, Jeanne; Regnstrom, Karin; Gardai, Shyra; Bard, Frederique; Mocci, Simonetta; Seto, Pui; You, Monica; Larochelle, Catherine; Prat, Alexandre; Chow, Samuel; Li, Lauri; Vandevert, Chris; Zago, Wagner; Lorenzana, Carlos; Nishioka, Christopher; Hoffman, Jennifer; Botelho, Raquel; Willits, Christopher; Tanaka, Kevin; Johnston, Jennifer; Yednock, Ted
2012-01-01
TH17 cells enter tissues to facilitate pathogenic autoimmune responses, including multiple sclerosis (MS). However, the adhesion molecules involved in the unique migratory capacity of TH17 cells, into both inflamed and uninflamed tissues remain unclear. Herein, we characterize MCAM (CD146) as an adhesion molecule that defines human TH17 cells in the circulation; following in vitro restimulation of human memory T cells, nearly all of the capacity to secrete IL-17 is contained within the population of cells expressing MCAM. Furthermore, we identify the MCAM ligand as laminin 411, an isoform of laminin expressed within the vascular endothelial basement membranes under inflammatory as well as homeotstatic conditions. Purified MCAM-Fc binds to laminin 411 with an affinity of 27 nM, and recognizes vascular basement membranes in mouse and human tissue. MCAM-Fc binding was undetectable in tissue from mice with targeted deletion of laminin 411, indicating that laminin 411 is a major tissue ligand for MCAM. An anti-MCAM monoclonal antibody, selected for inhibition of laminin binding, as well as soluble MCAM-Fc, inhibited T cell adhesion to laminin 411 in vitro. When administered in vivo, the antibody reduced TH17 cell infiltration into the CNS and ameliorated disease in an animal model of MS. Our data suggest that MCAM and laminin 411 interact to facilitate TH17 cell entry into tissues and promote inflammation. PMID:22792325
DEFF Research Database (Denmark)
Hodges, Gethin W; Bang, Casper N; Wachtell, Kristian
2015-01-01
The fundamental role of inflammation in cardiovascular disease (CVD) has prompted interest in numerous biomarkers that detect subclinical levels of inflammation. Soluble urokinase plasminogen activator receptor (suPAR) is a novel biomarker that correlates significantly with cardiovascular events ...... comprehensive review of suPAR in CVD and explore its function and usefulness in predicting cardiovascular events....
Idea management in support of pharmaceutical front end innovation
DEFF Research Database (Denmark)
Aagaard, Annabeth
2012-01-01
The pharmaceutical industry faces continuing pressures from rising R&D costs and depreciating value of patents, as patent lives is eroded by testing procedures and pressures from public authorities to cut health care costs. These challenges have increased the focus on shortening development times......, which again put pressure on the efficiency of front end innovation (FEI). In the attempt to overcome these various challenges pharmaceutical companies are looking for new models to support FEI. This paper explores in what way idea management can be applied as a tool in facilitation of front end...... innovation in practice. First I show through a literature study, how idea management and front end innovation are related and may support each other. Hereafter I apply an exploratory case study of front end innovation in eight medium to large pharmaceutical companies in examination of how idea management...
C9.A/14 steelwork joints de poutres par plaque frontale : assemblages par gousset
2015-01-01
Les Tables de résistances ultimes des assemblages boulonnés par plaque frontale et par gousset, complétées par une description des modèles de calcul et des exemples d’application, ont pour but de faciliter la tâche de l'ingénieur et du constructeur. Cette première partie C9.A/14 contient les chapitres suivants: - Joints de poutres par plaque frontale en acier S235 et S355 - Assemblages par gousset en acier S235 et S355 Les Tables contiennent des données relatives à la géométrie ainsi que les valeurs de calcul correspondantes des résistances ultimes des assemblages ; elles remplacent le chapitre « Assemblages par plaques frontales et boulons HR » des anciennes Tables C9.1 de 1983 / 2002. Le calcul de ces assemblages par plaque frontale est basé sur les hypothèses du modèle de la méthode des composants décrite dans la norme SN EN 1993-1-8. Les vérifications sont effectuées selon la norme SIA 263:2013. Les assemblages par gousset remplacent les assemblages par double cornière, (telle...
Gadrey , Jean; Gallouj , Faïz; Weinstein , Olivier
1995-01-01
International audience; Bien qu'ils soient largement majoritaires dans les grands agrégats économiques, les théories économiques de l'innovation tendent à négliger les services ou à considérer que l'innovation y est pour l'essentiel réduite à l'adoption d'innovations produites dans l'industrie. Dans cette contribution, on conteste ces points de vue en examinant les trois questions suivantes -pourquoi l'innovation dans les services est-elle méconnue ou oubliée par ces théories? -quelles sont (...
Directory of Open Access Journals (Sweden)
Bernard Offerle
2009-10-01
Full Text Available « Innover » est devenu la solution à tous les problèmes économiques, même si le concept en lui-même reste assez difficile à cerner. On accorde, par ailleurs, un rôle essentiel aux PME dans cette course à la compétitivité. La Grande-Bretagne est dans la situation paradoxale de faire à la fois preuve de plus d’esprit d’entreprise, mais de moins d’innovation que ses principaux partenaires européens. Les Britanniques ne manquent certes pas de bonnes idées, mais ils éprouvent certaines difficultés à les transformer en produits innovants, certainement parce qu’ils ne bénéficient pas assez d’encouragements. Le gouvernement a donc élaboré un système assez sophistiqué de soutien aux petites entreprises qui tente d’apporter des réponses pratiques aux questions que peuvent se poser les entrepreneurs au quotidien. Il n’est cependant pas sûr que cette stratégie apporte les résultats escomptés : les entrepreneurs, notamment ceux d’origine étrangère ou issus de l’immigration, ont soif d’indépendance et préfèrent prendre leurs distances par rapport aux autorités. En revanche, ce dont les petits entrepreneurs ont un besoin plus urgent pour pouvoir innover sont des banquiers compréhensifs et prêts à prendre des risques. Ils souhaiteraient également ne pas être submergés par des tâches administratives qui leur prennent beaucoup trop de temps. Le gouvernement ne semble pas encore avoir su apporter de solutions très innovantes à ces deux problèmes pourtant prioritaires.
20 CFR 411.545 - How are the outcome payments calculated under the outcome-milestone payment system?
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false How are the outcome payments calculated under the outcome-milestone payment system? 411.545 Section 411.545 Employees' Benefits SOCIAL SECURITY... are the outcome payments calculated under the outcome-milestone payment system? The amount of each...
Environmental management best practices: towards social innovation
Batle, Julio; Orfila-Sintes, Francina; Moon, C. J.
2018-01-01
This research investigates exploratory environmental initiatives in tourism companies in Mallorca over five years, with special consideration to those involving partnerships and synergies with other parties (including academic ones), in an exploration of Social Innovation (SI) approaches in the industry. The paper starts with an outline of the growing importance of sustainability within the hospitality industry and its inherent relation with SI. The study draws its empirical material from ten...
Establishing a CoPs-based innovation ecosystem to enhance competence - the case of CGN in China
DEFF Research Database (Denmark)
Chen, Jian; Lui, Xielin; Hu, Yimei
2016-01-01
This research investigated how an innovation system is created, and how technology, value and capability evolve at different stages of an innovation ecosystem. Based on an exploratory and process-oriented case study onof the innovation ecosystem strategy of a nuclear power giant- China General...... Nuclear Power Group (CGN, formerly known as China Guangdong Nuclear Power Group) for the period 1987-2014, this paper presents an integrative framework to explicate the micro-foundation of the formation mechanism of an innovation ecosystem for complex product system (CoPs) characterized by interdependency...
Un « gouvernement des journalistes par le Pouvoir politique » par défaut ?
Directory of Open Access Journals (Sweden)
Matthieu Lardeau
2013-12-01
journalistes au profit d’un gouvernement indirect – ou par défaut – des journalistes par les autorités publiques.This paper aims to discuss the interactions between two concomitant phenomenathat tagged the 1950s to 1970s French press: on the one hand, the movement initiated in 1951 at Le Monde and pursued by dailies’ journalists to develop and implement journalists’ associations (“Société de journalistes” or “Société de rédacteurs” inside the newsroom to run – on their own or in association with newspaper management – newsrooms and newspapers (editorial content, and business policy to some extent; and, on the other hand, the responses to this growing movement by public authorities (both political and administrative who aimee to contain the demands for more independence and power by journalists. This exploratory study is based on the analysis of two kinds of literature too often neglected by academics despite their great richness: (1 professional literature mainly authored by journalists involved in management duties, and managers of printing presses (Perier Daville, Boegner, Pigasse, etc., a flourishing literature since 1944, and more particularly during the 1960s and 1970s; (2 the grey literature that encompasses public reports like those produced by the Prime Minister’s Office (Lindon (1970 and Serisé (1972 commissions, and the Conseil economique et social, etc. Our main results show that propositions and actions advanced by journalists and members of the news media: (1 remain largely unexploited by the profession and political authorities despite their innovation and effectiveness; (2 are regularly contained or blocked by political and public authorities who intend to maintain their ruling power over the press and journalism; (3 and that journalism-representative organizations and dominant journalists invariably uphold containment positions to limit journalists’ empowerment in management and newspaper governance. Consequently, most
STRATEGIC MANAGEMENT OF SUSTAINABILITY AND INNOVATION
Directory of Open Access Journals (Sweden)
Vanessa Cuzziol Pinsky
2013-09-01
Full Text Available The sustainable development, global competitiveness and rapid technological change increasingly challenge companies to innovate with a focus on sustainability. The objectives of this study were to identify the critical success factors in business management and identify the challenges to implement sustainable products. This is an exploratory, descriptive and qualitative research, using the case study method. Data were collected through semi-structured and in-depth interviews with executives from the marketing and innovation departments, complemented by secondary sources, including sustainability reports, websites and other company documents. The content analysis revealed the critical success factors to implement sustainable products, highlighting the involvement of senior leadership, setting goals and long term vision, the involvement of the value chain in the search for sustainable solutions and have a area of innovation with sustainability goals. The key challenges identified are related to the involvement of the supply chain, using the principles of the life cycle assessment, marketing communication and measurement of results and environmental benefits.
SOCIAL KNOWLEDGE MANAGEMENT, RESEARCH AND INNOVATION NETWORKS FOR INCLUSION
Directory of Open Access Journals (Sweden)
Sandra Ace vedo Zapata
2017-09-01
Full Text Available The objective is to describe the social management of knowledge through research and innovation networks to promote social inclusion. The reflection of the exploratory stage is presented within the doctoral thesis analyzing the challenges of the universities in the achievement of social inclusion with networks of research and innovation. A descriptive work was done, with documentary tracking, systematization and analysis. The findings show that it is necessary to articulate efforts in interdisciplinary and transdisciplinary networks with different actors: state, company, education, scientists, technologists and vulnerable, excluded populations, to build policies and strategies for social inclusion.
Change in the game : business model innovation in the video game industry across time
Locke, Austin; Uhrínová, Bianka
2017-01-01
Technological innovation has changed business models across multiple industries – retail (Amazon), taxi (Uber), hotel (Airbnb). Through exploratory research, using secondary data, this thesis describes changes that have occurred in video gaming industry from its creation to the current, modern era that are connected to technological innovation. Based on the current research of business models, the authors created a “Value Creation-Revenue Stream Framework” that they use to anal...
42 CFR 411.15 - Particular services excluded from coverage.
2010-10-01
... Section 411.15 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN... exclusion encompasses all devices irrespective of their size, form, or technological features that use one..., occupational, or speech-language therapy services, regardless of whether the services are furnished by (or...
Approaches to Innovation Process Assessment: Complex Results from an Exploratory Investigation
Directory of Open Access Journals (Sweden)
Ondrej Zizlavsky
2015-12-01
companies is noted. Therefore, this paper is supposed to motivate researchers to conduct more large-scale studies in the area of innovative performance measurement systems and their implementation in different business sectors and areas.
Lane, Joseph P
2015-01-01
Society typically relies on the industrial sector to supply product and service innovations through the free market system. In some areas of free market failure deemed important to society - such as Assistive Technology - governments intervene by applying alternative innovation systems. This paper contends that governments consistently and inappropriately support an exploratory grant approach led by academia which generates knowledge in conceptual and prototype states, and instead should shift to a procurement contract approach led by industry which designs, tests and deploys commercial products and services.
20 CFR 411.167 - What is an educational institution or a technical, trade or vocational school?
2010-04-01
... Education. (e) Approval by a State agency or subdivision of the State includes approval of a school, college... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false What is an educational institution or a technical, trade or vocational school? 411.167 Section 411.167 Employees' Benefits SOCIAL SECURITY...
Can Participatory Action Research Create Value for Business Model Innovation?
DEFF Research Database (Denmark)
Sparre, Mogens; Rasmussen, Ole Horn; Fast, Alf Michael
Innovation (BMI)?” – has been investigated from five different perspectives based upon The Business Model Cube and The Where to Look Model. Using both established and newly developed tools the paper presents how. Theory and data from two cases are presented and it is demonstrated how industry increase......Abstract: Participatory Action Research (PAR) has a longer academic history compared with the idea of business models (BMs). This paper indicates how industries gain by using the combined methodology. The research question "Can participatory action research create value for Business Model...... their monetary and/or non-monetary value creation doing BMI based upon PAR. The process is essential and using the methodology of PAR creates meaning. Behind the process, the RAR methodology and its link to BM and BMI may contribute to theory construction and creation of a common language in academia around...
Cabrero Izquierdo, María del Carmen
2012-01-01
Se aborda el tema de la parálisis cerebral definiendo qué es, clasificando los tipos de parálisis dependiendo de la afectación y las características principales. Se explican algunos de sus tratamientos, se dan sistemas alternativos y/o aumentativos de comunicación para un alumno con PC (parálisis cerebral).
7 CFR 28.411 - Good Middling Light Spotted Color.
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Good Middling Light Spotted Color. 28.411 Section 28... Light Spotted Color. Good Middling Light Spotted Color is color which in spot or color, or both, is between Good Middling Color and Good Middling Spotted Color. ...
Agents Network´s and Innovation in Traditional Small Business
Directory of Open Access Journals (Sweden)
Ricardo Augusto Bonotto Barboza
2016-12-01
Full Text Available The universe of micro and small enterprises (MSEs which is operating in traditional sectors of the economy have peculiar characteristics that is materialized in barriers to innovation, public policy of interventions are needed to minimize their difficulties. This study aimed to report the virtues , the limitations and difficulties of the implementation of two instruments as potential or as an actual innovations inducers in micro and small enterprises ( MSEs traditional base. The methodological strategy used included a qualitative research, exploratory, designed as simple cases study , with data collected through interviews and participant observation. It was found that the micro and small business traditional base, even those who are targets of public policies and programs have many difficulties to operationalize innovation. It was also noted that the junction of the two instruments potentiated innovative activities.
Simulation of the Quench-06 experiment with Scdapsim
International Nuclear Information System (INIS)
Angel M, E. del; Nunez C, A.; Amador G, R.
2003-01-01
The present work describes the pattern of the called Quench installation developed and used by the National Commission of Nuclear Security and Safeguards (CNSNS) for their participation in the International Standard Problem 45 (ISP), organized by the Nuclear Energy Agency (NEA). The exercise consisted on the simulation of the denominated experiment Quench-06 carried out in the experimental installation Quench located in the Forschungszentrum laboratory in Karlsruhe, Germany. The experiment Quench-06 consisted on simulating the sudden and late injection of water in a fuel assemble for a pressurized reactor (PWR). The CNSNS uses the version bd of the SCDAPSIM code developed by the company Innovative Software Systems (ISS) to simulate this experiment. The obtained results showed that the code is able to predict the experiment partially when overestimating the hydrogen production and of the partial fused of some fuel pellets, but predicting correctly the damage in the shroud. (Author)
The Dilemma of Service Productivity and Service Innovation
Aspara, Jaakko; Klein, Jan F.; Luo, Xueming; Tikkanen, Henrikki
2017-01-01
We conduct a systematic exploratory investigation of the effects of firms’ existing service productivity on the success of their new service innovations. Although previous research extensively addresses service productivity and service innovation, this is the first empirical study that bridges the gap between these two research streams and examines the links between the two concepts. Based on a comprehensive data set of new service introductions in a financial services market over a 14-year period, we empirically explore the relationship between a firm’s existing service productivity and the firm’s success in introducing new services to the market. The results unveil a fundamental service productivity-service innovation dilemma: Being productive in existing services increases a firm’s willingness to innovate new services proactively but decreases the firm’s capabilities of bringing these services to the market successfully. We provide specific insights into the mechanism underlying the complex relationship between a firm’s productivity in existing services, its innovation proactivity, and its service innovation success. For managers, we not only unpack and elucidate this dilemma but also demonstrate that a focused customer scope and growth market conditions may enable firms to mitigate the dilemma and successfully pursue service productivity and service innovation simultaneously. PMID:29706764
Directory of Open Access Journals (Sweden)
Yeshwant Singh
2014-01-01
Full Text Available Objective. The study aimed to evaluate the influences of coadministration of antiepileptic drugs (AEDs on an antimalarial candidate 99/411 pharmacokinetic (PK profile. Method. For this, single oral dose PK drug interaction studies were conducted between 99/411 and FDA approved AEDs, namely, Phenytoin (PHT, Carbamazepine (CBZ, and Gabapentin (GB in both male and female SD rats, to assess the coadministered and intersexual influences on 99/411 PK profile. Results. Studies revealed that there were no significant alterations in the PK profile of 99/411 upon PHT and CBZ coadministration in both male and female rats, while systemic exposure of 99/411 was significantly increased by about 80% in female rats upon GB coadministration. In terms of AUC, there was an increase from 2471 ± 586 to 4560 ± 1396 ng·h/mL. Overall, it was concluded that simultaneous administration of AEDs with 99/411 excludes the requirements for dose adjustment, additional therapeutic monitoring, contraindication to concomitant use, and/or other measures to mitigate risk, except for GB coadministration in females. These findings are further helpful to predict such interactions in humans, when potentially applied through proper allometric scaling to extrapolate the data.
Beyond venture capital : an exploratory study of the finance-innovation-policy nexus in cleantech
Migendt, Michael; Polzin, Friedemann|info:eu-repo/dai/nl/413317404; Schock, Florian; Täube, Florian A.; von Flotow, Paschen
2017-01-01
In recent years, scholarly interest in financing for innovation has grown, particularly for mitigating cli-mate change. However, extant literature has neglected the interaction of actors along the equity financing value chain, and the indirect effects of innovation and financial policy on the supply
Global Innovation in Emerging Economies | CRDI - Centre de ...
International Development Research Centre (IDRC) Digital Library (Canada)
21 déc. 2010 ... Au cours des dernières décennies, on a assisté à une véritable transformation en ce qui concerne l'innovation de la part des entreprises, notamment au chapitre du ... Deux grandes nouvelles tendances se démarquent : l'implantation, par les sociétés multinationales, de la recherche-développement (R-D) ...
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Can the EN keep the milestone and outcome payments even if the beneficiary does not achieve all outcome months? 411.555 Section 411.555 Employees... Payment Systems § 411.555 Can the EN keep the milestone and outcome payments even if the beneficiary does...
Cunningham, Margaret R; McIntosh, Kathryn A; Pediani, John D; Robben, Joris; Cooke, Alexandra E; Nilsson, Mary; Gould, Gwyn W; Mundell, Stuart; Milligan, Graeme; Plevin, Robin
2012-05-11
Proteinase-activated receptors 4 (PAR(4)) is a class A G protein-coupled receptor (GPCR) recognized through the ability of serine proteases such as thrombin and trypsin to mediate receptor activation. Due to the irreversible nature of activation, a fresh supply of receptor is required to be mobilized to the cell surface for responsiveness to agonist to be sustained. Unlike other PAR subtypes, the mechanisms regulating receptor trafficking of PAR(4) remain unknown. Here, we report novel features of the intracellular trafficking of PAR(4) to the plasma membrane. PAR(4) was poorly expressed at the plasma membrane and largely retained in the endoplasmic reticulum (ER) in a complex with the COPI protein subunit β-COP1. Analysis of the PAR(4) protein sequence identified an arginine-based (RXR) ER retention sequence located within intracellular loop-2 (R(183)AR → A(183)AA), mutation of which allowed efficient membrane delivery of PAR(4). Interestingly, co-expression with PAR(2) facilitated plasma membrane delivery of PAR(4), an effect produced through disruption of β-COP1 binding and facilitation of interaction with the chaperone protein 14-3-3ζ. Intermolecular FRET studies confirmed heterodimerization between PAR(2) and PAR(4). PAR(2) also enhanced glycosylation of PAR(4) and activation of PAR(4) signaling. Our results identify a novel regulatory role for PAR(2) in the anterograde traffic of PAR(4). PAR(2) was shown to both facilitate and abrogate protein interactions with PAR(4), impacting upon receptor localization and cell signal transduction. This work is likely to impact markedly upon the understanding of the receptor pharmacology of PAR(4) in normal physiology and disease.
Directory of Open Access Journals (Sweden)
Gianni A. Romani Chocce
2006-10-01
Full Text Available The aim of this research is to analyze the innovative potential of Small and Medium Enterprises (SMEs in the Region of Antofagasta - Chile. The paper makes a detailed bibliographic revision on regional innovation processes and presents the results of a questionnaire applied to SMEs, considered as innovative according to the Organization for Economic Co-operation and Development (OCDE criteria. Although these results have to be carefully considered, due to the size of the sample it is possible to observe that there is an increasing awareness of the importance of innovation in the region while, at the same time, many obstacles to innovate are recognized.
Directory of Open Access Journals (Sweden)
Xiao Chen
2017-08-01
Full Text Available Background: Andrographolide (ADR, the main active component of Andrographis paniculata, displays anticancer activity in various cancer cell lines, among which leukemia cell lines exhibit the highest sensitivity to ADR. In particular, ADR was also reported to have reduced drug resistance in multidrug resistant cell lines. However, the mechanism of action (MOA of ADR’s anticancer and anti-drug-resistance activities remain elusive. Methods: In this study, we used the MV4-11 cell line, a FLT3 positive acute myeloid leukemia (AML cell line that displays multidrug resistance, as our experimental system. We first evaluated the effect of ADR on MV4-11 cell proliferation. Then, a quantitative proteomics approach was applied to identify differentially expressed proteins in ADR-treated MV4-11 cells. Finally, cellular processes and signal pathways affected by ADR in MV4-11 cell were predicted with proteomic analysis and validated with in vitro assays. Results: ADR inhibits MV4-11 cell proliferation in a dose- and time-dependent manner. With a proteomic approach, we discovered that ADR inhibited fatty acid synthesis, cellular iron uptake and FLT3 signaling pathway in MV4-11 cells. Conclusions: ADR inhibits MV4-11 cell proliferation through inhibition of fatty acid synthesis, iron uptake and protein synthesis. Furthermore, ADR reduces drug resistance by blocking FLT3 signaling.
Evaluating Additionality of an Innovation Subsidy Program Targeted at SMEs: An Exploratory Study
Directory of Open Access Journals (Sweden)
Sonja Radas
2013-04-01
Full Text Available This paper explores the effectiveness of a recently introduced innovation subsidy program targeted at SMEs in Croatia. Three aspects of program additionality were evaluated: input, output and behavioral aspects. Both qualitative and survey research was employed, and four case studies with selected recipient companies were conducted. This study is a response to the policy-makers’ need for early program assessment. It attempts to show that even with early evaluation and small population of recipients it is possible to gain insight into program effectiveness. The analysis suggests that the effects of programs targeted at innovative SMEs might need to be evaluated differently than general subsidies. This is especially evident in the evaluation of input additionality. The analysis indicates that SMEs which started with a higher R&D capability tend to increase R&D intensity while participating in the program. The program raised R&D and innovation capability of the participating SMEs, but commercialization of project results remains a concern.
Arvanitis, Spyros; Loukis, Euripidis N
2016-05-01
Hospitals are making big investments in various types of ICT, so it is important to investigate their effects on innovation and performance. This paper presents an empirical study in this direction, based on data for 743 hospitals from 18 European countries. We specified and estimated econometrically five equations: one for product innovation, one for process innovation and three equations for the three different dimensions of (ICT-enabled) hospital performance. All five equations included various ICT-related variables reflecting ICT infrastructure and a series of important ICT applications, some of them hospital-specific, and some others of general business use, and also ICT personnel (viewed as a kind of 'soft' ICT investment), while the performance equations also included the two innovation measures.
Zhang, Rui; White, Andrew T.; Pour Biazar, Arastoo; McNider, Richard T.; Cohan, Daniel S.
2018-01-01
This study examines the influence of insolation and cloud retrieval products from the Geostationary Operational Environmental Satellite (GOES) system on biogenic emission estimates and ozone simulations in Texas. Compared to surface pyranometer observations, satellite-retrieved insolation and photosynthetically active radiation (PAR) values tend to systematically correct the overestimation of downwelling shortwave radiation in the Weather Research and Forecasting (WRF) model. The correlation coefficient increases from 0.93 to 0.97, and the normalized mean error decreases from 36% to 21%. The isoprene and monoterpene emissions estimated by the Model of Emissions of Gases and Aerosols from Nature are on average 20% and 5% less, respectively, when PAR from the direct satellite retrieval is used rather than the control WRF run. The reduction in biogenic emission rates using satellite PAR reduced the predicted maximum daily 8 h ozone concentration by up to 5.3 ppbV over the Dallas-Fort Worth (DFW) region on some days. However, episode average ozone response is less sensitive, with a 0.6 ppbV decrease near DFW and 0.3 ppbV increase over East Texas. The systematic overestimation of isoprene concentrations in a WRF control case is partially corrected by using satellite PAR, which observes more clouds than are simulated by WRF. Further, assimilation of GOES-derived cloud fields in WRF improved CAMx model performance for ground-level ozone over Texas. Additionally, it was found that using satellite PAR improved the model's ability to replicate the spatial pattern of satellite-derived formaldehyde columns and aircraft-observed vertical profiles of isoprene.
2003-01-01
"In this exploratory research, a value-chain analysis is used to investigate how industrial suppliers working with the European Research Laboratory for Particle Physics (CERN) gain benefits resulting from technological innovation".
DEFF Research Database (Denmark)
Jensen, Sisse Siggaard
2006-01-01
-systems, the paper introduces the designing strategy referred to as virtual exploratories. Some of the advanced virtual worlds may inspire the design of such provoking and challenging virtual exploratories, and especially the Massively Multi-User Online Role-Playing Games (MMORPGS). However, if we have to learn from...... the design and activity of the advanced virtual worlds and role-playing games, then the empirical research on the actors’ activity, while they are acting, is an important precondition to it. A step towards the conception of such a designing strategy for virtual exploratories is currently pursued....... [1] The research project: Actors and Avatars Communicating in Virtual Worlds – an Empirical Analysis of Actors’ Sense-making Strategies When Based on a Communication Theoretical Approach’ (2006-2007) is supported...
Records management: a basis for organizational learning and innovation
Directory of Open Access Journals (Sweden)
Francisco José Aragão Pedroza Cunha
Full Text Available The understanding of (transformations related to organizational learning processes and knowledge recording can promote innovation. The objective of this study was to review the conceptual contributions of several studies regarding Organizational Learning and Records Management and to highlight the importance of knowledge records as an advanced management technique for the development and attainment of innovation. To accomplish this goal, an exploratory and multidisciplinary literature review was conducted. The results indicated that the identification and application of management models to represent knowledge is a challenge for organizations aiming to promote conditions for the creation and use of knowledge in order to transform it into organizational innovation. Organizations can create spaces and environments for local, regional, national, and global exchange with the strategic goal of generating and sharing knowledge, provided they know how to utilize Records Management mechanisms.
19 CFR 10.411 - Certification of origin or other information.
2010-04-01
... Free Trade Agreement Import Requirements § 10.411 Certification of origin or other information. (a... the United States-Chile Free Trade Agreement; there has been no further production or any other... regional value content or other requirements specified in General Note 26(n), HTSUS; (3) Preference...
Shchekotikhin, Andrey E; Shtil, Alexander A; Luzikov, Yuri N; Bobrysheva, Tatyana V; Buyanov, Vladimir N; Preobrazhenskaya, Maria N
2005-03-15
A series of 3-aminomethyl derivatives of 4,11-dihydroxynaphtho[2,3-f]indole-5,10-dione was synthesized by Mannich reaction or by the transamination of 3-dimethylaminomethyl 4,11-dihydroxy- or 4,11-dimethoxynaphtho[2,3-f]indole-5,10-dione. The potency of novel derivatives was tested on a National Cancer Institute panel of 60 human tumor cell lines as well as in cells with genetically defined determinants of cytotoxic drug resistance, P-glycoprotein (Pgp) expression, and p53 inactivation. Mannich derivatives of 4,11-dihydroxynaphtho[2,3-f]indole-5,10-dione with an additional amino function in their side chain, demonstrated equal cytotoxicity against the parental K562 leukemia cells and their Pgp-positive subline, whereas the latter showed approximately 7-fold resistance to adriamycin, a Pgp transported drug. 3-(1-Piperazinyl)methyl and 3-(quinuclidin-3-yl)aminomethyl derivatives of 4,11-dihydroxynaphtho[2,3-f]indole-5,10-dione killed HCT116 colon carcinoma cells (carrying wild type p53) and their p53-null variant within the similar range of concentrations. We conclude that Mannich modification of 4,11-dihydroxynaphtho[2,3-f]indole-5,10-dione, especially when cyclic diamine (e.g., piperazine, quinuclidine) is used, confers an important feature to the resulting compounds, namely, the potency for tumor cells otherwise resistant to a variety of anticancer drugs.
The energy transition: new dialogues between cities and local stakeholders. Exploratory study
International Nuclear Information System (INIS)
Saxer, Olivia; Lacassagne, Sylvie; Guerin, Laura; Dupas, Stephane
2016-01-01
Energy Cities has carried out an exploratory study for cities and diverse project leaders desiring to start a sustainable energy transition in collaboration with all stakeholders in their territory. Local authorities have a key role to play in climate and energy policies and in the energy transition towards a low carbon, energy efficient and sustainable society. However, they cannot act alone. They often control only a small percentage of the emissions of local greenhouse gases directly, and this percentage rarely exceeds a quarter. It is therefore necessary to rely on the involvement of local stakeholders, which in turn will provide an opportunity for these stakeholders to be ambitious through innovative actions. How to stimulate stakeholders' involvement? In the past several years, a number of citizens', economic actors' or other local actors' initiatives have contributed to the energy transition of territories. These initiatives are based on empowerment. For instance, stakeholders can get access and the power to act on innovative tools and approaches, such as social economy, stakeholders' participation, crowd-funding, renewable energy citizen cooperatives and fab labs. Two primary questions to explore: As coordinators and pilots of local strategies for energy transition, how can local authorities foster, identify, support and replicate local energy transition initiatives? What dialogue should local authorities and leaders of local initiatives engage in? How can they drive new modes of governance, where stakeholders share responsibility to co-develop public policies, manage their city, and encourage the energy transition at the local level? We selected more than ten European energy transition initiatives, as diverse as they are innovative, anticipating new forms of governance and new ways to act and collaborate. The exploratory study does not only describe their process but it also analyses the synergies between the different stakeholders and the role the
Dörrie, J; Schuh, W; Keil, A; Bongards, E; Greil, J; Fey, G H; Zunino, S J
1999-10-01
The regulatory effects of IFNgamma on CD95 expression and CD95-mediated cell death were investigated in three high-risk pro-B acute lymphoblastic leukemia (ALL) lines that carry the chromosomal translocation t(4;11)(q21;q23). These leukemias are characteristically refractory to conventional chemotherapeutic treatments operating through the induction of apoptosis. However, the mechanisms leading to increased cell survival and resistance to cell death in these leukemias are largely unknown. Interferon-gamma (IFNgamma), a potent inhibitor of hematopoiesis, acts in part by upregulating CD95 and sensitizing cells to CD95-induced apoptosis. The t(4;11) lines SEM, RS4;11, and MV4;11 expressed low levels of CD95, but were completely resistant to CD95-mediated death. Addition of IFNgamma markedly upregulated CD95 expression in SEM (8-9-fold), RS4;11 (2-3-fold), and MV4;11 (2-3-fold) lines. However, after treatment with IFNgamma, only an 11% increase in sensitivity to CD95-mediated cell death was observed in SEM cells, whereas RS4;11 and MV4;11 cells remained resistant. Cycloheximide, but not actinomycin D or brefeldin A, increased CD95-specific cell death only in IFNgamma-treated RS4;11 cells by approximately 12%. Abundant levels of Bcl-2 and Bcl-XL, known to inhibit CD95-signaling in some cells, were present suggesting a possible role for both molecules in the resistance to CD95-mediated cell death. Resistance of the leukemic blasts to CD95-mediated cell death and the failure of IFNgamma to substantially sensitize the CD95-signaling pathway may contribute to the highly malignant phenotype of pro-B ALL with translocation t(4;11).
Songpol Kulviwat; Ramendra Thaku; Chiquan Guo
2006-01-01
An exploratory study was conducted to investigate consumer adoption of online purchase using a survey data set. Based upon the theory of innovation and self-efficacy theory, risk aversion, online proficiency, shopping convenience, and product choice variety were proposed to influence consumer intention to shop online, which, in turn, affects online purchases. Results of regression analyses revealed that all but shopping convenience were significant predictors of consumer intention to purchase...
Collet, Jean-Paul; Skippen, Peter W; Mosavianpour, Mir Kaber; Pitfield, Alexander; Chakraborty, Bubli; Hunte, Garth; Lindstrom, Ronald; Kissoon, Niranjan; McKellin, William H
2014-01-08
Despite considerable efforts, engaging staff to lead quality improvement activities in practice settings is a persistent challenge. At British Columbia Children's Hospital (BCCH), the pediatric intensive care unit (PICU) undertook a new phase of quality improvement actions based on the Community of Practice (CoP) model with Participatory Action Research (PAR). This approach aims to mobilize the PICU 'community' as a whole with a focus on practice; namely, to create a 'community of practice' to support reflection, learning, and innovation in everyday work. An iterative two-stage PAR process using mixed methods has been developed among the PICU CoP to describe the environment (stage 1) and implement specific interventions (stage 2). Stage 1 is ethnographic description of the unit's care practice. Surveys, interviews, focus groups, and direct observations describe the clinical staff's experiences and perspectives around bedside care and quality endeavors in the PICU. Contrasts and comparisons across participants, time and activities help understanding the PICU culture and experience. Stage 2 is a succession of PAR spirals, using results from phase 1 to set up specific interventions aimed at building the staff's capability to conduct QI projects while acquiring appropriate technical skills and leadership capacity (primary outcome). Team communication, information, and interaction will be enhanced through a knowledge exchange (KE) and a wireless network of iPADs. Lack of leadership at the staff level in order to improve daily practice is a recognized challenge that faces many hospitals. We believe that the PAR approach within a highly motivated CoP is a sound method to create the social dynamic and cultural context within which clinical teams can grow, reflect, innovate and feel proud to better serve patients.
20 CFR 411.180 - What is timely progress toward self-supporting employment?
2010-04-01
... Who Are Using a Ticket Introduction § 411.180 What is timely progress toward self-supporting... the previous 12-month progress certification period. In computing any 12-month progress certification...
Par Pond vegetation status 1996
International Nuclear Information System (INIS)
Mackey, H.E. Jr.; Riley, R.S.
1996-12-01
The water level of Par Pond was lowered approximately 20 feet in mid-1991 in order to protect downstream residents from possible dam failure suggested by subsidence on the downstream slope of the dam and to repair the dam. This lowering exposed both emergent and nonemergent macrophyte beds to drying conditions resulting in extensive losses. A survey of the newly emergent, shoreline aquatic plant communities of Par Pond began in June 1995, three months after the refilling of Par Pond to approximately 200 feet above mean sea level. These surveys continued in July, September, and late October, 1995, and into the early spring and late summer of 1996. Communities similar to the pre-drawdown, Par Pond aquatic plant communities continue to become re-established. Emergent beds of maidencane, lotus, waterlily, watershield, and Pontederia are extensive and well developed. Measures of percent cover, width of beds, and estimates of area of coverage with satellite data indicate regrowth within two years of from 40 to 60% of levels prior to the draw down. Cattail occurrence continued to increase during the summer of 1996, especially in the former warm arm of Par Pond, but large beds common to Par Pond prior to the draw down still have not formed. Lotus has invaded and occupies many of the areas formerly dominated by cattail beds. To track the continued development of macrophytes in Par Pond, future surveys through the summer and early fall of 1997, along with the evaluation of satellite data to map the extent of the macrophyte beds of Par Pond, are planned
Luo, Dong-jiao; Yan, Jie; Mao, Ya-fei; Li, Shu-ping; Luo, Yi-hui; Li, Li-wei
2005-01-01
To construct lipL32/1-lipL41/1 fusion gene and its prokaryotic expression system and to determine frequencies of carrying and expression of lipL32 and lipL41 genes in L.interrogans wild strains and specific antibody levels in sera from leptospirosis patients. lipL32/1-lipL41/1 fusion gene was constructed using linking primer PCR method and the prokaryotic expression system of the fusion gene done with routine techniques. SDS-PAGE was used to examine expression of the target recombinant protein rLipL32/1-rLipL41/1. Immunogenicity of rLipL32/1-rLipL41/1 was identified by Western blot. PCR and MAT were performed to detect carrying and expression of lipL32 and lipL41 genes in 97 wild L.interrogans strains. Antibodies against products of lipL32 and lipL41 genes in serum samples from 228 leptospirosis patients were detected by ELISA method. The homogeneity of nucleotide and putative amino acid sequence of lipL32/1-lipL41/1 fusion gene were 99.9 % and 99.8 % in comparison with the reported sequences. Expression output of the target recombinant protein rLipL32/1-rLipL41/1, mainly present in inclusion body, accounted for 10 % of the total bacterial proteins. Both the rabbit antisera against rLipL32/1 and rLipL41/1 could combine to rLipL32/1-rLipL41/1. 97.9 % and 87.6 % of the L.interrogans wild strains had lipL32 and lipL41 genes, respectively. 95.9 % and 84.5 % of the wild strains were positive for MAT with titers of 1:4 - 1:128 using rabbit anti-rLipL32s or anti-rLipL41s sera, respectively. 94.7 % - 97.4 % of the patients'serum samples were positive for rLipL32s antibodies, while 78.5 % - 84.6 % of them were rLipL41s antibodies detectable. lipL32/1-jlipL41/1 fusion gene and its prokaryotic expression system were successfully constructed. The expressed fusion protein had qualified immunogenicity. Both the lipL32 and lipL41 genes are extensively carried and frequently expressed by different serogroups of L.interrogans, and their expression products exhibit cross-antigenicity.
23 CFR 650.411 - Procedures for bridge replacement and rehabilitation projects.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Procedures for bridge replacement and rehabilitation... ENGINEERING AND TRAFFIC OPERATIONS BRIDGES, STRUCTURES, AND HYDRAULICS Highway Bridge Replacement and Rehabilitation Program § 650.411 Procedures for bridge replacement and rehabilitation projects. (a) Consideration...
Navigating the Tensions of Innovative Assessment and Pedagogy in Higher Education
Directory of Open Access Journals (Sweden)
Jennifer Lock
2018-04-01
Full Text Available Innovative practice in a classroom adds challenges and tensions to programs and institutional structures in higher education. With the recent emphasis on curricula reform, there is a great focus on assessment and pedagogical practices to support student learning. To illustrate the tensions arising from these efforts, we present four pedagogical and assessment innovation approaches using both Shulman’s (2005 Signature Pedagogies and Tatar’s (2007 Design Tensions frameworks. The four approaches include problem-based learning, game-based learning, case-based learning, and technology-enhanced learning. A narrative for each approach examines and addresses tensions using Shulman’s (2005 surface, deep and implicit structures. We argue that there is an interconnected complexity and conflicting visions among the micro- (e.g., classroom or practicum, meso- (e.g., program, and macro- (e.g., institution levels. We acknowledge that dynamic tensions continually exist and needs to be thoughtfully navigated in support of innovative assessment and pedagogies in higher education. Dans l’enseignement supérieur, les pratiques innovatrices en salle de classe ajoutent des défis et des tensions aux programmes et aux structures institutionnelles. Suite à l’importance accrue récemment attachée à la réforme des programmes d’études, l’accent est mis sur l’évaluation et les pratiques pédagogiques pour soutenir l’apprentissage des étudiants. Afin d’illustrer les tensions qui découlent de ces efforts, nous présentons quatre approches de pédagogie et d’évaluation innovatrices qui font appel à la fois aux cadres de Shulman, Signature Pedagogies (2005, et à ceux de Tatar, Design Tensions (2007. Les quatre approches comprennent l’apprentissage par problèmes, l’apprentissage fondé sur le jeu, l’apprentissage basé sur des cas et l’apprentissage amélioré par les technologies. Chaque approche est examinée et traite des tensions
42 CFR 411.204 - Medicare benefits secondary to LGHP benefits.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Medicare benefits secondary to LGHP benefits. 411... benefits secondary to LGHP benefits. (a) Medicare benefits are secondary to benefits payable by an LGHP for services furnished during any month in which the individual— (1) Is entitled to Medicare Part A benefits...
2010-01-01
... airship that is a light-sport aircraft. (e) Lighter-than-air category and balloon class privileges, (1) 35... apply for a flight instructor certificate with a sport pilot rating? 61.411 Section 61.411 Aeronautics... CERTIFICATION: PILOTS, FLIGHT INSTRUCTORS, AND GROUND INSTRUCTORS Flight Instructors With a Sport Pilot Rating...
Developing a Scale for Innovation Management at Schools: A Study of Validity and Reliability
Bulbul, Tuncer
2012-01-01
The purpose of this study is to develop a valid and reliable assessment tool for use in determining the competency beliefs of school administrators about innovation management. The scale applied to a study group of 216 school administrators, after work Centered on assessing intelligibility and specialized opinion. Exploratory and confirmatory…
Innovations et métallurgies en Méditerranée occidentale (XIIIe–XVe siècles
Directory of Open Access Journals (Sweden)
Verna, Catherine
2011-12-01
Full Text Available After a definition of technical innovation in the Middle Ages and it’s relationship to industry, this paper explores it’s characteristics in the fi eld of iron and silver (silver-bearing lead and copper metallurgy from the 13th to the 15th centuries in the western Mediterranean area. The exploration opens with a synthesis of the circulation of iron and steel products, with special care taken over the definition of their respective qualities, in particular the distinction between iron and steel; the exploration continues with an introduction to specific technical territories related to industrial “districts”, which allows the author to present the study of the circulation of technical knowledge. The paper concludes with a study of notables (Catalan in particular as rural entrepreneurs who invested in the technical innovation of their time.[fr] Après avoir défi ni l’innovation technique au Moyen Âge et ses rapports à l’industrie, cet article en étudie les caractéristiques dans les domaines de la métallurgie du fer et de l’argent (plomb et cuivre argentifères du XIIIe au XVe siècle, en Méditerranée occidentale. Cet examen s’ouvre par un tableau de la circulation des produits sidérurgiques, attentif à la définition de leurs qualités respectives, en particulier à la distinction fer-acier; il se poursuit par la présentation des territoires techniques spécifiques associés à des districts industriels, ce qui permet à l’auteur d’aborder l’étude des circulations des savoirs techniques. L’article se conclut par une étude des notables (en particulier catalans, entrepreneurs ruraux, qui ont investi dans l’innovation technique.
2014-01-01
Background Despite considerable efforts, engaging staff to lead quality improvement activities in practice settings is a persistent challenge. At British Columbia Children’s Hospital (BCCH), the pediatric intensive care unit (PICU) undertook a new phase of quality improvement actions based on the Community of Practice (CoP) model with Participatory Action Research (PAR). This approach aims to mobilize the PICU ‘community’ as a whole with a focus on practice; namely, to create a ‘community of practice’ to support reflection, learning, and innovation in everyday work. Methodology An iterative two-stage PAR process using mixed methods has been developed among the PICU CoP to describe the environment (stage 1) and implement specific interventions (stage 2). Stage 1 is ethnographic description of the unit’s care practice. Surveys, interviews, focus groups, and direct observations describe the clinical staff’s experiences and perspectives around bedside care and quality endeavors in the PICU. Contrasts and comparisons across participants, time and activities help understanding the PICU culture and experience. Stage 2 is a succession of PAR spirals, using results from phase 1 to set up specific interventions aimed at building the staff’s capability to conduct QI projects while acquiring appropriate technical skills and leadership capacity (primary outcome). Team communication, information, and interaction will be enhanced through a knowledge exchange (KE) and a wireless network of iPADs. Relevance Lack of leadership at the staff level in order to improve daily practice is a recognized challenge that faces many hospitals. We believe that the PAR approach within a highly motivated CoP is a sound method to create the social dynamic and cultural context within which clinical teams can grow, reflect, innovate and feel proud to better serve patients. PMID:24401288
CONSUMERS' PERCEPTION ON INNOVATION IN THE TOURISM VALUE CHAIN
Directory of Open Access Journals (Sweden)
Ravar Anamaria Sidonia
2013-07-01
Full Text Available In the current economic environment, innovation is considered critical by the majority of tourism companies that are increasingly willing to spend more to become more innovative. This tendency is visible in all segments of the tourism value chain: accommodation services, transportation, intermediaries – travel agencies and tour-operators – as well at entertainment and leisure facilities. The final aim of innovation in tourism enterprises is to increase customer satisfaction and thus secure the enterprises' competitive advantage on a continuously changing market. Thus, consumers' perception on innovation is relevant not only to academics and researchers, but especially to organisations in the business environment, which use customer feedback in order to develop innovative products which are better suited to the individual needs of tourists. The purpose of this article is to determine how consumers of tourist services perceive innovation in the various segments of the tourism value chain. The results will indicate the perceived intensity with which innovation is implemented in the tourism industry as well as the sectors in which innovation could bring additional benefits to tourists. To this aim, it was conducted a literature review on the main types of innovations in hospitality, airline transportation and travel intermediaries, as well as a pilot questionnaire-based study on 120 regular consumers of tourist services. Results indicate a discrepancy between the importance tourists give to innovation and the actual perceived level of innovation in the tourism value chain. Furthermore, the research shows the importance of innovation in different segments of the tourism value chain in the purchase decision of a tourism product. Unfortunately, results indicate that Romanian tourism operators' perceived innovativeness is lower in comparison with foreign tourism operators. The study is exploratory, representing a starting point into a more
Directory of Open Access Journals (Sweden)
Marcelo Seido Nagano
2014-09-01
Full Text Available The goal of this study is to investigate the use of product innovation management practices and the challenges faced by organizations when increasing their innovative performance. To this end, we analyzed the relationships between internal organizational elements, as well as the influence of contextual factors (size, field and source of capital in the characterization of innovation management systems and of barriers to innovation faced by each company. We chose this topic due to the fact that management processes that leverage innovative performance are not yet fully understood, and because of the lack of empirical studies that analyze the reality of the practices proposed in the organizational world, especially in Brazil. As a conceptual basis, we presented modern approaches to innovation, which recognize that this should not be seen as an isolated event but as a process. Exploratory qualitative research was carried out by means of a multiple case study. In it, we studied the innovation management systems of four companies which present relevant product development activities in Brazil. As well as a detailed study of the elements of innovation management, this article includes contributions referring to the characterization of organizational challenges faced by organizations when managing their innovation process.
Differentiating innovation priorities among stakeholder in hospital care.
Lambooij, Mattijs S; Hummel, Marjan J
2013-08-16
Decisions to adopt a particular innovation may vary between stakeholders because individual stakeholders may disagree on the costs and benefits involved. This may translate to disagreement between stakeholders on priorities in the implementation process, possibly explaining the slow diffusion of innovations in health care. In this study, we explore the differences in stakeholder preferences for innovations, and quantify the difference in stakeholder priorities regarding costs and benefits. The decision support technique called the analytic hierarchy process was used to quantify the preferences of stakeholders for nine information technology (IT) innovations in hospital care. The selection of the innovations was based on a literature review and expert judgments. Decision criteria related to the costs and benefits of the innovations were defined. These criteria were improvement in efficiency, health gains, satisfaction with care process, and investments required. Stakeholders judged the importance of the decision criteria and subsequently prioritized the selected IT innovations according to their expectations of how well the innovations would perform for these decision criteria. The stakeholder groups (patients, nurses, physicians, managers, health care insurers, and policy makers) had different preference structures for the innovations selected. For instance, self-tests were one of the innovations most preferred by health care insurers and managers, owing to their expected positive impacts on efficiency and health gains. However, physicians, nurses and patients strongly doubted the health gains of self-tests, and accordingly ranked self-tests as the least-preferred innovation. The various stakeholder groups had different expectations of the value of the nine IT innovations. The differences are likely due to perceived stakeholder benefits of each innovation, and less to the costs to individual stakeholder groups. This study provides a first exploratory quantitative
Robert, Jean-michel; Maestrini, Serge; Heral, Maurice; Zanette, Yvan
1981-01-01
L'utilisation de tests biologiques dans l'étude de la fertilité des eaux de claires ainsi que l'analyse chimique des réserves en sels nutritifs des mêmes eaux montrent qu'une part importante de la biomasse micro-algale peut être produite dans ces bassins, par assimilation par les cellules de substances organiques dissoutes. Ainsi, pour l'azote, des estimations indirectes aboutissent à des quantités de cet élément assimilé sous forme organique variant entre 0,6 et 30,7 µg-at.I-1 selon les mode...
Developing and testing the patient-centred innovation questionnaire for hospital nurses.
Huang, Ching-Yuan; Weng, Rhay-Hung; Wu, Tsung-Chin; Lin, Tzu-En; Hsu, Ching-Tai; Hung, Chiu-Hsia; Tsai, Yu-Chen
2018-03-01
Develop the patient-centred innovation questionnaire for hospital nurses and establish its validity and reliability. Patient-centred care has been adopted by health care managers in their efforts to improve health care quality. It is regarded as a core concept for developing innovation. A cross-sectional study was employed to collect data from hospital nurses in Taiwan. This study was divided into two stages: pilot study and main study. In the main study, 596 valid responses were collected. This study adopted reliability analysis, exploratory factor analysis, confirmatory factor analysis and selected nurse innovation scale as a criterion to test criterion-related validity. Five-dimension patient-centred innovation questionnaire was proposed: access and practicability, co-ordination and communication, sharing power and responsibility, care continuity, family and person focus. Each dimension demonstrated a reliability of 0.89-0.98. All dimensions had acceptable convergent and discriminate validity. The patient-centred innovation questionnaire and nurse innovation scale exhibited a significantly positive correlation. Patient-centred innovation questionnaire not only had a good theoretical basis but also had sufficient reliability and construct validity, and criterion-related validity. Patient-centred innovation questionnaire could give a measure for evaluating the implementation of patient-centred care and could be used as a management tool during the process of nurse innovation. © 2017 John Wiley & Sons Ltd.
Protease-activated receptor (PAR)-2 is required for PAR-1 signalling in pulmonary fibrosis
Lin, Cong; von der Thüsen, Jan; Daalhuisen, Joost; ten Brink, Marieke; Crestani, Bruno; van der Poll, Tom; Borensztajn, Keren; Spek, C. Arnold
2015-01-01
Idiopathic pulmonary fibrosis is the most devastating diffuse fibrosing lung disease of unknown aetiology. Compelling evidence suggests that both protease-activated receptor (PAR)-1 and PAR-2 participate in the development of pulmonary fibrosis. Previous studies have shown that bleomycin-induced
Liens entre le savoir et l'innovation dans les services de gestion des ...
International Development Research Centre (IDRC) Digital Library (Canada)
Ce projet de recherche-action portera sur l'innovation dans la prestation de services par les administrations locales au Sri Lanka. Il ciblera principalement les administrateurs locaux chargés de la prestation des services de gestion des déchets solides. Les chercheurs établiront dans quelle mesure les interactions entre les ...
Thapa, Bikram Bahadur; Agarwal, Aniruddha; Singh, Ramandeep; Gupta, Parul Chawla; Ram, Jagat
2016-05-01
To compare outcomes of phacoaspiration (PA) with Cionni ring-assisted posterior-chamber intraocular lens implantation (PCIOL) versus pars plana lensectomy (PPL) with anterior vitrectomy (AV) and sutureless transscleral fixation of the IOL (TSFIOL) assisted with fibrin glue in the management of a subluxated lens. In this prospective and comparative interventional study, one eye of children with a bilateral subluxated lens was randomized to undergo PA with PCIOL using a Cionni ring (group A: n = 14 eyes), and the other eye underwent PPL + AV with glue-assisted TSFIOL (group B: n = 14 eyes). The outcome measures included best-corrected visual acuity (BCVA) in logMAR units and rates of complications at 12-month follow-up visits. 28 eyes of 14 children (age: 8.06 ± 4.49 years) were included in the study. BCVA improved from preoperative value of 1.21 to 0.4 (p = 0.001) in group A and from 1.53 to 0.31 (p = 0.001) in group B at month 12. There was no significant difference in the BCVA on comparing the two groups at month 12 (p > 0.411). Postoperative complications in group A included corneal edema (two eyes), Cionni hook capture (one eye), elevated IOP (one eye), and posterior capsular opacification (five eyes). In group B, corneal edema was seen in two eyes, hypotony in one eye, vitreous hemorrhage in one eye and pupillary optic capture in four eyes. Head-to-head comparison of the two techniques demonstrates no significant difference in the rates of complications at month 12. The decision to choose either technique may be based on the operating surgeon's skill, experience and preference.
Paredes-Chi, Arely Anahy; Castillo-Burguete, María Teresa
2018-06-01
Normal schools in Mexico train teachers for basic level education. Classified as Higher Education Institutions, part of their mandate is to conduct scientific research to improve educational quality. Currently, normal school students can meet graduation requirements by either writing a thesis or reporting on professional practice using Participatory Action Research (PAR). Teachers at normal schools have only limited experience in conducting and supervising PAR projects. With the aim of analyzing the situation and addressing this paradox, we used PAR to develop a plan to train normal school teachers in application of PAR methodology. We present the training proposal and evaluate its results in a pilot phase. These suggest that PAR represents an innovative option for training teachers to conduct research and therefore fulfill part of their responsibilities at normal schools in Mexico. Changes in institutional culture and structure would be required for successful implementation of PAR in this context. Copyright © 2018 Elsevier Ltd. All rights reserved.
Hourd, P C; Williams, D J
2008-07-01
This paper reports the results from an exploratory study that sets out to identify and compare the strategic approaches and patterns of business practice employed by 14 UK small- and medium-sized enterprises to achieve success in the medical device sector of the health-care industry. An interview-based survey was used to construct individual case studies of the medical device technology (MDT) companies. A cross-case analysis was performed to search for patterns and themes that cut across these individual cases. Exploratory results revealed the heterogeneity of MDT companies and the distinctive features of the MDT innovation process that emphasize the importance of a strategic approach for achieving milestones in the product development and exploitation process and for creating value for the company and its stakeholders. Recognizing the heterogeneity of MDT companies, these exploratory findings call for further investigation to understand better the influence of components of the MDT innovation process on the commercialization life cycle and value trajectory. This is required to assist start-up or spin-out MDT companies in the UK and worldwide to navigate the critical transitions that determine access to financial and consumer markets and enhance the potential to build a successful business. This will be important not only for bioscience-based companies but also for engineering-based companies aiming to convert their activities into medical devices and the health- and social-care market.
Stimulation de la capacité d'innovation des micro, petites et ...
International Development Research Centre (IDRC) Digital Library (Canada)
Stimulation de la capacité d'innovation des micro, petites et moyennes entreprises d'Asie par le truchement d'intermédiaires ... En plus d'études de cas comparatives menées en Chine et en Thaïlande, des bourses de recherche menant à la maîtrise ou au doctorat seront octroyées à de jeunes professeurs ainsi qu'à des ...
Creating the environment for innovation and entrepreneurship
Directory of Open Access Journals (Sweden)
Paul M. Lane
2016-10-01
Full Text Available Innovation generation and diffusion have been widely acknowledged as hinging upon the complex set of institutional, social and psychological processes. The objective of the paper is to examine the need and possibilities of creating the environment for innovation and entrepreneurship in the university setting. In particular, this paper focuses on interrelationships and roles of specific groups of university members: the administration, faculty and students. The study is exploratory in character, based on observations and literature review. It starts with defining modern-day university as home of innovation emphasizing the need for interdisciplinary and interinstitutional approaches. The paper discusses the need of faculty to learn to reach across the institution and beyond to work with others, working across silos of academia and meeting with others from very different disciplines. Second it examines ways the university administration support can encourage innovation among its faculty, staff and students. Third, it draws on existing research to identify key dimensions of change. The study proposes pathways that may activate the mechanisms of climate and infrastructure for innovation. The proposed dimensions and analyzed areas of change can potentially form the foundations of a framework for universities seeking to diagnose their existing condition and use such findings to enhance the generation and diffusion of innovation. The university quest to break down the barriers and reach across the disciplines to generate innovation takes commitment which needs to be coupled with administrative change such as the reward structures lined up with the vision and changes regarding the teaching and learning practices as well as the physical environment for the classes, the class rooms and meeting spaces of students and faculty.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false What effect will the subsequent entitlement to title II benefits have on EN payments for title XVI beneficiaries after they assign their ticket? 411.552 Section 411.552 Employees' Benefits SOCIAL SECURITY ADMINISTRATION THE TICKET TO WORK AND SELF...
20 CFR 658.411 - Filing and assignment of JS-related complaints.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Filing and assignment of JS-related... Agency Js Complaint System § 658.411 Filing and assignment of JS-related complaints. (a) JS-related... office personnel shall be as follows: (1) All JS-related complaints filed with a local office, and...
Directory of Open Access Journals (Sweden)
Roberta Rodrigues Faoro
2017-04-01
Full Text Available Introduction: this paper presents an analysis of the sharing of knowledge and innovation in the inter-relationships of the type outsourcing of Information Technology. Objective: analyze the existence of relationship between knowledge sharing and innovation in the inter-relationships of the type of outsourcing information technology (IT. Methodology: research is exploratory, qualitative and using as a strategy the multiple case study, which analyzed 12 companies in IT outsourcing environments, 4 suppliers of IT and IT 8 client companies. Data were collected through semi structured interviews, documentary and direct observation. Results: it can be noted that the sharing of knowledge showed contribute to the existence of innovation in IT outsourcing environment. The suppliers prioritize the codification of shared knowledge, while customers prefer the sharing of knowledge through informal conversations. It was identified that the motives for outsourcing IT may be related to the sharing of knowledge and innovation. Conclusions: this research contributes to the advancement of knowledge about the knowledge and innovation sharing phenomena in outsourcing of IT environments.
18 CFR 367.4115 - Account 411.5, Investment tax credit adjustments, other.
2010-04-01
..., Investment tax credit adjustments, other. 367.4115 Section 367.4115 Conservation of Power and Water Resources....4115 Account 411.5, Investment tax credit adjustments, other. This account must include the amount of those investment tax credit adjustments not properly included in other accounts. ...
Mayhew, Matthew J.; Simonoff, Jeffrey S.; Baumol, William J.; Selznick, Benjamin S.; Vassallo, Stephen J.
2016-01-01
The purpose of this exploratory study was to examine the cultivation of innovative entrepreneurial intentions among students in three distinctive educational settings: a U.S. undergraduate four-year environment, a U.S. M.B.A. two-year environment, and a German five-year business and technology environment. Results suggested that innovative…
Querbes, A.
2011-01-01
The trivialization of smartphones has given rise to an architectural reconfiguration of the mobile operating system innovation process. We have also seen the recent emergence of three ?open source? consortia: the Symbian and LiMo Foundations, and the Open Handset Alliance. In this exploratory paper,
Foresight and the third mission of universities: the case for innovation system foresight
DEFF Research Database (Denmark)
Piirainen, Kalle A.; Dahl Andersen, Allan; Andersen, Per Dannemand
2016-01-01
and innovation dimensions through the development of joint understanding of the agendas and future needs of stakeholders. In addition, foresight enables education to be designed to address identified needs. Research limitations/implications – The findings are both conceptual and exploratory in nature...... analyse the third mission and relevant literature on innovation systems and foresight to explain how and why foresight contributes to the third mission. Findings – The authors propose that foresight contributes to the third mission of universities,particularly to the research and development.......Thus, the argument needs further examination through a broader study on foresight in the university–industry context and/or longitudinal research on the outcomes and impact of foresight in this context. Practical implications – The findings highlight the importance of understanding the systemic nature of innovation...
Guo, Wei; Zheng, Qing; An, Weijin; Peng, Wei
2017-09-01
Collaborative innovation (co-innovation) community emerges as a new product design platform where companies involve users in the new product development (NPD) process. Large numbers of users participate and contribute to the process voluntarily. This exploratory study investigates the heterogeneous roles of users based on a global co-innovation project in online community. Content analysis, social network analysis and cluster method are employed to measure user behaviors, distinguish user roles, and analyze user contributions. The study identifies six user roles that emerge during the NPD process in co-innovation community: project leader, active designer, generalist, communicator, passive designer, and observer. The six user roles differ in their contribution forms and quality. This paper contributes to research on co-innovation in online communities, including design team structure, user roles and their contribution to design task and solution, as well as user value along the process. In addition, the study provides practices guidance on implementing project, attracting users, and designing platform for co-innovation community practitioners. Copyright © 2017 Elsevier Ltd. All rights reserved.
Marketing of Patents for Innovation: A Study in Brazilian Multicase Universities
Directory of Open Access Journals (Sweden)
Felipe de Almeida Malvezzi
2014-11-01
Full Text Available Ways to make patents Brazilian universities in innovation has been discussed both by academia and by the funding agencies in order to generate, in addition to knowledge, social and economic benefits to the university and to society in general. In this sense, this research aimed to understand the strategies and marketing practices developed by Brazilian universities for the promotion and commercialization of patent records, aiming at innovation. The assumption for this research is that the use of marketing strategies is a necessary and fundamental for the successful transfer of patents when it sees technological innovation. The research is exploratory qualitative approach based on references, interviews and multi case study. After gathering and analyzing data involving UNICAMP, USP and UFMG in promoting and marketing your patents, it was observed that the main marketing practices identified were: inventory and classification of patents, agents of innovation, integrated marketing communication, technological showcase, executive summary of patents, event promotion and institutional visits. We also conclude, in the context of marketing innovation management at the university, the biggest challenge is to work radical and incremental innovation differently and simultaneously, since both are necessary for scientific and technological development in the short and long term.
Im, Subin; Hu, Michael Y; Toh, Rex S
2003-12-01
The Kirton Adaption-Innovation Inventory, which is a widely used measure of innovative (as opposed to adaptive) cognitive individual style, is believed to have three dimensions: Sufficiency of Originality, Efficiency, and Rule/Group Conformity. Several studies have raised concerns regarding its construct validity, specifically with respect to the Sufficiency of Originality subscale. Within this subscale, exploratory factor analysis identified two distinct subdimensions, Idea Generation and Preference for Change. In this study, we used a sample of 356 household participants (with an average age of 56 yr., average income of 39,700 dollars, and average of 15 yr. of education) from the Arkansas Household Research Panel. We then employed Bollen and Grandjean's approach based on confirmatory factor analysis to assess whether there are actually two distinct subdimensions instead of one. Our study shows that within the Sufficiency of Originality subscale, there are indeed two distinct subdimensions, Idea Generation and Preference for Change. Further analyses indicate that dropping double-loaded items identified through exploratory factor analysis significantly improves the fit statistics. Also, allowing correlated errors for the measurement items that belong to the same subdimension can also significantly improve the overall fit of the model based on chi-square statistics.
Par Pond vegetation status Summer 1995 -- Summary
International Nuclear Information System (INIS)
Mackey, H.E. Jr.; Riley, R.S.
1996-01-01
The water level of Par Pond was lowered approximately 20 feet in mid-1991 in order to protect downstream residents from possible dam failure suggested by subsidence on the downstream slope of the dam and to repair the dam. This lowering exposed both emergent and nonemergent macrophyte beds to drying conditions resulting in extensive losses. A survey of the newly emergent, shoreline aquatic plant communities of Par Pond began in June 1995, three months after the refilling of Par Pond to approximately 200 feet above mean sea level. These surveys continued in July, September, and late October, 1995. Communities similar to the pre-drawdown, Par Pond aquatic plant communities are becoming re-established. Emergent beds of maidencane, lotus, waterlily, and watershield are extensive and well developed. Cattail occurrence continued to increase during the summer, but large beds common to Par Pond prior to the drawdown have not formed. Estimates from SPOT HRV, remote sensing satellite data indicated that as much as 120 hectares of emergent wetlands vegetation may have been present along the Par Pond shoreline by early October, 1995. To track the continued development of macrophytes in Par Pond, future surveys throughout 1996 and 1997, along with the continued evaluation of satellite data to map the areal extent of the macrophyte beds of Par Pond, are planned
The Potential for Innovation in the Swedish Food Sector
Beckeman, Märit
2011-01-01
The food sector in Sweden, comprised of retailers, food manufacturers and packaging suppliers, has been investigated, guided by two research questions: What does “innovation” mean to the different actors (i.e. is there a gap in opinions)? How is innovation performed and what are the key issues? But before this research of the present, the past was studied (the author’s licentiate) to identify and describe the factors and reasons behind the growing food sector in Sweden after World War II, par...
Innovation en matière de biocarburants sous le signe de l'inclusion ...
International Development Research Centre (IDRC) Digital Library (Canada)
Ce projet favorisera une innovation en matière de biocarburants qui prend en compte tous les acteurs pertinents, dont les femmes vivant en milieu rural. Les chercheurs ... Des chercheurs appuyés par le CRDI parlent de leurs expériences au Comité sur les ONG lors du forum de la Commission de la condition de la femme.
Organizational Values and Innovative Organizational Knowledge Creation
Directory of Open Access Journals (Sweden)
Lilian Aparecida Pasquini Miguel
2009-01-01
Full Text Available Innovation is a source of competitive advantage and is based on the continuous creation of organizational knowledge, which is supported by the individual learning. The individual learning of traditional / comportamentalist and constructivist nature can be understood, by extension, as organizational learning. The knowledge can be innovative if, along with the enabling conditions that characterize it - intention, fluctuation or chaos, autonomy, redundancy and variety of requirements – the process of learning is based on a constructivist nature, the only one capable to generate new learning solutions. The organizational values are beliefs that guide the organizations behavior and constitute motivational goals. This work had as aim to identify the relationship between organizational values and the creation of knowledge. The descriptive exploratory research used the quantitative method. The organizational values appeared in this study mainly associated to the knowledge creation aspects in the internal sphere of the organizations. The orientation towards the external environment appeared less related to the organizational values.
ParABS system in chromosome partitioning in the bacterium Myxococcus xanthus.
Directory of Open Access Journals (Sweden)
Antonio A Iniesta
Full Text Available Chromosome segregation is an essential cellular function in eukaryotic and prokaryotic cells. The ParABS system is a fundamental player for a mitosis-like process in chromosome partitioning in many bacterial species. This work shows that the social bacterium Myxococcus xanthus also uses the ParABS system for chromosome segregation. Its large prokaryotic genome of 9.1 Mb contains 22 parS sequences near the origin of replication, and it is shown here that M. xanthus ParB binds preferentially to a consensus parS sequence in vitro. ParB and ParA are essential for cell viability in M. xanthus as in Caulobacter crescentus, but unlike in many other bacteria. Absence of ParB results in anucleate cells, chromosome segregation defects and loss of viability. Analysis of ParA subcellular localization shows that it clusters at the poles in all cells, and in some, in the DNA-free cell division plane between two chromosomal DNA masses. This ParA localization pattern depends on ParB but not on FtsZ. ParB inhibits the nonspecific interaction of ParA with DNA, and ParA colocalizes with chromosomal DNA only when ParB is depleted. The subcellular localization of ParB suggests a single ParB-parS complex localized at the edge of the nucleoid, next to a polar ParA cluster, with a second ParB-parS complex migrating after the replication of parS takes place to the opposite nucleoid edge, next to the other polar ParA cluster.
Par-baked Bread Technology: Formulation and Process Studies to Improve Quality.
Almeida, Eveline Lopes; Steel, Caroline Joy; Chang, Yoon Kil
2016-01-01
Extending the shelf-life of bakery products has been an important requirement resulting from the mechanization of this industry and the need to increase the distance for the distribution of final products, caused by the increase in production and consumer demand. Technologies based on the interruption of the breadmaking process represent an alternative to overcome product staling and microbiological deterioration. The production of par-baked breads is one of these technologies. It consists of baking the bread in two stages, and due to the possibility of retarding the second stage, it can be said that the bread can always be offered fresh to the consumer. The technology inserts logistics as part of the production process and creates the "hot point" concept, these being the locations where the bread is finalized, such as in the consumers' homes or sales locations. In this work, a review of the papers published on this subject was carried out, and aspects related to both the formulation and the process were considered. This technology still faces a few challenges, such as solving bread quality problems that appear due to process modifications, and these will also be considered. The market for these breads has grown rapidly and the bakery industry searches innovations related to par-baked bread technology.
Aspara, Jaakko; Klein, Jan F; Luo, Xueming; Tikkanen, Henrikki
2018-05-01
We conduct a systematic exploratory investigation of the effects of firms' existing service productivity on the success of their new service innovations. Although previous research extensively addresses service productivity and service innovation, this is the first empirical study that bridges the gap between these two research streams and examines the links between the two concepts. Based on a comprehensive data set of new service introductions in a financial services market over a 14-year period, we empirically explore the relationship between a firm's existing service productivity and the firm's success in introducing new services to the market. The results unveil a fundamental service productivity-service innovation dilemma: Being productive in existing services increases a firm's willingness to innovate new services proactively but decreases the firm's capabilities of bringing these services to the market successfully. We provide specific insights into the mechanism underlying the complex relationship between a firm's productivity in existing services, its innovation proactivity, and its service innovation success. For managers, we not only unpack and elucidate this dilemma but also demonstrate that a focused customer scope and growth market conditions may enable firms to mitigate the dilemma and successfully pursue service productivity and service innovation simultaneously.
46 CFR 502.411 - Mediation and other alternative means of dispute resolution.
2010-10-01
... 46 Shipping 9 2010-10-01 2010-10-01 false Mediation and other alternative means of dispute... PROVISIONS RULES OF PRACTICE AND PROCEDURE Alternative Dispute Resolution § 502.411 Mediation and other alternative means of dispute resolution. (a) Parties are encouraged to utilize mediation or other forms of...
Lambooij, M.S.; Hummel, J. Marjan
2012-01-01
Objectives The main hypothesis in this study is that stakeholders have different preferences concerning IT innovations in hospitals, and these preferences are caused by perceived cost/benefit ratios. This will translate in disagreement between stakeholders on which innovations to implement first,
Pillet, Flavien; Passot, Fanny Marie; Pasta, Franck; Anton Leberre, Véronique; Bouet, Jean-Yves
2017-01-01
Bacterial centromeres-also called parS, are cis-acting DNA sequences which, together with the proteins ParA and ParB, are involved in the segregation of chromosomes and plasmids. The specific binding of ParB to parS nucleates the assembly of a large ParB/DNA complex from which ParA-the motor protein, segregates the sister replicons. Closely related families of partition systems, called Bsr, were identified on the chromosomes and large plasmids of the multi-chromosomal bacterium Burkholderia cenocepacia and other species from the order Burkholeriales. The centromeres of the Bsr partition families are 16 bp palindromes, displaying similar base compositions, notably a central CG dinucleotide. Despite centromeres bind the cognate ParB with a narrow specificity, weak ParB-parS non cognate interactions were nevertheless detected between few Bsr partition systems of replicons not belonging to the same genome. These observations suggested that Bsr partition systems could have a common ancestry but that evolution mostly erased the possibilities of cross-reactions between them, in particular to prevent replicon incompatibility. To detect novel similarities between Bsr partition systems, we have analyzed the binding of six Bsr parS sequences and a wide collection of modified derivatives, to their cognate ParB. The study was carried out by Surface Plasmon Resonance imaging (SPRi) mulitplex analysis enabling a systematic survey of each nucleotide position within the centromere. We found that in each parS some positions could be changed while maintaining binding to ParB. Each centromere displays its own pattern of changes, but some positions are shared more or less widely. In addition from these changes we could speculate evolutionary links between these centromeres.
Spano, Frank; Donovan, Jeff C.
2015-01-01
Résumé Objectif Présenter aux médecins de famille des renseignements de base pour faire comprendre l’épidémiologie, la pathogenèse, l’histologie et l’approche clinique au diagnostic de la pelade par plaques. Sources des données Une recension a été effectuée dans PubMed pour trouver des articles pertinents concernant la pathogenèse, le diagnostic et le pronostic de la pelade par plaques. Message principal La pelade par plaques est une forme de perte pileuse auto-immune dont la prévalence durant une vie est d’environ 2 %. Des antécédents personnels ou familiaux de troubles auto-immuns concomitants, comme le vitiligo ou une maladie de la thyroïde, peuvent être observés dans un petit sous-groupe de patients. Le diagnostic peut souvent être posé de manière clinique en se fondant sur la perte de cheveux non cicatricielle et circulaire caractéristique, accompagnée de cheveux en « point d’exclamation » en périphérie chez ceux dont le problème en est aux premiers stades. Le diagnostic des cas plus complexes ou des présentations inhabituelles peut être facilité par une biopsie et un examen histologique. Le pronostic varie largement et de mauvais résultats sont associés à une apparition à un âge précoce, une perte importante, la variante ophiasis, des changements aux ongles, des antécédents familiaux ou des troubles auto-immuns concomitants. Conclusion La pelade par plaques est une forme auto-immune de perte de cheveux périodiquement observée en soins primaires. Les médecins de famille sont bien placés pour identifier la pelade par plaques, déterminer la gravité de la maladie et poser le diagnostic différentiel approprié. De plus, ils sont en mesure de renseigner leurs patients à propos de l’évolution clinique de la maladie ainsi que du pronostic général selon le sous-type de patients.
Open innovation: A preliminary model from the Knowledge-based Theory
Directory of Open Access Journals (Sweden)
Rocío González-Sánchez
2011-04-01
Full Text Available Purpose: The open innovation paradigm is an alternative and/or complementary way to knowledge management processes in its various stages, questioning the basic assumptions where some of the technological innovation strategies and processes are based on. The new logic of innovation process exploits knowledge dissemination through new innovation communities, on the one hand, and, considers of strategic value the external access to intangible resources. Thus, this approach supposes an alternative view to the traditional close innovation, focused on the exclusive exploitation of value innovations. This paper aims to contribute to building an integrated model of key factors to success in open innovation processes. It is analyzed for the role that certain key knowledge management decisions have on the results of open innovation projects, to facilitate the change process and provide new capacity or skills to do so. Design/methodology/approach: Through the review of theoretical and empirical literature, we show the main variables related to the functioning of open innovation systems, and establish various propositions about the meaning and intensity of such relationships.Findings: The management of open innovation project improves through three external factors: technical leadership based on experience, the intensive use of ICT, which allows a multilateral communication, and the existence of intermediate agents or facilitators with a strong neutral attitude. The results also depend on internal factors: the link function, the search routines, the establishment of incentive systems to encourage proactivity and organizational culture.Originality/value: In the absence of full proposals to guide effective decision making on both the management of relationships between organizations, as well as factors inherent to each of them, this paper proposes an exploratory model that integrates the key success factors in open innovation processes.
Citirik, Mehmet; Batman, Cosar; Bicer, Tolga; Zilelioglu, Orhan
2009-09-01
To assess the alterations in keratometric astigmatism following the 25-gauge transconjunctival sutureless pars plana vitrectomy versus the conventional pars plana vitrectomy. Sixteen consecutive patients were enrolled into the study. Conventional vitrectomy was applied to eight of the cases and 25-gauge transconjunctival sutureless vitrectomy was performed in eight patients. Keratometry was performed before and after the surgery. In the 25-gauge transconjunctival sutureless pars plana vitrectomy group, statistically significant changes were not observed in the corneal curvature in any post-operative follow-up measurement (p > 0.05); whereas in the conventional pars plana vitrectomy group, statistically significant changes were observed in the first postoperative day (p = 0.01) and first postoperative month (p = 0.03). We noted that these changes returned to baseline in three months (p = 0.26). Both 25-gauge transconjunctival sutureless and conventional pars plana vitrectomy are effective surgical modalities for selected diseases of the posterior segment. Surgical procedures are critical for the visual rehabilitation of the patients. The post-operative corneal astigmatism of the vitrectomised eyes can be accurately determined at least two months post-operatively.
Centromere pairing by a plasmid-encoded type I ParB protein
DEFF Research Database (Denmark)
Ringgaard, Simon; Löwe, Jan; Gerdes, Kenn
2007-01-01
The par2 locus of Escherichia coli plasmid pB171 encodes two trans-acting proteins, ParA and ParB, and two cis-acting sites, parC1 and parC2, to which ParB binds cooperatively. ParA is related to MinD and oscillates in helical structures and thereby positions ParB/parC-carrying plasmids regularly......, hence identifying the N terminus of ParB as a requirement for ParB-mediated centromere pairing. These observations suggest that centromere pairing is an important intermediate step in plasmid partitioning mediated by the common type I loci....
Deligiannaki, A; Ali, M
2011-01-01
The development of science and technology increasing rapidly; in many cases advantageous innovations find obstacles for their establishment and in some others they simply fail. The authors of this paper demonstrate that the reason this may happen, is not depended only form the innovation itself; but the socio cultural aspects plays a fundamental role for the diffusion and the adoption of innovation. A number of studies have dealt with the diffusion and the adoption of innovation but limited r...
Directory of Open Access Journals (Sweden)
Flavien Pillet
Full Text Available Bacterial centromeres-also called parS, are cis-acting DNA sequences which, together with the proteins ParA and ParB, are involved in the segregation of chromosomes and plasmids. The specific binding of ParB to parS nucleates the assembly of a large ParB/DNA complex from which ParA-the motor protein, segregates the sister replicons. Closely related families of partition systems, called Bsr, were identified on the chromosomes and large plasmids of the multi-chromosomal bacterium Burkholderia cenocepacia and other species from the order Burkholeriales. The centromeres of the Bsr partition families are 16 bp palindromes, displaying similar base compositions, notably a central CG dinucleotide. Despite centromeres bind the cognate ParB with a narrow specificity, weak ParB-parS non cognate interactions were nevertheless detected between few Bsr partition systems of replicons not belonging to the same genome. These observations suggested that Bsr partition systems could have a common ancestry but that evolution mostly erased the possibilities of cross-reactions between them, in particular to prevent replicon incompatibility. To detect novel similarities between Bsr partition systems, we have analyzed the binding of six Bsr parS sequences and a wide collection of modified derivatives, to their cognate ParB. The study was carried out by Surface Plasmon Resonance imaging (SPRi mulitplex analysis enabling a systematic survey of each nucleotide position within the centromere. We found that in each parS some positions could be changed while maintaining binding to ParB. Each centromere displays its own pattern of changes, but some positions are shared more or less widely. In addition from these changes we could speculate evolutionary links between these centromeres.
14 CFR 121.411 - Qualifications: Check airmen (airplane) and check airmen (simulator).
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Qualifications: Check airmen (airplane) and... § 121.411 Qualifications: Check airmen (airplane) and check airmen (simulator). (a) For the purposes of this section and § 121.413: (1) A check airman (airplane) is a person who is qualified, and permitted...
Kern, Scott E.
2014-01-01
Innovation is the direct intended product of certain styles in research, but not of others. Fundamental conflicts between descriptive vs inferential statistics, deductive vs inductive hypothesis testing, and exploratory vs pre-planned confirmatory research designs have been played out over decades, with winners and losers and consequences. Longstanding warnings from both academics and research-funding interests have failed to influence effectively the course of these battles. The NIH publicly...
Par Pond Fish, Water, and Sediment Chemistry
International Nuclear Information System (INIS)
Paller, M.H.; Wike, L.D.
1996-06-01
The objectives of this report are to describe the Par Pond fish community and the impact of the drawdown and refill on the community, describe contaminant levels in Par Pond fish, sediments, and water and indicate how contaminant concentrations and distributions were affected by the drawdown and refill, and predict possible effects of future water level fluctuations in Par Pond
Par Pond Fish, Water, and Sediment Chemistry
Energy Technology Data Exchange (ETDEWEB)
Paller, M.H. [Westinghouse Savannah River Company, AIKEN, SC (United States); Wike, L.D.
1996-06-01
The objectives of this report are to describe the Par Pond fish community and the impact of the drawdown and refill on the community, describe contaminant levels in Par Pond fish, sediments, and water and indicate how contaminant concentrations and distributions were affected by the drawdown and refill, and predict possible effects of future water level fluctuations in Par Pond.
The efficacy of the phytochemical resveratrol as a preventive agent against the growth of t(4;11) acute lymphoblastic leukemia (ALL) was evaluated in NOD.CB17-Prkdcscid/J mice engrafted with the human t(4;11) ALL line SEM. SEM cells were injected into the tail vein and engraftment was monitored by ...
Antecedents of CIOs' Innovation Capability in Hospitals: Results of an Empirical Study.
Liebe, Jan-David; Esdar, Moritz; Thye, Johannes; Hübner, Ursula
2017-01-01
CIOs' innovation capability is regarded as a precondition of successful HIT adoption in hospitals. Based on the data of 142 CIOs, this study aimed at identifying antecedents of perceived innovation capability. Eight features describing the status quo of the hospital IT management (e.g. use of IT governance frameworks), four features of the hospital structure (e.g. functional diversification) and four CIO characteristics (e.g. duration of employment) were tested as potential antecedents in an exploratory stepwise regression approach. Perceived innovation capability in its entirety and its three sub-dimensions served as criterion. The results show that CIOs' perceived innovation capability could be explained significantly (R2=0.34) and exclusively by facts that described the degree of formalism and structure of IT management in a hospital, e.g. intensive and formalised strategic communication, the existence of an IT strategy and the use of IT governance frameworks. Breaking down innovation capability into its constituents revealed that "innovative organisational culture" contributed to a large extent (R2=0.26) to the overall result sharing several predictors. In contrast, "intrapreneurial personality" (R2=0.11) and "openness towards users" (R2=0.18) could be predicted less well. These results hint at the relationship between working in a well-structured, formalised and strategy oriented environment and the overall feeling of being capable to promote IT innovation.
Concerning the dynamic instability of actin homolog ParM
International Nuclear Information System (INIS)
Popp, David; Yamamoto, Akihiro; Iwasa, Mitsusada; Narita, Akihiro; Maeda, Kayo; Maeda, Yuichiro
2007-01-01
Using in vitro TIRF- and electron-microscopy, we reinvestigated the dynamics of native ParM, a prokaryotic DNA segregation protein and actin homolog. In contrast to a previous study, which used a cysteine ParM mutant, we find that the polymerization process of wild type ATP-ParM filaments consists of a polymerization phase and a subsequent steady state phase, which is dynamically unstable, like that of microtubules. We find that the apparent bidirectional polymerization of ParM, is not due to the intrinsic nature of this filament, but results from ParM forming randomly oriented bundles in the presence of crowding agents. Our results imply, that in the bacterium, ParM filaments spontaneously form bipolar bundles. Due to their intrinsic dynamic instability, ParM bundles can efficiently 'search' the cytoplasmic lumen for DNA, bind it equally well at the bipolar ends and segregate it approximately symmetrically, by the insertion of ParM subunits at either end
Le Centre d'innovation pour la résilience de l'Afrique de l'Est | IDRC ...
International Development Research Centre (IDRC) Digital Library (Canada)
D'ici 2025, la pauvreté sera essentiellement concentrée dans les pays africains à faible revenu touchés par des conflits et de la violence. ... International Water Resources Association, in close collaboration with IDRC, is holding a webinar titled “Climate change and adaptive water management: Innovative solutions from the ...
DEFF Research Database (Denmark)
Lund, Ida K; Illemann, Martin; Thurison, Tine
2011-01-01
, and a potential diagnostic and predictive impact of the different uPAR forms has been reported. Hence, pericellular proteolysis seems to be a suitable target for anti-cancer therapy and numerous approaches have been pursued. Targeting of this process may be achieved by preventing the binding of uPA to u...... using mouse monoclonal antibodies (mAbs) against mouse uPA or uPAR. These reagents will target uPA and uPAR in both stromal cells and cancer cells, and their therapeutic potential can now be assessed in syngenic mouse cancer models....
20 CFR 411.515 - Can the EN change its elected payment system?
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Can the EN change its elected payment system...-SUFFICIENCY PROGRAM Employment Network Payment Systems § 411.515 Can the EN change its elected payment system? (a) Yes. Any change by an EN in its elected EN payment system will apply to beneficiaries who assign...
Directory of Open Access Journals (Sweden)
Lisa G van den Hengel
Full Text Available AIMS: In collateral development (i.e. arteriogenesis, mononuclear cells are important and exist as a heterogeneous population consisting of pro-inflammatory and anti-inflammatory/repair-associated cells. Protease-activated receptor (PAR1 and PAR2 are G-protein-coupled receptors that are both expressed by mononuclear cells and are involved in pro-inflammatory reactions, while PAR2 also plays a role in repair-associated responses. Here, we investigated the physiological role of PAR1 and PAR2 in arteriogenesis in a murine hind limb ischemia model. METHODS AND RESULTS: PAR1-deficient (PAR1-/-, PAR2-deficient (PAR2-/- and wild-type (WT mice underwent femoral artery ligation. Laser Doppler measurements revealed reduced post-ischemic blood flow recovery in PAR2-/- hind limbs when compared to WT, while PAR1-/- mice were not affected. Upon ischemia, reduced numbers of smooth muscle actin (SMA-positive collaterals and CD31-positive capillaries were found in PAR2-/- mice when compared to WT mice, whereas these parameters in PAR1-/- mice did not differ from WT mice. The pool of circulating repair-associated (Ly6C-low monocytes and the number of repair-associated (CD206-positive macrophages surrounding collaterals in the hind limbs were increased in WT and PAR1-/- mice, but unaffected in PAR2-/- mice. The number of repair-associated macrophages in PAR2-/- hind limbs correlated with CD11b- and CD115-expression on the circulating monocytes in these animals, suggesting that monocyte extravasation and M-CSF-dependent differentiation into repair-associated cells are hampered. CONCLUSION: PAR2, but not PAR1, is involved in arteriogenesis and promotes the repair-associated response in ischemic tissues. Therefore, PAR2 potentially forms a new pro-arteriogenic target in coronary artery disease (CAD patients.
Directory of Open Access Journals (Sweden)
Fernández, J. F.
2002-02-01
Full Text Available The preparation and crystalline features of perovskite solid solution Y(CoxMn1-xO3, x=0.6, 0.7, belonging to the Co-rich region of the pseudobinary system YMnO3-YCoO3 have been studied. Dilatometric essays performed under different atmospheres have been carried out for determining the best conditions to obtain single-phase samples. Influence of the thermal cycle and of the sintering density on the appearance of secondary phases has been also established. Firing under O2 atmosphere favours the formation of the pure perovskite. The cooling rate plays an important role for inhibiting the formation of secondary phases. All the crystalline parameters depend ultimately on the final density of the polycrystalline bodies.Se han estudiado la preparación y las características cristalinas de la solución sólida Y(CoxMn1-xO3, x=0.6, 0.7, con estructura de tipo perovsquita, perteneciente a la región rica en Co del sistema seudobinario YMnO3-YCoO3. Se han llevado a cabo ensayos dilatométricos bajo diferentes atmósferas para determinar las mejores condiciones para obtener cerámicas monofásicas. Se ha establecido igualmente la influencia del ciclo térmico y de la densidad de sinterizado sobre la aparición de fases secundarias. La sinterización en oxígeno favorece la formación de la perovsquita pura. La velocidad de enfriamiento juega un importante papel sobre la inhibición de la formación de fases secundarias. Todos los parámetros cristalinos dependen finalmente de la densidad final de los materiales cerámicos.
Apoplejía pituitaria con parálisis del III par craneal: Reporte de caso
Directory of Open Access Journals (Sweden)
Miguel Pinto Valdivia
2011-10-01
Full Text Available Se describe el caso de un varón de 65 años de edad, sin antecedentes patológicos de importancia, que acudió a emergencia del Hospital Nacional Cayetano Heredia por presentar cefalea intensa y ptosis palpebral izquierda. El examen físico mostró parálisis aislada del III par craneal izquierdo. Los análisis de laboratorio mostraron hiponatremia e hipopituitarismo y la resonancia magnética nuclear un adenoma pituitario con áreas de hemorragia e invasión de los senos cavernosos. El tratamiento incluyó glucocorticoides y descompresión quirúrgica transesfenoidal. La anatomía patológica confirmó el diagnóstico de infarto hemorrágico de un adenoma pituitario. El paciente fue dado de alta con terapia sustitutiva de levotiroxina y prednisona. La ptosis palpebral izquierda se recuperó en forma parcial. La apoplejía pituitaria es un síndrome clínico producido por un proceso expansivo dentro de la silla turca, secundario a hemorragia o infarto de un adenoma pituitario, que se caracteriza por cefalea, déficit visual, oftalmoplejía y alteración del nivel de conciencia. Este proceso expansivo puede comprimir los pares craneales en los senos cavernosos, produciendo diferentes grados de parálisis de los músculos oculomotores. La parálisis aislada del III par craneal es rara.(Rev Med Hered 2011;22:186-189.
Copenhagen uPAR prostate cancer (CuPCa) database
DEFF Research Database (Denmark)
Lippert, Solvej; Berg, Kasper D; Høyer-Hansen, Gunilla
2016-01-01
AIM: Urokinase plasminogen activator receptor (uPAR) plays a central role during cancer invasion by facilitating pericellular proteolysis. We initiated the prospective 'Copenhagen uPAR Prostate Cancer' study to investigate the significance of uPAR levels in prostate cancer (PCa) patients. METHODS...
Recombination in the human Pseudoautosomal region PAR1.
Directory of Open Access Journals (Sweden)
Anjali G Hinch
2014-07-01
Full Text Available The pseudoautosomal region (PAR is a short region of homology between the mammalian X and Y chromosomes, which has undergone rapid evolution. A crossover in the PAR is essential for the proper disjunction of X and Y chromosomes in male meiosis, and PAR deletion results in male sterility. This leads the human PAR with the obligatory crossover, PAR1, to having an exceptionally high male crossover rate, which is 17-fold higher than the genome-wide average. However, the mechanism by which this obligatory crossover occurs remains unknown, as does the fine-scale positioning of crossovers across this region. Recent research in mice has suggested that crossovers in PAR may be mediated independently of the protein PRDM9, which localises virtually all crossovers in the autosomes. To investigate recombination in this region, we construct the most fine-scale genetic map containing directly observed crossovers to date using African-American pedigrees. We leverage recombination rates inferred from the breakdown of linkage disequilibrium in human populations and investigate the signatures of DNA evolution due to recombination. Further, we identify direct PRDM9 binding sites using ChIP-seq in human cells. Using these independent lines of evidence, we show that, in contrast with mouse, PRDM9 does localise peaks of recombination in the human PAR1. We find that recombination is a far more rapid and intense driver of sequence evolution in PAR1 than it is on the autosomes. We also show that PAR1 hotspot activities differ significantly among human populations. Finally, we find evidence that PAR1 hotspot positions have changed between human and chimpanzee, with no evidence of sharing among the hottest hotspots. We anticipate that the genetic maps built and validated in this work will aid research on this vital and fascinating region of the genome.
Knowledge Management Orientation: An Innovative Perspective to Hospital Management.
Ghasemi, Matina; Ghadiri Nejad, Mazyar; Bagzibagli, Kemal
2017-12-01
By considering innovation as a new project in hospitals, all the project management's standard steps should be followed in execution. This study investigated the validation of a new set of measures in terms of providing a procedure for knowledge management-oriented innovation that enriches the hospital management system. The relation between innovation and all the knowledge management areas, as the main constructs of project management, was illustrated by referring to project management standard steps and previous studies. Through consultations and meetings with a committee of professional project managers, a questionnaire was developed to measure ten knowledge management areas in hospital's innovation process. Additionally, a group of experts from hospital managers were invited to comment on the applicability of the questionnaires by considering if the items are measurable in hospitals practically. A close-ended, Likert-type scale items, consisted of ten sections, were developed based on project management body of knowledge thorough Delphi technique. It enables the managers to evaluate hospitals' situation to be aware whether the organization follows the knowledge management standards in innovation process or not. By pilot study, confirmatory factor analysis and exploratory factor analysis were conducted to ensure the validity and reliability of the measurement items. The developed items seem to have a potential to help hospital managers and subsequently delivering new products/services successfully based on the standard procedures in their organization. In all innovation processes, the knowledge management areas and their standard steps help hospital managers by a new tool as questionnaire format.
Plasma suPAR is lowered by smoking cessation
DEFF Research Database (Denmark)
Eugen-Olsen, Jesper; Ladelund, Steen; Sørensen, Lars Tue
2016-01-01
BACKGROUND: Soluble urokinase plasminogen activator receptor (suPAR) is a stable inflammatory biomarker. In patients, suPAR is a marker of disease presence, severity and prognosis. In the general population, suPAR is predictive of disease development, such as diabetes and cardiovascular disease a...
Structure of the semi-decoupled π 1/2[411] band in odd proton nucleus 169Ta
International Nuclear Information System (INIS)
Song Hai; Deng Fuguo; Shao Liqin; Zhou Hongyu; Sun Huibin; Lu Jingbin; Zhao Guangyi; Yin Lichang; Liu Yunzuo
2003-01-01
High spin states of the odd proton-nucleus 169 Ta have been populated in the reaction 155 Gd( 19 F, 5 n) with beam energies of 97 MeV. Rotational band based on d 3/2 proton 1/2[411] Nilsson state has been pushed up to 39/2 + in the α=1/2 decay sequence. Its signature partner, the α=-1/2 decay sequence with four link transitions has been established and 1/2[411] band in 169 Ta was reassigned to be a semi-decoupled band. The systematics of the signature splitting in the K=1/2 bands in the rear-earth region and the accidental degeneracy conclusion given by the angular projection shell model were discussed
31 CFR 537.411 - Purchase of shares in economic development projects in Burma.
2010-07-01
... SANCTIONS REGULATIONS Interpretations § 537.411 Purchase of shares in economic development projects in Burma... Burma of shares of ownership, including an equity interest, in the economic development of resources... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Purchase of shares in economic...
Linking energy efficiency and innovation practices: Empirical evidence from the foundry sector
International Nuclear Information System (INIS)
Cagno, Enrico; Ramirez-Portilla, Andres; Trianni, Andrea
2015-01-01
The Europe 2020 strategy currently promotes energy efficiency and innovation through disconnected targets focusing on either energy or R&D. Similar policies indicate that in practice, these two concepts are usually perceived as mutually exclusive. Furthermore, evidence in the literature regarding the relationship between R&D and energy efficiency is still highly limited. This exploratory study aims to address this gap by investigating the link between innovation practices and energy efficiency through a multiple case study of 30 foundries in Northern Italy. We analysed the firms' innovativeness, measured by internal R&D and Open Innovation practices (inbound and outbound), and energy efficiency, measured by specific energy consumption, level of adoption of energy-efficient technologies and barriers to energy efficiency. The results seem to show that those foundries complementing internal R&D with inbound practices have a higher level of energy efficiency, a higher level of adoption of available technologies, and a lower perception of barriers to efficiency improvements. This finding suggests that diversifying innovation practices could lead to better performance with respect to all three indicators of energy efficiency analysed. This study contributes to understanding how more innovative firms can be more energy efficient, providing interesting highlights for managers and policymakers. -- Highlights: •The relation between innovation practices and energy efficiency is articulated. •The link between innovation practices and energy efficiency is tested for foundries. •Energy efficiency is measured with three different indicators. •Analyses of the relations between these indicators support the link with innovation. •Concurrent adoption of internal R&D and inbound practices leads to higher efficiency
2010-04-01
... its choice of a payment system for use when functioning as an EN? 411.365 Section 411.365 Employees... agency notify us about its choice of a payment system for use when functioning as an EN? (a) The State VR agency must send us a letter telling us which EN payment system it will use when it functions as an EN...
Audiology, Entrepreneurship and Innovation: A perspective on private practice
Directory of Open Access Journals (Sweden)
Alex Antonites
2013-12-01
Full Text Available Objective: This paper investigates the correlation and contact points between entrepreneurship as a discipline and the profession of audiology. The research focuses on specific areas of entrepreneurship (e.g. innovation as an entrepreneurial skill and the impact it has on audiology private practices as key role players in the biotechnology industry. Design: This study used a two-stage research design comprising of an exploratory study and a formal study to survey the entrepreneurial and business skills of audiologists as entrepreneurs in private practice. Findings: The findings describe severe deficiencies - specifically the business and entrepreneurial skill sets of the professional audiologist as an entrepreneur. The mind-set of the audiologist is not that of an entrepreneur, but rather of a small business owner. A lack of self-confidence to be creative, take risks, and identify new opportunities or innovate in terms of products, process and services was found. Audiologists are not necessarily concerned about the creation of employment, or the growth and profitability of their practices. Autonomy and security are the primary objectives of most practice owners. Keywords: Innovation, Entrepreneurs, Women Entrepreneurs, Entrepreneurship, Audiology, Biotechnology
Foreign board members and firm innovativeness: An exploratory analysis for setting a research agenda
DEFF Research Database (Denmark)
Makkonen, Teemu; Williams, Allan; Habersetzer, Antoine
2018-01-01
Purpose This paper aims to assess the often repeated, but empirically unconfirmed, supposition that there is a positive connection between foreign board members (FBMs) and firm innovativeness and to set a research agenda for future studies on the topic. Design/methodology/approach The analyses ar...
The inflammatory marker suPAR after cardiac arrest
DEFF Research Database (Denmark)
Rundgren, Malin; Lyngbaek, Stig; Fisker, Helle
2015-01-01
. This pilot study aimed at investigating suPAR levels in relation to outcome after CA and mild induced hypothermia. METHODS: suPAR levels were measured at 6, 36, and 72 hours in patients treated with hypothermia after CA. suPAR levels were analyzed in relation to survival after 6 months. Receiver operating...
Directory of Open Access Journals (Sweden)
Cabral Soares F
2014-12-01
Full Text Available Fernanda Cabral Soares,1 Thaís Cristina Galdino de Oliveira,1 Liliane Dias e Dias de Macedo,1 Alessandra Mendonça Tomás,1 Domingos Luiz Wanderley Picanço-Diniz,2 João Bento-Torres,1,3 Natáli Valim Oliver Bento-Torres,1,3 Cristovam Wanderley Picanço-Diniz1 1Universidade Federal do Pará, Instituto de Ciências Biológicas, Hospital Universitário João de Barros Barreto, Laboratório de Investigações em Neurodegeneração e Infecção Belém, Pará, Brazil; 2Universidade Federal do Oeste do Pará, Núcleo Universitário de Oriximiná, Oriximiná, Pará, Brazil; 3Faculdade de Fisioterapia e Terapia Ocupacional, Universidade Federal do Pará, Belém, Pará, BrazilObjective: The recognition of the limits between normal and pathological aging is essential to start preventive actions. The aim of this paper is to compare the Cambridge Neuropsychological Test Automated Battery (CANTAB and language tests to distinguish subtle differences in cognitive performances in two different age groups, namely young adults and elderly cognitively normal subjects.Method: We selected 29 young adults (29.9±1.06 years and 31 older adults (74.1±1.15 years matched by educational level (years of schooling. All subjects underwent a general assessment and a battery of neuropsychological tests, including the Mini Mental State Examination, visuospatial learning, and memory tasks from CANTAB and language tests. Cluster and discriminant analysis were applied to all neuropsychological test results to distinguish possible subgroups inside each age group.Results: Significant differences in the performance of aged and young adults were detected in both language and visuospatial memory tests. Intragroup cluster and discriminant analysis revealed that CANTAB, as compared to language tests, was able to detect subtle but significant differences between the subjects.Conclusion: Based on these findings, we concluded that, as compared to language tests, large-scale application
How the question of innovation is addressed by the social sciences
Directory of Open Access Journals (Sweden)
Jean Corneloup
2009-07-01
Full Text Available Although innovation has today become a topical notion, given its fundamental importance in understanding the economy and the way our society adapts to its development goals, its characteristics and principles nevertheless need to be defined. While the 20th century was marked by important technological, political, economic and cultural changes, the current era seems to be increasingly bent on imposing innovation as a motor for the development of society. It is therefore important to understand how the question of innovation is currently being addressed, and in turn this involves looking at the different ways in which the innovative process is interpreted. Between the notional approach, which often remains vague and somewhat basic, and the theoretical approaches that attempt to present different perspectives for ways of understanding the innovation process, the path of knowledge is very often compartmentalized by the different scientific disciplines. In this paper, we will attempt to show the tensions and combinations that exist between the different approaches adopted by the management sciences, sociology, economics and geography in attempting to understand the innovative process. To do so, we will focus our study on the firm and the territory (as the spatial dimension of innovation, elements that have already been the subject of numerous studies to understand the forces participating in the production of novelty.Si l’innovation est devenue aujourd’hui une notion d’actualité tant elle apparaît comme fondamentale pour penser l’économie et l’adaptation de notre société à son projet de développement, reste à en définir les caractéristiques et les principes. Si le XX° siècle a été marqué par des changements importants sur un plan technologique, politique, économique ou encore culturel, l’époque actuelle semble redoubler d’efforts pour imposer l’innovation comme moteur du développement de la société. Reste alors
International Nuclear Information System (INIS)
Soliman, H.N.
2011-01-01
Highlights: → The corrosion of commercial Al alloy is higher than that of Al-HO411 alloy. → The inhibition efficiency increases with the increasing of 8-hydroxyquinoline (8HQ) concentration. → The inhibition efficiencies of Al-HO411 samples are higher than those of commercial Al. → The 8HQ is promising candidate to be added to the coating systems as active anti-corrosive component for corrosion protection of both alloys. - Abstract: The effect of 8-hydroxyquinoline (8HQ) on the corrosion inhibition of commercial Al and Al-HO411 alloys has been investigated in NaOH solutions. Results showed that the inhibition efficiency was increased with increasing concentration of 8HQ. Al-HO411 alloy exhibited higher corrosion resistance and inhibition efficiency than the commercial Al. Examination of both samples was studied by means of optical microscope as well as energy-dispersive X-ray spectrometer. The crystallographic structure of both samples was analyzed by means of X-ray diffractometry. It was observed that protective films are formed on the surfaces that play an essential role in the corrosion inhibition of the alloys under investigation.
2005-01-01
For a few years, the CERN Library has been receiving books from the University of Hanover sent via Avignon, at least that's what it says on the envelope. Such a detour would mean that parcels were travelling 720 km more than the distance separating Geneva and Hanover, which would be a very strange state of affairs. The explanation lies in a spelling mistake. The sender has been stamping parcels with a stamp that says "Par Avignon prioritaire" (first-class via Avignon) instead of "Par Avion prioritaire" (First Class Air Mail), a source of much amusement to the librarians!
Considering Materials Management in Construction: An Exploratory Study
Directory of Open Access Journals (Sweden)
Zakaria Dakhli
2018-03-01
Full Text Available While materials count for a considerable amount of construction costs, the way materials are managed seems to be improvised rather than approached methodically. This study investigates the practice of novel techniques used to manage materials in the construction industry. Techniques that have already proven themselves to be efficient ways to manage the production pace within the industry include the pull system, Just-In-Time, Kitting and off-site fabrication. These are explained and assessed in the context of the French construction industry through an exploratory study, supported by a questionnaire completed by contractors. The results reveal that a clear plan to manage materials on-site is lacking among the respondents, creating common inventory problems. This research provides evidence to support the central role played by an efficient management of material flow on-site. It also highlights the obstacles that hinder the adoption of innovative techniques, such as sub-contractor coordination.
CONFLICTS AND OPERATIONAL HURDLES IN THE MANAGEMENT OF INNOVATIVE PROJECTS: AN EMPIRICAL STUDY
Directory of Open Access Journals (Sweden)
José Varela Donato
2013-12-01
Full Text Available This article aims at describing how conflicts and operational hurdles manifest themselves in the management of innovative projects in a development bank (DB. The research characterizes itself as a qualitative and exploratory approach; the data collection consisted of interviews with consultants and project managers and by documents on management projects in Development Bank; the interviews have undergone the content analysis by utilizing the Atlas.ti. The research revealed that the project management in its new implemented model faces difficulties similar to those observed in traditional hierarchies. It was observed that conflicts regarding interests, values, psychological aspects and operational hurdles are intrinsic to the life cycle of innovative projects, which implementation requires a lot of political capacity from their leaders to be effective.
Serum suPAR in patients with FSGS: trash or treasure?
Maas, Rutger J H; Deegens, Jeroen K J; Wetzels, Jack F M
2013-07-01
The urokinase-type plasminogen activator receptor (uPAR) has important functions in cell migration. uPAR can be shed from the cell membrane resulting in soluble uPAR (suPAR). Further cleavage gives rise to shorter fragments with largely unknown functions. Recent studies have demonstrated that both overexpression of uPAR on podocytes and the administration of suPAR cause proteinuria in mice. The common pathogenic mechanism involves the activation of podocyte β3-integrin. Increased activation of β3-integrin is also observed in patients with focal and segmental glomerulosclerosis (FSGS). These observations form the basis for the hypothesis that suPAR may be the circulating factor causing FSGS. A recent study fosters this idea by demonstrating increased suPAR levels in the serum of patients with FSGS and reporting an association with recurrence after transplantation and response to plasmapheresis. However, this study was heavily biased, and subsequent studies have given conflicting results. Although the experimental work is very suggestive, at present there is no proof that any known human suPAR fragment causes FSGS in humans. We therefore suggest that the measurement of suPAR using currently available assays has absolutely no value at the present time in decision-making in routine clinical practice.
Proteinase-Activated Receptor 1 (PAR1 regulates leukemic stem cell functions.
Directory of Open Access Journals (Sweden)
Nicole Bäumer
Full Text Available External signals that are mediated by specific receptors determine stem cell fate. The thrombin receptor PAR1 plays an important role in haemostasis, thrombosis and vascular biology, but also in tumor biology and angiogenesis. Its expression and function in hematopoietic stem cells is largely unknown. Here, we analyzed expression and function of PAR1 in primary hematopoietic cells and their leukemic counterparts. AML patients' blast cells expressed much lower levels of PAR1 mRNA and protein than CD34+ progenitor cells. Constitutive Par1-deficiency in adult mice did not affect engraftment or stem cell potential of hematopoietic cells. To model an AML with Par1-deficiency, we retrovirally introduced the oncogene MLL-AF9 in wild type and Par1-/- hematopoietic progenitor cells. Par1-deficiency did not alter initial leukemia development. However, the loss of Par1 enhanced leukemic stem cell function in vitro and in vivo. Re-expression of PAR1 in Par1-/- leukemic stem cells delayed leukemogenesis in vivo. These data indicate that Par1 contributes to leukemic stem cell maintenance.
Proteinase-Activated Receptor 1 (PAR1) regulates leukemic stem cell functions.
Bäumer, Nicole; Krause, Annika; Köhler, Gabriele; Lettermann, Stephanie; Evers, Georg; Hascher, Antje; Bäumer, Sebastian; Berdel, Wolfgang E; Müller-Tidow, Carsten; Tickenbrock, Lara
2014-01-01
External signals that are mediated by specific receptors determine stem cell fate. The thrombin receptor PAR1 plays an important role in haemostasis, thrombosis and vascular biology, but also in tumor biology and angiogenesis. Its expression and function in hematopoietic stem cells is largely unknown. Here, we analyzed expression and function of PAR1 in primary hematopoietic cells and their leukemic counterparts. AML patients' blast cells expressed much lower levels of PAR1 mRNA and protein than CD34+ progenitor cells. Constitutive Par1-deficiency in adult mice did not affect engraftment or stem cell potential of hematopoietic cells. To model an AML with Par1-deficiency, we retrovirally introduced the oncogene MLL-AF9 in wild type and Par1-/- hematopoietic progenitor cells. Par1-deficiency did not alter initial leukemia development. However, the loss of Par1 enhanced leukemic stem cell function in vitro and in vivo. Re-expression of PAR1 in Par1-/- leukemic stem cells delayed leukemogenesis in vivo. These data indicate that Par1 contributes to leukemic stem cell maintenance.
Serum suPAR in patients with FSGS: trash or treasure?
Maas, R.J.H.; Deegens, J.K.J.; Wetzels, J.F.M.
2013-01-01
The urokinase-type plasminogen activator receptor (uPAR) has important functions in cell migration. uPAR can be shed from the cell membrane resulting in soluble uPAR (suPAR). Further cleavage gives rise to shorter fragments with largely unknown functions. Recent studies have demonstrated that both
Accouchement par forceps: indications et pronostic materno-foetal ...
African Journals Online (AJOL)
L'accouchement par voie basse, peut être parfois compromis par des facteurs maternels, foetaux ou materno-foetaux nécessitant des moyens thérapeutiques comme le forceps pour achever l'accouchement par voie naturelle. Le forceps, une méthode qui n'est pas sans risque pour la mère et le nouveau-né. Nous avons ...
42 CFR 411.53 - Basis for conditional Medicare payment in no-fault cases.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Basis for conditional Medicare payment in no-fault... Limitations on Medicare Payment for Services Covered Under Liability or No-Fault Insurance § 411.53 Basis for conditional Medicare payment in no-fault cases. (a) A conditional Medicare payment may be made in no-fault...
Entrepreneurs’ Exploratory Perseverance in Learning Settings
Muehlfeld, K.S.; Urbig, Diemo; Weitzel, Utz
We introduce “exploratory perseverance” as a novel construct that captures perseverant behavior in settings in which several alternatives can be explored and evaluated. We suggest that entrepreneurs display exploratory perseverance reflected by a tendency to keep exploring broader sets of
18 CFR 367.4114 - Account 411.4, Investment tax credit adjustments, service company property.
2010-04-01
..., Investment tax credit adjustments, service company property. 367.4114 Section 367.4114 Conservation of Power... Operating Income § 367.4114 Account 411.4, Investment tax credit adjustments, service company property. This account must include the amount of those investment tax credit adjustments that relate to service company...
PERCEPTION AND COMMUNICATION OF INNOVATION IN RETAIL TRADE (CASE STUDY APPLIED TO BRICOLAGE PRODUCTS
Directory of Open Access Journals (Sweden)
Pop Nicolae Al.
2012-07-01
Full Text Available Starting from the specific features of bricolage retail trade (which is part of the ‘Do It Yourself’ – DYI commercial format, this study aims to clarify the concept and structure of innovation in this field, and to present how innovation is perceived and communicated by sellers to customers. The initial literature review is followed by the design of a three-stage research, which consists of a variety of methods, techniques and tools of selective market research. The objectives are to establish the main forms of innovation in DIY trade, the perception and communication of innovation to the customer, and the internal marketing techniques which could deliver higher marketing advantages to the seller. This paper covers only the results of a pilot research conducted via qualitative exploratory research among 13 managers of the bricolage stores in Bucharest. Five hypotheses were tested and confirmed through research. All premises are ready for the scientific construction of research tools for the second and third stages of the study.
Energy Technology Data Exchange (ETDEWEB)
Matthews, Patrick K. [Navarro-Intera, LLC (N-I), Las Vegas, NV (United States)
2015-03-01
This Streamlined Approach for Environmental Restoration (SAFER) Plan addresses the actions needed to achieve closure for Corrective Action Unit (CAU) 411, Double Tracks Plutonium Dispersion (Nellis). CAU 411 is located on the Nevada Test and Training Range and consists of a single corrective action site (CAS), NAFR-23-01, Pu Contaminated Soil. There is sufficient information and historical documentation from previous investigations and the 1996 interim corrective action to recommend closure of CAU 411 using the SAFER process. Based on existing data, the presumed corrective action for CAU 411 is clean closure. However, additional data will be obtained during a field investigation to document and verify the adequacy of existing information, and to determine whether the CAU 411 closure objectives have been achieved. This SAFER Plan provides the methodology to gather the necessary information for closing the CAU. The results of the field investigation will be presented in a closure report that will be prepared and submitted to the Nevada Division of Environmental Protection (NDEP) for review and approval. The site will be investigated based on the data quality objectives (DQOs) developed on November 20, 2014, by representatives of NDEP, the U.S. Air Force (USAF), and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Field Office. The DQO process was used to identify and define the type, amount, and quality of data needed to determine whether CAU 411 closure objectives have been achieved. The following text summarizes the SAFER activities that will support the closure of CAU 411; Collect environmental samples from designated target populations to confirm or disprove the presence of contaminants of concern (COCs) as necessary to supplement existing information; If COCs are no longer present, establish clean closure as the corrective action; If COCs are present, the extent of contamination will be defined and further corrective actions
18 CFR 367.4111 - Account 411.1, Provision for deferred income taxes-Credit, operating income.
2010-04-01
..., Provision for deferred income taxes-Credit, operating income. 367.4111 Section 367.4111 Conservation of... Company Operating Income § 367.4111 Account 411.1, Provision for deferred income taxes—Credit, operating... taxes, credit, that relate to service company operating income. ...
Jippes, Erik; Steinert, Yvonne; Pols, Jan; Achterkamp, Marjolein C; van Engelen, Jo M L; Brand, Paul L P
2013-03-01
To examine the impact of social networks and a two-day faculty development course on clinical supervisors' adoption of an educational innovation. During 2007-2010, 571 residents and 613 clinical supervisors in four specialties in the Netherlands were invited to complete a Web-based questionnaire. Residents rated their clinical supervisors' adoption of an educational innovation, the use of structured and constructive (S&C) feedback. Clinical supervisors self-assessed their adoption of this innovation and rated their communication intensity with other clinical supervisors in their department. For each supervisor, a centrality score was calculated, representing the extent to which the supervisor was connected to departmental colleagues. The authors analyzed the effects of supervisor centrality and participation in a two-day Teach-the-Teacher course on the degree of innovation adoption using hierarchical linear modeling, adjusting for age, gender, and attitude toward the S&C feedback innovation. Respondents included 370 (60%) supervisors and 357 (63%) residents. Although Teach-the-Teacher course participation (n=172; 46.5%) was significantly related to supervisors' self-assessments of adoption (P=.001), it had no effect on residents' assessments of supervisors' adoption (P=.371). Supervisor centrality was significantly related to innovation adoption in both residents' assessments (P=.023) and supervisors' self-assessments (P=.024). A clinical supervisor's social network may be as important as faculty development course participation in determining whether the supervisor adopts an educational innovation. Faculty development initiatives should use faculty members' social networks to improve the adoption of educational innovations and help build and maintain communities of practice.
40 CFR 721.10103 - Naphtha (Fischer-Tropsch), C4-11-alkane, branched and linear.
2010-07-01
...-alkane, branched and linear. 721.10103 Section 721.10103 Protection of Environment ENVIRONMENTAL..., branched and linear. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as naphtha (fischer-tropsch), C4-11-alkane, branched and linear (PMN P-04-235; CAS No...
Trenching as an exploratory method
International Nuclear Information System (INIS)
Hatheway, A.W.; Leighton, F.B.
1979-01-01
The critical nature of siting nuclear power plants has led to increased emphasis on exploratory trenching. Trenching is the most definitive of all subsurface exploratory methods; it permits inspection of a continuous geologic section by both geologists and regulatory authorities and makes possible the preparation of a graphic log that delineates both obvious and subtle geologic features. About one of every two nuclear plant licensing efforts utilizes exploratory trenching. Many geologic hazards, such as ''capable'' faults, can be detected from trench exposures; they may otherwise remain undetected. Trenches must be judiciously located, survey-controlled, excavated safely and adequately shored, logged in detail, and properly diagnosed. Useful techniques of trench logging include thorough cleaning of the trench walls, teamwork between geologist and recorder, logging against a carefully surveyed baseline and vertical reference grid, and panoramic photography.Soils, including paleosols, and glacial and glaciofluvial deposits present some of the most difficult media to log. Trench logs must be thoroughly interpreted and correlated so that they document the geologic conditions governing suitability of the site. Age-determination techniques utilized in exploratory trenching include petrographic analyses, quartz inclusion studies, clay mineralogic analyses, and radiometric methods
Innovation based on value co-creation: An alternative for Brazilian wine?
Directory of Open Access Journals (Sweden)
Borges Martiele Cortes
2016-01-01
Full Text Available The Brazilian wine industry has been facing obstacles such as competition and high tax rates. Innovation is an alternative towards this scenario being it a major factor for any company's survival and growth in the market. Besides this, technological advances and access to information provide consumers with a larger number of choices and knowledge for an informed decision making. Despite differentiation efforts consumers did not obtain satisfaction. Customer interaction provides another way to generate innovation from its involvement in the production process (co-creation of value. The research was held in an awarded winery located in Bento Gonçalves (Brazil with the objective of understanding how the process of value co-creation between Brazilian award-winning wineries and consumers influences innovation generation. It is an exploratory and qualitative study collected through in-depth interviews with a semi-structured script. The winery identifies beneficial effects in the production process resulting from interactions because it narrows the bond with the consumer creating a better understanding of the consumers as well as develop a more tailored offer regarding value. The innovations generated based on co-creation can be taken as an alternative to imposed barriers in the current Brazilian wine sector.
Protease-Activated Receptor 4 (PAR4): A Promising Target for Antiplatelet Therapy.
Rwibasira Rudinga, Gamariel; Khan, Ghulam Jilany; Kong, Yi
2018-02-14
Cardiovascular diseases (CVDs) are currently among the leading causes of death worldwide. Platelet aggregation is a key cellular component of arterial thrombi and major cause of CVDs. Protease-activated receptors (PARs), including PAR1, PAR2, PAR3 and PAR4, fall within a subfamily of seven-transmembrane G-protein-coupled receptors (GPCR). Human platelets express PAR1 and PAR4, which contribute to the signaling transduction processes. In association with CVDs, PAR4 not only contributes to platelet activation but also is a modulator of cellular responses that serve as hallmarks of inflammation. Although several antiplatelet drugs are available on the market, they have many side effects that limit their use. Emerging evidence shows that PAR4 targeting is a safer strategy for preventing thrombosis and consequently may improve the overall cardiac safety profile. Our present review summarizes the PAR4 structural characteristics, activation mechanism, role in the pathophysiology of diseases and understanding the association of PAR4 targeting for improved cardiac protection. Conclusively, this review highlights the importance of PAR4 antagonists and its potential utility in different CVDs.
Innovation pour la santé des mères et des enfants d'Afrique | CRDI ...
International Development Research Centre (IDRC) Digital Library (Canada)
L'initiative Innovation pour la santé des mères et des enfants d'Afrique (ISMEA) cherche à améliorer la santé des mères, des nouveau-nés et des enfants en ... Cette initiative de 36 millions de dollars sur sept ans – financée conjointement par les Instituts de recherche en santé du Canada, Affaires mondiales Canada et le ...
Duan, Shaowei; Wang, Jianjun; Gao, Chenhao; Jin, Changyu; Li, Dong; Peng, Danshuai; Du, Guomei; Li, Yiqian; Chen, Mingxun
2018-03-01
Previous studies have shown that a plant WRKY transcription factor, WRKY41, has multiple functions, and regulates seed dormancy, hormone signaling pathways, and both biotic and abiotic stress responses. However, it is not known about the roles of AtWRKY41 from the model plant, Arabidopsis thaliana, and its ortholog, BnWRKY41, from the closely related and important oil-producing crop, Brassica napus, in the regulation of anthocyanin biosynthesis. Here, we found that the wrky41 mutation in A. thaliana resulted in a significant increase in anthocyanin levels in rosette leaves, indicating that AtWRKY41 acts as repressor of anthocyanin biosynthesis. RNA sequencing and quantitative real-time PCR analysis revealed increased expression of three regulatory genes AtMYB75, AtMYB111, and AtMYBD, and two structural genes, AT1G68440 and AtGSTF12, all of which contribute to anthocyanin biosynthesis, in the sixth rosette leaves of wrky41-2 plants at 20 days after germination. We cloned the full length complementary DNA of BnWRKY41-1 from the C2 subgenome of the B. napus genotype Westar and observed that, when overexpressed in tobacco leaves as a fusion protein with green fluorescent protein, BnWRKY41-1 is localized to the nucleus. We further showed that overexpression of BnWRKY41-1 in the A. thaliana wrky41-2 mutant rescued the higher anthocyanin content phenotype in rosette leaves of the mutant. Moreover, the elevated expression levels in wrky41-2 rosette leaves of several important regulatory and structural genes regulating anthocyanin biosynthesis were not observed in the BnWRKY41-1 overexpressing lines. These results reveal that BnWRKY41-1 has a similar role with AtWRKY41 in regulating anthocyanin biosynthesis when overexpressed in A. thaliana. This gene represents a promising target for genetically manipulating B. napus to increase the amounts of anthocyanins in rosette leaves. Copyright © 2017 Elsevier B.V. All rights reserved.
Innovative culture in long-term care settings: the influence of organizational characteristics.
Nieboer, Anna P; Strating, Mathilde M H
2012-01-01
Innovative cultures have been reported to enhance the creation and implementation of new ideas and working methods in organizations. Although there is considerable research on the impact of organizational context on the innovativeness of organizations, the same is not the case for research on the organizational characteristics responsible for an innovative culture in (long-term) care settings. The aim of this study was to identify organizational characteristics that explain innovative culture in the (long-term) care sector. A large cross-sectional study in Dutch long-term care-nursing homes and/or elderly homes, care organizations for the handicapped, and long-term mental health care organizations-was conducted. A total of 432 managers and care professionals in 37 organizations participated. The Group Innovation Inventory was used to measure innovative culture in long-term care organizations. Structural characteristics of the organization were centralization and formalization, environmental dynamism and competitiveness, internal and external exchange of information, leadership style, commitment to quality improvement, and the organization's innovative strategy. The determinants of an innovative culture were estimated with a two-level random-intercepts and fixed-slopes model. Multilevel regression models were used to account for the organizational clustering of individuals within the 37 care organizations. Environmental dynamism, job codification, formal external exchange of information, transformational leadership, commitment to quality, and an exploratory and exploitative innovation strategy were all significantly correlated with an innovative culture in the multivariate multilevel analysis; the other characteristics were not. The explained organizational- and individual-level variance was 52.5% and 49.2%, respectively. The results point to substantial differences in innovative cultures between and within care organizations that can, in part, be explained by
Mr Gary Nairn MP, Chair of the Standing Committee on Science and Innovation, Australia
Maximilien Brice
2003-01-01
Photos 01,04,06,07: Mr Gary Nairn MP, Chair of the Standing Committee on Science and Innovation, Australia,visiting the silicon test laboratory, April 2003. Photos 02,03: From left to right: Mr Gary Nairn MP, Chair of the Standing Committee on Science and Innovation, Australia,visiting the silicon test laboratory with Prof. Steinar Stapnes, Physicist in the ATLAS experiment, April 2003. Photos 02,09: Mrs Kerrye Nairn, Australia,visiting the silicon test laboratory, April 2003
PAR1 activation affects the neurotrophic properties of Schwann cells.
Pompili, Elena; Fabrizi, Cinzia; Somma, Francesca; Correani, Virginia; Maras, Bruno; Schininà, Maria Eugenia; Ciraci, Viviana; Artico, Marco; Fornai, Francesco; Fumagalli, Lorenzo
2017-03-01
Protease-activated receptor-1 (PAR1) is the prototypic member of a family of four G-protein-coupled receptors that signal in response to extracellular proteases. In the peripheral nervous system, the expression and/or the role of PARs are still poorly investigated. High PAR1 mRNA expression was found in the rat dorsal root ganglia and the signal intensity of PAR1 mRNA increased in response to sciatic nerve transection. In the sciatic nerve, functional PAR1 receptor was reported at the level of non-compacted Schwann cell myelin microvilli of the nodes of Ranvier. Schwann cells are the principal population of glial cells of the peripheral nervous system which myelinate axons playing an important role during axonal regeneration and remyelination. The present study was undertaken in order to determine if the activation of PAR1 affects the neurotrophic properties of Schwann cells. Our results suggest that the stimulation of PAR1 could potentiate the Schwann cell ability to favour nerve regeneration. In fact, the conditioned medium obtained from Schwann cell cultures challenged with a specific PAR1 activating peptide (PAR1 AP) displays increased neuroprotective and neurotrophic properties with respect to the culture medium from untreated Schwann cells. The proteomic analysis of secreted proteins in untreated and PAR1 AP-treated Schwann cells allowed the identification of factors differentially expressed in the two samples. Some of them (such as macrophage migration inhibitory factor, matrix metalloproteinase-2, decorin, syndecan 4, complement C1r subcomponent, angiogenic factor with G patch and FHA domains 1) appear to be transcriptionally regulated after PAR1 AP treatment as shown by RT-PCR. Copyright © 2017 Elsevier Inc. All rights reserved.
Protease-Activated Receptor 4 (PAR4: A Promising Target for Antiplatelet Therapy
Directory of Open Access Journals (Sweden)
Gamariel Rwibasira Rudinga
2018-02-01
Full Text Available Cardiovascular diseases (CVDs are currently among the leading causes of death worldwide. Platelet aggregation is a key cellular component of arterial thrombi and major cause of CVDs. Protease-activated receptors (PARs, including PAR1, PAR2, PAR3 and PAR4, fall within a subfamily of seven-transmembrane G-protein-coupled receptors (GPCR. Human platelets express PAR1 and PAR4, which contribute to the signaling transduction processes. In association with CVDs, PAR4 not only contributes to platelet activation but also is a modulator of cellular responses that serve as hallmarks of inflammation. Although several antiplatelet drugs are available on the market, they have many side effects that limit their use. Emerging evidence shows that PAR4 targeting is a safer strategy for preventing thrombosis and consequently may improve the overall cardiac safety profile. Our present review summarizes the PAR4 structural characteristics, activation mechanism, role in the pathophysiology of diseases and understanding the association of PAR4 targeting for improved cardiac protection. Conclusively, this review highlights the importance of PAR4 antagonists and its potential utility in different CVDs.
Update of the exploratory report Acrolein
Slooff W; Bont PFH; Janus JA; Pronk MEJ; Ros JPM; ECO; PPCbv; ACT; LAE
1994-01-01
The report is an update of the exploratory report acrolein (Slooff et al., 1991) that served as a basis for the discussion during the exploratory meeting on acrolein in March 1992. The meeting supported the conclusion that priority should be given to the compartment air and to the risks to humans.
Directory of Open Access Journals (Sweden)
Maria Cecília Sobral
2008-10-01
Full Text Available At affluent markets, the literature on product development management tells us to aggregate value and technology, to differentiate products and to launch fast. And at the low-income markets? This exploratory research defines a popular product, characterizes and measures their markets in Brazil, and identifies innovation strategies for them. The results suggest that the effective strategic orientation differs from affluent markets. It includes: to enhance the auto service component; to identify and service the key functionalities to the targeted public; to standardize products and increase the production scale; to extend the product life cycle; to use convenient distribution and marketing channels; to build product images that have appeal in the popular market; to offer longer financing horizons with befittingly lower installments. Data came from market researches and general demographic census. General media published stories were used to identify companies and their strategies. And a few case studies allowed the authors a deeper exploration of the relevant themes.
Vote par sondage uniforme incorruptible
Blanchard , Nicolas
2016-01-01
International audience; Introduit en 2012 par David Chaum, le vote par sondage uniforme (random-sample voting) est un protocole de vote basé sur un choix d'une sous-population représentative , permettant de limiter les coûts tout en ayant de nombreux avantages, principalement lorsqu'il est couplé a d'autres techniques comme ThreeBallot. Nous analysons un problème de corruptibilité potentielle où les votants peuvent vendre leur vote au plus offrant et proposons une variation du protocole reméd...
Directory of Open Access Journals (Sweden)
Mohd Nizam Ab Rahman
2015-01-01
Full Text Available The business environment is currently characterized by intensified competition at both the national and firm levels. Many studies have shown that innovation positively affect firms in enhancing their competitiveness. Innovation is a dynamic process that requires a continuous, evolving, and mastered management. Evaluating the sustainability of overall innovation capability of a business is a major means of determining how well this firm effectively and efficiently manages its innovation process. A psychometrically valid scale of evaluating the sustainability of overall innovation capability of a firm is still insufficient in the current innovation literature. Thus, this study developed a reliable and valid scale of measuring the sustainability of overall innovation capability construct. The unidimensionality, reliability, and several validity components of the developed scale were tested using the data collected from 175 small and medium-sized enterprises in Iran. A series of systematic statistical analyses were performed. Results of the reliability measures, exploratory and confirmatory factor analyses, and several components of validity tests strongly supported an eight-dimensional (8D scale of measuring the sustainability of overall innovation capability construct. The dimensions of the scale were strategic management, supportive culture and structure, resource allocation, communication and networking, knowledge and technology management, idea management, project development, and commercialization capabilities.
DEFF Research Database (Denmark)
Ebersbach, G; Gerdes, K; Charbon, Gitte Ebersbach
2001-01-01
Prokaryotic plasmids and chromosomes encode partitioning (par) loci that segregate DNA to daughter cells before cell division. Recent database analyses showed that almost all known par loci encode an ATPase and a DNA-binding protein, and one or more cis-acting regions where the proteins act. All...
The role of pars flaccida in human middle ear sound transmission.
Aritomo, H; Goode, R L; Gonzalez, J
1988-04-01
The role of the pars flaccida in middle ear sound transmission was studied with the use of twelve otoscopically normal, fresh, human temporal bones. Peak-to-peak umbo displacement in response to a constant sound pressure level at the tympanic membrane was measured with a noncontacting video measuring system capable of repeatable measurements down to 0.2 micron. Measurements were made before and after pars flaccida modifications at 18 frequencies between 100 and 4000 Hz. Four pars flaccida modifications were studied: (1) acoustic insulation of the pars flaccida to the ear canal with a silicone rubber baffle, (2) stiffening the pars flaccida with cyanoacrylate cement, (3) decreasing the tension of the pars flaccida with a nonperforating incision, and (4) perforation of the pars flaccida. All of the modifications (except the perforation) had a minimal effect on umbo displacement; this seems to imply that the pars flaccida has a minor acoustic role in human beings.
Implications of Reverse Innovation for Socio-Economic Sustainability: A Case Study of Philips China
Directory of Open Access Journals (Sweden)
Juan Shan
2016-06-01
Full Text Available The idea of reverse innovation, local innovation happening in emerging markets for the global market, has gained much academic and managerial attention in recent years. The purpose of this study is to understand how reverse innovation has successfully diffused into the product and market development strategies at Philips Inc., a prominent multinational company (MNC of the modern era. Furthermore, the study presents the success achieved by these innovations at both the domestic and global levels, along with their implications regarding socio-economic sustainability in emerging markets. In order to investigate the research questions, a case study of Philips China was conducted involving three product innovations that were found to be suitable examples of reverse innovation. After the study of extant literature on the topic, drawing from research databases, newspaper articles, and company press releases, five semi-structuredinterviews were conducted with key managers and a market practitioner to gain sufficient understanding for this exploratory study. Subsequent case analysis concludes that these innovations are examples of reverse innovation representing a new paradigm change in innovation flow. This flow of innovation from emerging markets to developed markets as confirmed by Corsi’s framework could potentially disrupt developed markets as well as contribute to ensure healthy living conditions for the population living in developing countries. If so, this represents a sustainable socio-economic change in-line with the United Nations' Sustainable Development Goal (SDG of “ensuring healthy lives and promoting well-being for all at all ages.” This is relevant as Philips aspires to be a prominent private sector player in achieving the above-stated goal by defeating non-communicable disease and strengthening local healthcare systems.
Bartel-Radic, Anne; Moos, J. Chris; Long, Suzanna K.
2015-01-01
This article presents an innovative pedagogy based on student participation in globally distributed project teams. The study questions the link between student learning of intercultural competence and the global teaming experience. Data was collected from 115 students participating in 22 virtual intercultural teams. Results revealed that students…
18 CFR 430.11 - Advance notice of exploratory drilling.
2010-04-01
... exploratory drilling. 430.11 Section 430.11 Conservation of Power and Water Resources DELAWARE RIVER BASIN... exploratory drilling. The Commission encourages consultation with any project sponsor who is considering... project and prior to initiation of exploratory drilling. (a) Any person, firm corporation or other entity...
Movement and equipositioning of plasmids by ParA filament disassembly
DEFF Research Database (Denmark)
Ringgaard, Simon; van Zon, Jeroen; Howard, Martin
2009-01-01
, plasmids consistently migrate behind disassembling ParA cytoskeletal structures, suggesting that ParA filaments pull plasmids by depolymerization. The perpetual cycles of ParA assembly and disassembly result in continuous relocation of plasmids, which, on time averaging, results in equidistribution...
Open innovations, innovation communities and firm's innovative activities
Directory of Open Access Journals (Sweden)
Getejanc Vesna
2016-01-01
Full Text Available The open innovation paradigm emphasizes the fact that firms can improve their performance by opening their business models and reduce their R&D costs by effective incorporation of external knowledge. In other words, companies are able to capture value through knowledge that exists outside the boundaries of their organization. The shift from closed to open model of innovation has imposed the necessity to adopt more open approach to innovation within traditional academic view of business strategy. The adoption of this innovative approach is emphasized even more, by the necessity for stronger connection and cooperation among the participants of the innovation process. Free will and collaboration are the main characteristics of open source software, which is recognized in literature as the role model of open innovation and is a rapidly growing method of technology development. Furthermore, innovative communities represent a great opportunity for improvement of the companies' innovation activities, since they have become an important source for identifying the needs and problems of the users. Their development has been fostered by information technologies and recent social changes in user behavior. Recognizing and better understanding the motivation of the members of the innovation communities that guide them to participate in the process of idea generation, can have significant influence on their incorporation within the innovation process. Equally important is to define the incentives that are suited for stimulating and fostering innovative user activities. Taking this topic in consideration, the purpose of this article is to address the following questions: In what way does the collaboration in open source software projects have positive effect on companies' innovation performance? What are the innovation communities and how can companies establish successful interaction with them? Why does the interaction with innovation communities lead to
PAR-1 contributes to the innate immune response during viral infection
Antoniak, Silvio; Owens, A. Phillip; Baunacke, Martin; Williams, Julie C.; Lee, Rebecca D.; Weithäuser, Alice; Sheridan, Patricia A.; Malz, Ronny; Luyendyk, James P.; Esserman, Denise A.; Trejo, JoAnn; Kirchhofer, Daniel; Blaxall, Burns C.; Pawlinski, Rafal; Beck, Melinda A.; Rauch, Ursula; Mackman, Nigel
2013-01-01
Coagulation is a host defense system that limits the spread of pathogens. Coagulation proteases, such as thrombin, also activate cells by cleaving PARs. In this study, we analyzed the role of PAR-1 in coxsackievirus B3–induced (CVB3-induced) myocarditis and influenza A infection. CVB3-infected Par1–/– mice expressed reduced levels of IFN-β and CXCL10 during the early phase of infection compared with Par1+/+ mice that resulted in higher viral loads and cardiac injury at day 8 after infection. Inhibition of either tissue factor or thrombin in WT mice also significantly increased CVB3 levels in the heart and cardiac injury compared with controls. BM transplantation experiments demonstrated that PAR-1 in nonhematopoietic cells protected mice from CVB3 infection. Transgenic mice overexpressing PAR-1 in cardiomyocytes had reduced CVB3-induced myocarditis. We found that cooperative signaling between PAR-1 and TLR3 in mouse cardiac fibroblasts enhanced activation of p38 and induction of IFN-β and CXCL10 expression. Par1–/– mice also had decreased CXCL10 expression and increased viral levels in the lung after influenza A infection compared with Par1+/+ mice. Our results indicate that the tissue factor/thrombin/PAR-1 pathway enhances IFN-β expression and contributes to the innate immune response during single-stranded RNA viral infection. PMID:23391721
Analysis of Innovation and Its Environmental Impacts on the Chemical Industry
Directory of Open Access Journals (Sweden)
Dusan Schreiber
2016-01-01
Full Text Available Globalization of the economy and the need to achieve competitiveness drive organizations to invest in technology and in innovation, in order to find solutions that will provide advantages in an ever-more competitive market. The conflict between dwindling natural resources and the demand for economic growth has created a growing need to find means for making environmental conservation compatible with economic growth. The objective of this study is to contribute to the debate by analyzing the innovations implemented by chemical companies in the Sinos Valley region, Rio Grande do Sul, Brazil, and by identifying the motivations that drive them to develop environmental technologies. The study is exploratory and descriptive, with a quantitative data collection component in the form of a survey sent to all chemical companies in the Sinos Valley region, listed in a local business association database. The study results indicate that development of innovations is predominantly of an incremental nature and that novelty is generally restricted to the new-for-firm level. The environmental technologies implemented are generally designed to prevent or remedy environmental damage and are primarily motivated by the need to comply with environmental standards and legislation.
Energy Technology Data Exchange (ETDEWEB)
Burmeister, Mark [Navarro, Las Vegas, NV (United States)
2016-11-01
The Corrective Action Unit (CAU) 411 Closure Report (CR) was published in June 2016 (NNSA/NFO, 2016). The purpose of this addendum is to clarify language in the CR relating to the field instrument for the detection of low-energy radiation (FIDLER), provide the waste disposal documentation for waste generated during the corrective action investigation (CAI), and reference a letter from the U.S. Air Force (USAF) regarding the closure of CAU 411.
The Case For Corporate Responsibility: An Exploratory Study
Directory of Open Access Journals (Sweden)
Lucy da Piedade
2006-11-01
Full Text Available Stakeholder demands and the introduction of the ‘triple bottom line’ as a means of reporting corporate performance, make it critical that South African companies assess why they should undertake corporate responsibility initiatives. This exploratory study (part two of a two-part study investigated the issues that are being or should be addressed by companies under the banner of corporate responsibility and the reasons for this. The views of a convenience snowball sample of consultants, academics and practitioners of corporate responsibility, was gained by means of a Delphi technique. Content analysis was employed to categorise the views into themes. The findings indicate the need for corporate responsibility action in the areas of ecology, the environment, health and well-being, building human capital and in the encouragement of economic development. Cost benefit and defensive arguments dominate the case for corporate responsibility. There is little indication that organisations have identified the opportunity of corporate responsibility initiatives to increase innovation and organisational learning and its contribution to risk management. Recommendations are made regarding the assessment of investment in this area.
Peptide-Based Optical uPAR Imaging for Surgery
DEFF Research Database (Denmark)
Juhl, Karina; Christensen, Anders; Persson, Morten
2016-01-01
Near infrared intra-operative optical imaging is an emerging technique with clear implications for improved cancer surgery by enabling a more distinct delineation of the tumor margins during resection. This modality has the potential to increase the number of patients having a curative radical...... tumor resection. In the present study, a new uPAR-targeted fluorescent probe was developed and the in vivo applicability was evaluated in a human xenograft mouse model. Most human carcinomas express high level of uPAR in the tumor-stromal interface of invasive lesions and uPAR is therefore considered...... an ideal target for intra-operative imaging. Conjugation of the flourophor indocyanine green (ICG) to the uPAR agonist (AE105) provides an optical imaging ligand with sufficiently high receptor affinity to allow for a specific receptor targeting in vivo. For in vivo testing, human glioblastoma xenograft...
Directory of Open Access Journals (Sweden)
İbrahim PINAR
2012-06-01
strategy development processes which occur in organizations, it is widely understood that strategy development is multidimensional in nature. In an organization, innovation may emerge in two different forms; either upgrading the existing products, services and processes (exploitative innovation, or inventing totally new and different products, services and processes (exploratory innovation. In this study, the relationship between strategy development processes and innovation forms was examined on a sample of 246 companies. Alpha coefficients were calculated to ensure the reliability of the scales and factor analysis yielded two factors, exploratory and exploitative innovativeness, which fit the theory. Regression analysis was also used in order to test the hypotheses. Whilst the results revealed a negative effect between the command type of strategy development process on both exploitative and exploratory innovation forms, no relationship between the enforced choice type of strategy development process and innovation forms was found.
Dynamic Filament Formation by a Divergent Bacterial Actin-Like ParM Protein.
Directory of Open Access Journals (Sweden)
Anthony J Brzoska
Full Text Available Actin-like proteins (Alps are a diverse family of proteins whose genes are abundant in the chromosomes and mobile genetic elements of many bacteria. The low-copy-number staphylococcal multiresistance plasmid pSK41 encodes ParM, an Alp involved in efficient plasmid partitioning. pSK41 ParM has previously been shown to form filaments in vitro that are structurally dissimilar to those formed by other bacterial Alps. The mechanistic implications of these differences are not known. In order to gain insights into the properties and behavior of the pSK41 ParM Alp in vivo, we reconstituted the parMRC system in the ectopic rod-shaped host, E. coli, which is larger and more genetically amenable than the native host, Staphylococcus aureus. Fluorescence microscopy showed a functional fusion protein, ParM-YFP, formed straight filaments in vivo when expressed in isolation. Strikingly, however, in the presence of ParR and parC, ParM-YFP adopted a dramatically different structure, instead forming axial curved filaments. Time-lapse imaging and selective photobleaching experiments revealed that, in the presence of all components of the parMRC system, ParM-YFP filaments were dynamic in nature. Finally, molecular dissection of the parMRC operon revealed that all components of the system are essential for the generation of dynamic filaments.
First (18)F-labeled ligand for PET imaging of uPAR
DEFF Research Database (Denmark)
Persson, Morten; Liu, Hongguang; Madsen, Jacob
2013-01-01
Urokinase-type plasminogen activator receptor (uPAR) is overexpressed in human prostate cancer and uPAR has been found to be associated with metastatic disease and poor prognosis. AE105 is a small linear peptide with high binding affinity to uPAR. We synthesized an N-terminal NOTA......-conjugated version (NOTA-AE105) for development of the first (18)F-labeled uPAR positron-emission-tomography PET ligand using the Al(18)F radiolabeling method. In this study, the potential of (18)F-AlF-NOTA-AE105 to specifically target uPAR-positive prostate tumors was investigated....
The Emergence of Inclusive Exploratory Talk in Primary Students' Peer Interaction
Rajala, Antti; Hilppo, Jaakko; Lipponen, Lasse
2012-01-01
In this study, we examine a prominent type of classroom talk, exploratory talk, in primary school peer interactions. Exploratory talk has been shown to be productive in facilitating problem solving and fostering school achievement. However, within the growing body of research concerning exploratory talk, the relation between exploratory talk and…
Directory of Open Access Journals (Sweden)
Alda Cristina Silva da Costa
2017-05-01
Full Text Available On December 11, 2011, a plebiscite was held in Pará proposing to create two separatist states, Carajás and Tapajós, out of the state of Pará. The public voted against both projects. This article analyzes the narrative identities found on the front pages of O Liberal and Diário do Pará newspapers about the plebiscite in Pará. Depth Hermeneutics (DH, as proposed by Thompson (2011, was used as the methodological reference. DH emphasizes the object of analysis as a meaningful symbolic construction requiring interpretation. Narrative analysis, as proposed by Motta (2007, was the main research technique used to highlight the movement of construction of journalistic (discursive characters. The narrative identities built by the two newspapers showed that both were against the creation of the new states, but for very different reasons. The flag of Pará was the main object used to induce the idea of unity. Em 11 de dezembro de 2011, o plebiscito no Pará propôs a criação dos estados de Carajás e de Tapajós a partir da divisão do estado do Pará. O resultado da consulta pública foi negativo aos dois projetos. O artigo analisa as identidades narrativas constituídas pelas primeiras páginas dos jornais O Liberal e Diário do Pará sobre o plebiscito no Pará. Utilizou-se como referencial metodológico a Hermenêutica em Profundidade (HP, proposta por Thompson (2011. A HP evidencia o fato de que o objeto de análise é uma construção simbólica significativa, que exige uma interpretação. Como principal técnica de pesquisa, a análise narrativa, proposta por Motta (2007, com ênfase no movimento de construção de personagens jornalísticas (discursivas. As identidades narrativas construídas pelos dois jornais indicaram que ambos eram contrários à criação dos novos estados, porém por motivos divergentes. A bandeira do Pará foi o principal elemento utilizado para evocar a ideia de unidade. En 11 de diciembre de 2011, el plebiscito en
Limnological database for Par Pond: 1959 to 1980
International Nuclear Information System (INIS)
Tilly, L.J.
1981-03-01
A limnological database for Par Pond, a cooling reservoir for hot reactor effluent water at the Savannah River Plant, is described. The data are derived from a combination of research and monitoring efforts on Par Pond since 1959. The approximately 24,000-byte database provides water quality, primary productivity, and flow data from a number of different stations, depths, and times during the 22-year history of the Par Pond impoundment. The data have been organized to permit an interpretation of the effects of twenty years of cooling system operations on the structure and function of an aquatic ecosystem
Soluble urokinase plasminogen activator receptor (suPAR) in acute care
DEFF Research Database (Denmark)
Rasmussen, Line Jee Hartmann; Ladelund, Steen; Haupt, Thomas Huneck
2016-01-01
for age, sex, Charlson score and C reactive protein. Area under the curve for receiver operating characteristics curve analysis of suPAR for 30-day mortality was 0.84 (95% CI 0.81 to 0.86). Furthermore, in the entire cohort, women had slightly higher suPAR compared with men, and suPAR was associated...
Kwakkel, J.H.
2017-01-01
There is a growing interest in model-based decision support under deep uncertainty, reflected in a variety of approaches being put forward in the literature. A key idea shared among these is the use of models for exploratory rather than predictive purposes. Exploratory modeling aims at exploring
Directory of Open Access Journals (Sweden)
Manuel Rodenes Adam
2007-05-01
Full Text Available This article presents the results of an empirical-exploratory study applied to companies of the Software Industry (IndSw sector. One of the objectives pursued was to know the Critical Success Factors (CSF of the SWInd and their relation with the business strategic orientation. The CSF identified and analyzed were: Government Support, Human Capital, Marketing, Quality and Innovation. The research results reveal that it is possible to identify the existence of at least two main groups of strategic orientation (cost and differentiation within this sector. The analysis of the relation between business strategic orientation and the CSF emphasizes the following CSF: Human Capital, Quality and Innovation, the remaining factors present a little significant relation. The empirical study was made through multivariate analysis techniques. The analysis of results is based on data collected through the application of a web survey (Internet to Mexican software companies. The survey was applied in July 2005.
Weber, Thomas Karl-Heinz
2012-01-01
Just like nature, also technologies and industries, products and companies go through life cycles -- from 'birth' through maturity to 'death'. Innovativeness gives birth to new technologies and products, and innovation is written on the (business) storybook of many entrepreneurial undertakings and ventures. Those again appear habitually as starting or turning points in company and industry pedigrees. Further down the road, companies achieve maturity by managing consistently production and del...
Intact and cleaved uPAR forms: diagnostic and prognostic value in cancer
DEFF Research Database (Denmark)
Rasch, M.G.; Lund, I.K.; Hoyer-Hansen, G.
2008-01-01
identified in tissue and body fluids. It is well-established, that the total amount of all uPAR forms is a strong prognostic marker in different types of cancer. Using immunoassays, measuring the individual uPAR forms, has revealed that the cleaved uPAR forms are even stronger prognostic markers and have...... diagnostic utility. This review will focus on the mechanism of uPAR cleavage and the functional consequences, as well as the clinical applicability of cleaved uPAR forms Udgivelsesdato: 2008...
Innovation in the plural of the alpine cre-actors
Directory of Open Access Journals (Sweden)
Andréa Finger-Stich
2009-06-01
Full Text Available The capacity to innovate for a sustainable development of alpine territories cannot depend only on economic, legal and political conditions defined by the State at national and international levels. It depends also on local conditions that situate historically and geographically the actors in a continuity of social and ecological relationships. This approach highlights the collective – thus organisational – dimensions of the innovation process, including the imagination, the development, the implementation and even the diffusion of a new practice. Our point of view is that for contributing to the sustainable development of the Alps, innovations need to change the ecological, political, social and cultural relationships engaging the actors in these territories. This change affects as much the object territory as the subject actor of the territory. This is why innovating in the Alps means also innovating the Alps and the alpine actors (Cosalp, 2008. Based on a research about local people’s participation in the management of alpine communal forests, the article shows the importance of local interactions involving actors of diverse occupation, gender, age and origins1.La capacité d’innovation pour un développement durable des territoires alpins ne peut dépendre uniquement de conditions économiques, légales et politiques définies par les Etats aux échelles nationale et internationale. Elle dépend aussi de conditions locales, qui situent historiquement et géographiquement les acteurs dans une continuité de relations sociales et écologiques. Cette perspective accentue l’importance de la dimension collective, donc organisationnelle, du processus d’innovation, allant de l’imagination, puis au développement, à la réalisation – voire la diffusion – d’une nouvelle pratique. Le point de vue de cet article est qu’une innovation, pour contribuer au développement durable des Alpes, doit changer les relations
L’innovation au pluriel des cré-acteurs alpins
Directory of Open Access Journals (Sweden)
Andréa Finger-Stich
2009-06-01
Full Text Available La capacité d’innovation pour un développement durable des territoires alpins ne peut dépendre uniquement de conditions économiques, légales et politiques définies par les Etats aux échelles nationale et internationale. Elle dépend aussi de conditions locales, qui situent historiquement et géographiquement les acteurs dans une continuité de relations sociales et écologiques. Cette perspective accentue l’importance de la dimension collective, donc organisationnelle, du processus d’innovation, allant de l’imagination, puis au développement, à la réalisation – voire la diffusion – d’une nouvelle pratique. Le point de vue de cet article est qu’une innovation, pour contribuer au développement durable des Alpes, doit changer les relations écologique, politique, sociale et culturelle, qui engagent les acteurs du territoire. Ce changement affecte tant l’objet territoire que le sujet acteur du territoire. C’est pourquoi, innover dans les Alpes revient aussi à innover les Alpes et les acteurs alpins(Cosalp, 2008. Sur la base d’une recherche sur la participation des populations locales dans la gestion de forêts communales alpines, l’article relève l’importance des interactions locales impliquant les acteurs d’occupations, genres, âges et origines divers1.The capacity to innovate for a sustainable development of alpine territories cannot depend only on economic, legal and political conditions defined by the State at national and international levels. It depends also on local conditions that situate historically and geographically the actors in a continuity of social and ecological relationships. This approach highlights the collective - thus organisational - dimensions of the innovation process, including the imagination, the development, the implementation and even the diffusion of a new practice. Our point of view is that for contributing to the sustainable development of the Alps, innovations need to
Teng, Tun-Chien; Lai, Wei-Che
2014-12-15
This study proposed a planar solar concentrator featuring alignment-free total-internal-reflection (TIR) collectors and an innovative compound tracker. The compound tracker, combining a mechanical single-axis tracker and scrollable prism sheets, can achieve a performance on a par with dual-axis tracking while reducing the cost of the tracking system and increasing its robustness. The alignment-free TIR collectors are assembled on the waveguide without requiring alignment, so the planar concentrator is relatively easily manufactured and markedly increases the feasibility for use in large concentrators. Further, the identical TIR collector is applicable to various-sized waveguide slab without requiring modification, which facilitates flexibility regarding the size of the waveguide slab. In the simulation model, the thickness of the slab was 2 mm, and its maximal length reached 6 m. With an average angular tolerance of ±0.6°, and after considering both the Fresnel loss and the angular spread of the sun, the simulation indicates that the waveguide concentrator of a 1000-mm length provides the optical efficiencies of 62-77% at the irradiance concentrations of 387-688, and the one of a 2000-mm length provides the optical efficiencies of 52-64.5% at the irradiance concentrations of 645-1148. Alternatively, if a 100-mm horizontally staggered waveguide slab is collocated with the alignment-free TIR collectors, the optical efficiency would be greatly improved up to 91.5% at an irradiance concentration of 1098 (C(geo) = 1200X).
Exploratory research and development FY90
International Nuclear Information System (INIS)
Struble, G.L.; Middleton, C.; Baldwin, G.; Cherniak, J.; Clements, W.; Donohue, M.L.; Francke, A.; Kirvel, R.D.; MacGregor, P.; Shaw, G.
1990-01-01
In general, the Exploratory Research and Development (ER ampersand D) Program supports research projects considered too basic or long-range to be funded by other Lawrence Livermore National Laboratory (LLNL) programs. This Program is managed for the Laboratory Director by a special assistant who chairs the LLNL's IR ampersand D Review Committee. Membership in the Review Committee comprises senior LLNL scientists, engineers, and managers whose areas of expertise span the range of scientific disciplines pursued at the Laboratory. The research supported by the Program falls into three categories: Exploratory Research in the Disciplines, Director's Initiatives, and Laboratory-Wide Competition. The first two, Exploratory Research and Director's Initiatives, promote pioneering work in the various scientific disciplines and programmatic areas. Laboratory departments and divisions propose and manage projects in the Exploratory Research category. The Laboratory Director, with the advice of the Review Committee, selects several larger projects to fund as Director's Initiative. These projects, which are proposed and managed by the responsible associate director, are intended to enhance the scope of existing programs or establish new technical directions and programs for the Laboratory. All FY90 projects are described in detail in this report. Other publications on ER ampersand D projects are included in the Publications List at the back of this report
Trenching as a exploratory method
International Nuclear Information System (INIS)
Hatheway, A.W.; Leighton, F.B.
1979-01-01
The critical nature of siting nuclear power plants has led to increased emphasis on exploratory methods; it permits inspection of a continuous geologic section by both geologists and regulatory authorities and makes possible the preparation of a graphic log that delineates both obvious and subtle geologic features. About one of every two nuclear plant licensing efforts utilizes exploratory trenching. Many geologic hazards, such as ''capable'' faults, can be detected from trench exposures; they may otherwise remain undetected. Trenches must be judiciously located, survey-controlled, excavated safetly and adequately shored, logged in detail, and properly diagnosed. Useful techniques of trench logging include thorough cleaning of the trench walls, teamwork between geologist and recorder, logging against a carefully surveyed baseline and vertical reference grid, and panoramic photography. Soils, including paleosols, and glacial and glaciofluvial deposits present some of the most difficult media to log. Trench logs must be thoroughly interpreted and correlated so that they document the geologic conditions governing suitability of the site. Age-determination techniques utilized in exploratory trenching include petrographic analyses, quartz inclusion studies, clay mineralogic analyses, and radiometric methods
A Bipolar Spindle of Antiparallel ParM Filaments Drives Bacterial Plasmid Segregation
DEFF Research Database (Denmark)
Gayathri, P; Fujii, T; Møller-Jensen, Jakob
2012-01-01
the spindle between ParRC complexes on sister plasmids. Using a combination of structural work and total internal reflection fluorescence microscopy, we show that ParRC bound and could accelerate growth at only one end of polar ParM filaments, mechanistically resembling eukaryotic formins. The architecture...... of ParM filaments enabled two ParRC-bound filaments to associate in an antiparallel orientation, forming a bipolar spindle. The spindle elongated as a bundle of at least two antiparallel filaments, thereby pushing two plasmid clusters toward the poles....
Kondo, Hiromi; Ito, Shin; Hatazaki, Kyoko; Horie, Kengo; Nakane, Keita; Mizutani, Kosuke; Tsuchiya, Tomohiro; Yasuda, Mitsuru; Yokoi, Shigeaki; Nakano, Masahiro; Deguchi, Takashi
2018-03-01
Of 73 clinical strains of Haemophilus influenzae isolated from the urethra of men with urogenital infections, we enrolled 6 strains (8.2%) with levofloxacin (LVFX) minimum inhibitory concentrations (MICs) of ≥0.03 μg/ml in this study. All the strains were isolated from non-gonococcal urethritis (NGU). We amplified the quinolone resistance-determining region of the gyrA gene and the analogous region of the parC gene from bacterial DNAs by PCR and sequenced the PCR products. Two strains with a LVFX MIC of 0.03 μg/ml had an amino acid change of Asp88 to Gly in GyrA. One with a LVFX MIC of 0.06 μg/ml had a change of Asp88 to Tyr in GyrA. Two with respective LVFX MICs of 0.12 and 0.25 μg/ml had a change of Ser84 to Leu in GyrA. One with a LVFX MIC of 1 μg/ml had changes of Ser84 to Leu in GyrA and of Ser84 to Ile in ParC. Multilocus sequence typing showed two strains with a change of Asp88 to Gly in GyrA had the same sequence type, but the others had sequence types different from each other. Single amino acid changes in GyrA alone or single changes in both GyrA and ParC could contribute to decreased susceptibility to fluoroquinolones in H. influenzae isolates from NGU. Most of the isolates with GyrA and/or ParC alterations would be multiclonal. The prevalence of such isolates would be relatively low, and they would still be susceptible to fluoroquinolones commonly prescribed for treatment of NGU. Copyright © 2017 Japanese Society of Chemotherapy and The Japanese Association for Infectious Diseases. Published by Elsevier Ltd. All rights reserved.
Exploratory behaviour, emotional wellbeing and childcare quality in preschool education
Directory of Open Access Journals (Sweden)
Alexander Barandiaran
2015-05-01
Full Text Available The aim of this study was to examine the relationship between children exploratory behaviour and the quality of structural childcare and process in preschools. The study also examined how childcare quality affects the relationship between emotional wellbeing and exploratory behaviour. The sample comprised 206 children from 40 classrooms in 20 preschools, together with their teachers. The children's age ranged between 37 and 64 months (M = 50.96, SD = 6.54. The results indicated that children cared for by more sensitive teachers engaged in more exploratory behavior. However, no moderating effect was found of teacher sensitivity on the positive relationship between exploratory behavior and wellbeing. Finally, some factors linked to the quality of structural childcare also influenced exploratory behavior, although to a lesser extent.
PAR-2 expression in the gingival crevicular fluid reflects chronic periodontitis severity
Directory of Open Access Journals (Sweden)
Henrique FUKUSHIMA
Full Text Available Abstract Recent studies investigating protease-activated receptor type 2 (PAR-2 suggest an association between the receptor and periodontal inflammation. It is known that gingipain, a bacterial protease secreted by the important periodontopathogen Porphyromonas gingivalis can activate PAR-2. Previous studies by our group found that PAR-2 is overexpressed in the gingival crevicular fluid (GCF of patients with moderate chronic periodontitis (MP. The present study aimed at evaluating whether PAR-2 expression is associated with chronic periodontitis severity. GCF samples and clinical parameters, including plaque and bleeding on probing indices, probing pocket depth and clinical attachment level, were collected from the control group (n = 19 at baseline, and from MP patients (n = 19 and severe chronic periodontitis (SP (n = 19 patients before and 6 weeks after periodontal non-surgical treatment. PAR-2 and gingipain messenger RNA (mRNA in the GCF of 4 periodontal sites per patient were evaluated by Reverse Transcription Polymerase Chain Reaction (RT-qPCR. PAR-2 and gingipain expressions were greater in periodontitis patients than in control group patients. In addition, the SP group presented increased PAR-2 and gingipain mRNA levels, compared with the MP group. Furthermore, periodontal treatment significantly reduced (p <0.05 PAR-2 expression in patients with periodontitis. In conclusion, PAR-2 is associated with chronic periodontitis severity and with gingipain levels in the periodontal pocket, thus suggesting that PAR-2 expression in the GCF reflects the severity of destruction during periodontal infection.
Dalitz, Robert; Toner, Phillip; Turpin, Tim
2011-01-01
Innovation is thought to improve productivity at the firm level and economic prosperity at the national level. This would seem to have implications for the skills and skills development of employees. However, little is known about the relationship between skills development and innovation. This report is the culmination of case studies exploring…
Energy autonomy in Le Mené: A French case of grassroots innovation
International Nuclear Information System (INIS)
Yalçın-Riollet, Melike; Garabuau-Moussaoui, Isabelle; Szuba, Mathilde
2014-01-01
Local citizen-led initiatives relating to energy are developing strongly in Anglo-Saxon countries and a growing body of research is examining their innovative potential. In France, similar grassroots initiatives – albeit with certain specificities – only began to emerge recently and so far, very few studies have dealt with them. The purpose of this article is to propose an exploratory and in-depth analysis of one advanced French case: Le Mene', a pioneer in local energy autonomy. We examine the conditions under which the initiative emerged and the processes through which a grassroots innovation is formed. In studying this case (interviews, analysis of documents), comparing it with other sources of data (expert interviews, comparative observation of other initiatives) and taking stock of various social sciences studies, we show that a social innovation was produced in Le Mene' through the hybridisation of actors, sociotechniques and discourses. This initiative was innovative not only in terms of the scope of the mechanisms implemented, but also in terms of the social organisation behind the development of the projects and the capacity to use energy production as a social resource. Finally, we reflect on the possible diffusion of these grassroots initiatives and their policy implications in France. - Highlights: • The case study is the Le Mené, a pioneer case for local energy autonomy. • This case is an emerging grassroots innovation in France. • Hybridisation (combining diversity and frames) is at the centre of the innovation. • This study focuses on the hybridisation of actors, sociotechniques and discourses. • Examines the potential diffusion of grassroots initiatives in France
Choomlucksana, Juthamas; Doolen, Toni L.
2017-01-01
The use of collaborative activities and simulation sessions in engineering education has been explored previously. However, few studies have investigated the relationship of these types of teaching innovations with other learner characteristics, such as self-efficacy and background knowledge. This study explored the effects of collaborative…
Structures of actin-like ParM filaments show architecture of plasmid-segregating spindles.
Bharat, Tanmay A M; Murshudov, Garib N; Sachse, Carsten; Löwe, Jan
2015-07-02
Active segregation of Escherichia coli low-copy-number plasmid R1 involves formation of a bipolar spindle made of left-handed double-helical actin-like ParM filaments. ParR links the filaments with centromeric parC plasmid DNA, while facilitating the addition of subunits to ParM filaments. Growing ParMRC spindles push sister plasmids to the cell poles. Here, using modern electron cryomicroscopy methods, we investigate the structures and arrangements of ParM filaments in vitro and in cells, revealing at near-atomic resolution how subunits and filaments come together to produce the simplest known mitotic machinery. To understand the mechanism of dynamic instability, we determine structures of ParM filaments in different nucleotide states. The structure of filaments bound to the ATP analogue AMPPNP is determined at 4.3 Å resolution and refined. The ParM filament structure shows strong longitudinal interfaces and weaker lateral interactions. Also using electron cryomicroscopy, we reconstruct ParM doublets forming antiparallel spindles. Finally, with whole-cell electron cryotomography, we show that doublets are abundant in bacterial cells containing low-copy-number plasmids with the ParMRC locus, leading to an asynchronous model of R1 plasmid segregation.
Comment est abordée la question de l’innovation dans les sciences sociales ?
Directory of Open Access Journals (Sweden)
Jean Corneloup
2009-07-01
Full Text Available Si l’innovation est devenue aujourd’hui une notion d’actualité tant elle apparaît comme fondamentale pour penser l’économie et l’adaptation de notre société à son projet de développement, reste à en définir les caractéristiques et les principes. Si le XXe siècle a été marqué par des changements importants sur un plan technologique, politique, économique ou encore culturel, l’époque actuelle semble redoubler d’efforts pour imposer l’innovation comme moteur du développement de la société. Reste alors à comprendre la manière dont cette question est abordée actuellement qui renvoie à différentes lectures de cet objet. Entre l’approche notionnelle qui reste bien souvent floue et assez sommaire et les approches théoriques qui tentent de nous présenter différentes perspectives pour comprendre la démarche innovante, le chemin de la connaissance est bien souvent compartimenté par disciplines scientifiques. Dans le cadre de cet écrit, on tentera de montrer l’existence de tensions et de combinaisons entre les approches en sciences de gestion, en sociologie, en économie et en géographie dans leur façon d’aborder le processus innovant. Pour exposer ce mouvement, on prendra comme sujet d’étude l’entreprise et le territoire qui sont l’objet de nombreux travaux pour comprendre les forces qui participent à la production de la nouveauté.Although innovation has today become a topical notion, given its fundamental importance in understanding the economy and the way our society adapts to its development goals, its characteristics and principles nevertheless need to be defined. While the 20th century was marked by important technological, political, economic and cultural changes, the current era seems to be increasingly bent on imposing innovation as a motor for the development of society. It is therefore important to understand how the question of innovation is currently being addressed, and in turn
H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil
Maximilien Brice
2002-01-01
Photo 01: At the ATLAS assembly hall H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil (centre) with C. Melo (left) and P. Jenni Photo 02: At the ATLAS assembly hall H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil (centre) with C. Melo (left) and P. Jenni. Photo 03: At the ATLAS assembly hall H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil (second from right) with R. Salmeron, C. Melo, A. Dos Anjos and H. Pessoa Lima Junior. Photo 05: At the ATLAS assembly hall H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil (second from left) with, from left to right C. Melo, R. Salmeron, P. Jenni. Photo 06: At the ATLAS assembly hall H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil (left) with C. Melo. Behind, J. Ellis and J.A. Rubiol. Photo 07: At the ATLAS assembly hall H.E. Mr Ronaldo Mota Sardenberg, Minister for Science,...
40 CFR 425.06 - Monitoring requirements.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Monitoring requirements. 425.06 Section 425.06 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS LEATHER TANNING AND FINISHING POINT SOURCE CATEGORY General Provisions § 425.06...
Directory of Open Access Journals (Sweden)
John Ong
2018-03-01
Full Text Available Summary: Use of hepatocytes derived from induced pluripotent stem cells (i-Heps is limited by their functional differences in comparison with primary cells. Extracellular niche factors likely play a critical role in bridging this gap. Using image-based characterization (high content analysis; HCA of freshly isolated hepatocytes from 17 human donors, we devised and validated an algorithm (Hepatocyte Likeness Index; HLI for comparing the hepatic properties of cells against a physiological gold standard. The HLI was then applied in a targeted screen of extracellular niche factors to identify substrates driving i-Heps closer to the standard. Laminin 411, the top hit, was validated in two additional induced pluripotent stem cell (iPSC lines, primary tissue, and an in vitro model of α1-antitrypsin deficiency. Cumulatively, these data provide a reference method to control and screen for i-Hep differentiation, identify Laminin 411 as a key niche protein, and underscore the importance of combining substrates, soluble factors, and HCA when developing iPSC applications. : Rashid and colleagues demonstrate the utility of a high-throughput imaging platform for identification of physiologically relevant extracellular niche factors to advance i-Heps closer to their primary tissue counterparts. The extracellular matrix (ECM protein screen identified Laminin 411 as an important niche factor facilitating i-Hep-based disease modeling in vitro. Keywords: iPS hepatocytes, extracellular niche, image-based screening, disease modeling, laminin
2010-04-01
..., Provision for deferred income taxes-Credit, other income and deductions. 367.4112 Section 367.4112... deferred taxes and deferrals of taxes, credit, that relate to other income and deductions. ... Accounts Service Company Operating Income § 367.4112 Account 411.2, Provision for deferred income taxes...
Par and IR reflectance, transmittance, and absorptance of four crop canopies
International Nuclear Information System (INIS)
Wanjura, D.F.; Hatfield, J.L.
1986-01-01
Reflectance, transmittance and absorptance of electromagnetic radiation by cotton, soybeans, grain sorghum, and sunflower was measured at three growth stages in two wavebands (PAR: 0.4 to 0.7 pun and IR: 0.7 to 1.1 yim). As leaf area increased in each crop there were increases in IR reflectance and PAR absorptance and decreases in PAR reflectance and both PAR and IR transmittance. IR radiation was concentrated at the soil surface between rows by reflectance from the sides of canopies when crop cover was less than 80%. Across all crops one parameter, leaf overlap index, explained 81 and 71% of the PAR reflectance and another, crop cover, explained 86 and 94% of IR reflectance from rows and interrows, respectively. Attenuation of PAR radiation through the canopies of cotton and sunflower was similar (K = 0.62 and 0.67) but different from that of soybeans and grain sorghum (K = 0.46 and 0.43) which were the same
Épidémiologie de l'intoxication par envenimation chez les enfants ...
African Journals Online (AJOL)
Introduction: L'intoxication par envenimation est l'ensemble des manifestations locales et générales induites par la pénétration dans l'organisme d'une substance toxique produite par un animal venimeux. Le but de notre travail était d'étudier les signes cliniques des intoxications par envenimation chez les enfants de 0 à 15 ...
Directory of Open Access Journals (Sweden)
Albert Makore
2013-06-01
Full Text Available This research paper focuses on the evaluation of innovative welding technology’s impact on the productivity of Small and Medium Enterprises (SMEs. The paper examines business operational sector and size, technology currently in use, customer/supplier relationships, and technical knowledge levels, skills in use on the shop floor level, training, safety standards implementation and quality control aspects in the SMEs. The companies are evaluated on their use of Oxygen and Acetylene gas welding, Manual Metal Arc Welding (MMA, Metal Inert Gas Welding (MIG and Tungsten Inert Gas Welding (TIG for maintenance and productive purposes. Both exploratory and descriptive research designs are applied in this study. A structured survey instrument was administered to seventy five (75 SMEs selected based the researcher’s judgement of companies’ industrial classification. The findings are that technological innovativeness has both positive and negative effects on the commercial success of companies,however management in SMEs do not leverage on the use of innovative welding technology. The findings on the nonsignificance of the influence of technological innovativeness of welding processes can be as a result internal managerial controllable factors and outward uncontrollable environmental factors.
PARs for combustible gas control in advanced light water reactors
International Nuclear Information System (INIS)
Hosler, J.; Sliter, G.
1997-01-01
This paper discusses the progress being made in the United States to introduce passive autocatalytic recombiner (PAR) technology as a cost-effective alternative to electric recombiners for controlling combustible gas produced in postulated accidents in both future Advanced Light Water Reactors (ALWRs) and certain U. S. operating nuclear plants. PARs catalytically recombine hydrogen and oxygen, gradually producing heat and water vapor. They have no moving parts and are self-starting and self-feeding, even under relatively cold and wet containment conditions. Buoyancy of the hot gases they create sets up natural convective flow that promotes mixing of combustible gases in a containment. In a non-inerted ALWR containment, two approaches each employing a combination of PARs and igniters are being considered to control hydrogen in design basis and severe accidents. In pre-inerted ALWRs, PARs alone control radiolytic oxygen produced in either accident type. The paper also discusses regulatory feedback regarding these combustible gas control approaches and describes a test program being conducted by the Electric Power Research Institute (EPRI) and Electricite de France (EdF) to supplement the existing PAR test database with performance data under conditions of interest to U.S. plants. Preliminary findings from the EPRI/EdF PAR model test program are included. Successful completion of this test program and confirmatory tests being sponsored by the U. S. NRC are expected to pave the way for use of PARs in ALWRs and operating plants. (author)
Brulure par Plaque de Bistouri Electrique: a Propos de Quatre Cas
Khales, A.; Achbouk, A.; Belmir, R.; Cherkab, L.; Ennouhi, M.A.; Ababou, K.; Ihrai, H.
2010-01-01
Summary La brûlure par plaque de bistouri électrique est un accident rare mais grave par la profondeur de la lésion et par sa localisation, surtout quand qu’elle survient dans un contexte chirurgical dont le vécu reste difficile de la part du malade et du chirurgien. Cette brûlure bien que imprévisible reste grave par la profondeur et la localisation de la brûlure et par sa survenue dans un contexte opératoire, chez des patients malades. La prise en charge de la brûlure doit se faire en milieu spécialisé. La prévention reste le seul moyen d’éviter ce type d’accident. PMID:21991216
The Brazilian Wine Industry: a case study on geographical proximity and innovation dynamics
Directory of Open Access Journals (Sweden)
Claudio Vinicius Silva Farias
2014-09-01
Full Text Available This paper aims to analyze the cooperation and learning processes in the local system of vitiviniculture production of Serra Gaúcha's region (Rio Grande do Sul, Brazil, in order to characterize the dynamics of innovation of the firms located there. In methodological terms, a non-probabilistic exploratory study has been conducted. Field research in 20 wineries as well as interviews with related organizations were carried out in order to understand which learning mechanisms support innovative strategies adopted by enterprises. Since learning processes are also the result of local interactions, it was necessary to understand whether these interactions produced cooperative links. The results showed that innovations made by the firms were basically incremental. To do so, they use their intrinsic learning processes as well as external agents. These agents can be located in the region or elsewhere. The geographical proximity becomes more relevant for smaller firms. It was still possible to perceive the existence of cooperation in both vertical and horizontal level. Most frequent actions of vertical cooperation occur especially between firms and their suppliers. When horizontal cooperation occurs between enterprises, it takes place particularly in international trading.
Directory of Open Access Journals (Sweden)
Naomi Nichols
2013-05-01
, appuyer des stratégies d’innovation sociale qui contribuent au bien commun? Notre évaluation indique qu’il y a beaucoup d’influences réciproques entre les collaborations communautaires/académiques, la mobilisation du savoir et l’innovation sociale, surtout que la mobilisation du savoir facilite la collaboration et vice versa. En effet, avec une mobilisation du savoir suffisante, les collaborations communautaires/académiques stimulent l’innovation sociale. Cet article se termine par des recommandations provenant de notre analyse documentaire.
Elusloom lennukiga puhkusele / Inge Parring
Parring, Inge
2003-01-01
Ilmunud ka: Delovõje Vedomosti 1. okt. lk. 13. Air Cargo Estonia/ACE Logisticsi müügijuht Inge Parring tutvustab elusloomade transpordivõimalusi. Vt. samas: Loomade transportimiseks vajalikud dokumendid
DEFF Research Database (Denmark)
Eugen-Olsen, Jesper; Giamarellos-Bourboulis, Evangelos J
2015-01-01
Investigation of biomarkers that can promptly predict unfavourable outcome of critically illness is an emerging necessity taking into consideration the need for early intervention, the shortage of available beds in intensive care units and the considerable cost of hospitalisation. The most...... promising biomarker is soluble urokinase-type plasminogen activator receptor (suPAR). Three studies in large populations of critically ill patients and patients admitted to the emergency department have shown that concentrations >12ng/mL can safely predict unfavourable outcome. This review presents...
DEFF Research Database (Denmark)
Rabna, Paulo; Andersen, Andreas; Wejse, Christian
2010-01-01
-suPAR was measured using a commercial ELISA (suPARnostic®). We found that U-suPAR carried significant prognostic information on mortality for HIV-infected subjects with an area under the ROC curve of 0.75. For HIV-negative individuals, little or no prognostic effect was observed. However, in both HIV positives...... and negatives, the predictive effect of U-suPAR was found to be inferior to that of P-suPAR....
Brésil : La contamination par le mercure en Amazonie | CRDI ...
International Development Research Centre (IDRC) Digital Library (Canada)
11 janv. 2011 ... En tentant de déceler la source de la contamination de l'Amazone par le ... par Jean-Rémy Davy Guimaraes de l'Université fédérale de Rio de Janeiro ... ces mattes est circonscrite par la conservation et la restauration en rive.
R.M.A. Hollen (Rick)
2015-01-01
markdownabstractResearch has highlighted that firms competing in dynamic environments have to balance exploitative (efficiency-directed) activities with explorative (innovation-directed) ones in order to remain internationally competitive. In economically advanced countries, whose competitiveness is
Exploratory research and development FY90
Energy Technology Data Exchange (ETDEWEB)
Struble, G.L.; Middleton, C.; Baldwin, G.; Cherniak, J.; Clements, W.; Donohue, M.L.; Francke, A.; Kirvel, R.D.; MacGregor, P.; Shaw, G. (eds.)
1990-01-01
In general, the Exploratory Research and Development (ER D) Program supports research projects considered too basic or long-range to be funded by other Lawrence Livermore National Laboratory (LLNL) programs. This Program is managed for the Laboratory Director by a special assistant who chairs the LLNL's IR D Review Committee. Membership in the Review Committee comprises senior LLNL scientists, engineers, and managers whose areas of expertise span the range of scientific disciplines pursued at the Laboratory. The research supported by the Program falls into three categories: Exploratory Research in the Disciplines, Director's Initiatives, and Laboratory-Wide Competition. The first two, Exploratory Research and Director's Initiatives, promote pioneering work in the various scientific disciplines and programmatic areas. Laboratory departments and divisions propose and manage projects in the Exploratory Research category. The Laboratory Director, with the advice of the Review Committee, selects several larger projects to fund as Director's Initiative. These projects, which are proposed and managed by the responsible associate director, are intended to enhance the scope of existing programs or establish new technical directions and programs for the Laboratory. All FY90 projects are described in detail in this report. Other publications on ER D projects are included in the Publications List at the back of this report.
Sociometric Indicators of Leadership: An Exploratory Analysis
2018-01-01
Research Report 2015 Sociometric Indicators of Leadership : An Exploratory Analysis Elizabeth R. Uhl U.S. Army...2017 4. TITLE AND SUBTITLE Sociometric Indicators of Leadership : An Exploratory Analysis 5a. CONTRACT NUMBER W5J9CQ-11-D-0001 5b...objectives and a discussion of the strengths and weaknesses of the wearable sensor technology. 15. SUBJECT TERMS Leadership ; Social Network; Sociometric
McKillop, Jessica; Heanue, Kevin; Kinsella, Jim
2018-01-01
Purpose: Research on young farmers traditionally focused on the future of the agricultural sector or else compared the innovativeness, efficiency or entrepreneurialism of young to older farmers. By contrast, this paper examines the differences in innovation within young farmers. Methodology: Innovativeness is defined here as the adoption of…
Novas determinações dos parâmetros atmosféricos das estrelas anãs brancas DA
Giovannini, O.; Costa, A. F. M.; Kepler, S. O.
2003-08-01
Nós temos selecionado uma amostra de estrelas anãs brancas DA (atmosfera de hidrogênio) a partir dos índices de Strömgren cujos valores estão próximos a região de instabilidade das estrelas anãs brancas DA variáveis, as chamadas estrelas DAV ou ZZ Ceti. O objetivo é determinar os parâmetros fundamentais (temperatura efetiva, Teff, aceleração da gravidade, log g, e massa) destas estrelas para verificar quais os parâmetros estelares estão envolvidos com o mecanismo de pulsação das estrelas DAV. Nós obtemos, até agora, mais de 120 espectros óticos de estrelas DA. Entre as estrelas selecionadas há 20 estrelas variáveis (DAV). Assim, podemos verificar se existem ou não estrelas não variáveis dentro da faixa de instabilidade das estrelas ZZ Ceti. Neste trabalho nós apresentamos a determinação dos parâmetros atmosféricos (temperatura efetiva, Teff, e aceleração da gravidade, log g) das estrelas anãs brancas DA usando os novos modelos de atmosfera ML2/a = 0.6. Estes modelos têm sido utilizados recentemente por fornecerem uma excelente consistência interna na determinação das temperaturas nas regiões do ultra-violeta e ótico. Os parâmetros atmosféricos são determinados espectroscopicamente através da comparação do fluxo de energia das linhas de Balmer (Hb à H9) entre os espectros observados e sintéticos (gerados pelos modelos de atmosfera). As temperaturas obtidas com os novos modelos são, em geral, menores (~ 1000 K menos) que as temperaturas determinadas anteriormente, com modelos ML1. Os valores de log g não mudaram significativamente (menos de 10%). A faixa de instabilidade das DAVs está entre 11000 e 13000 K, consistente com dados de outros autores.
Directory of Open Access Journals (Sweden)
Coppens Marc
2016-01-01
Full Text Available For all integers g ≥ 6 we prove the existence of a metric graph G with w41=1$w_4^1 = 1$ such that G has Clifford index 2 and there is no tropical modification G′ of G such that there exists a finite harmonic morphism of degree 2 from G′ to a metric graph of genus 1. Those examples show that not all dimension theorems on the space classifying special linear systems for curves have immediate translation to the theory of divisors on metric graphs.
Factors affecting construction performance: exploratory factor analysis
Soewin, E.; Chinda, T.
2018-04-01
The present work attempts to develop a multidimensional performance evaluation framework for a construction company by considering all relevant measures of performance. Based on the previous studies, this study hypothesizes nine key factors, with a total of 57 associated items. The hypothesized factors, with their associated items, are then used to develop questionnaire survey to gather data. The exploratory factor analysis (EFA) was applied to the collected data which gave rise 10 factors with 57 items affecting construction performance. The findings further reveal that the items constituting ten key performance factors (KPIs) namely; 1) Time, 2) Cost, 3) Quality, 4) Safety & Health, 5) Internal Stakeholder, 6) External Stakeholder, 7) Client Satisfaction, 8) Financial Performance, 9) Environment, and 10) Information, Technology & Innovation. The analysis helps to develop multi-dimensional performance evaluation framework for an effective measurement of the construction performance. The 10 key performance factors can be broadly categorized into economic aspect, social aspect, environmental aspect, and technology aspects. It is important to understand a multi-dimension performance evaluation framework by including all key factors affecting the construction performance of a company, so that the management level can effectively plan to implement an effective performance development plan to match with the mission and vision of the company.
Energy Technology Data Exchange (ETDEWEB)
Levy, V; Espinasse, J; Mairy, C; Hillairet, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1969-07-01
Vacancy clustering in quenched magnesium has been studied by transmission electron microscopy. The nature of the vacancy loops observed, seems to depend essentially on the impurity content of the metal; this effect can be attributed to a variation of the stacking fault energy of magnesium due to impurities. (authors) [French] On a etudie par microscopie electronique en transmission les defauts crees par trempe dans le magnesium. Un effet considerable des impuretes du metal sur la nature des boucles obtenues par condensation de lacunes a ete mis en evidence; cet effet semble s'expliquer de facon satisfaisante par un abaissement de l'energie de faute d'empilement du magnesium du aux impuretes. (auteur)
Dubarry, Nelly; Pasta, Franck; Lane, David
2006-01-01
Most bacterial chromosomes carry an analogue of the parABS systems that govern plasmid partition, but their role in chromosome partition is ambiguous. parABS systems might be particularly important for orderly segregation of multipartite genomes, where their role may thus be easier to evaluate. We have characterized parABS systems in Burkholderia cenocepacia, whose genome comprises three chromosomes and one low-copy-number plasmid. A single parAB locus and a set of ParB-binding (parS) centromere sites are located near the origin of each replicon. ParA and ParB of the longest chromosome are phylogenetically similar to analogues in other multichromosome and monochromosome bacteria but are distinct from those of smaller chromosomes. The latter form subgroups that correspond to the taxa of their hosts, indicating evolution from plasmids. The parS sites on the smaller chromosomes and the plasmid are similar to the “universal” parS of the main chromosome but with a sequence specific to their replicon. In an Escherichia coli plasmid stabilization test, each parAB exhibits partition activity only with the parS of its own replicon. Hence, parABS function is based on the independent partition of individual chromosomes rather than on a single communal system or network of interacting systems. Stabilization by the smaller chromosome and plasmid systems was enhanced by mutation of parS sites and a promoter internal to their parAB operons, suggesting autoregulatory mechanisms. The small chromosome ParBs were found to silence transcription, a property relevant to autoregulation. PMID:16452432
Directory of Open Access Journals (Sweden)
Evange Elias Assis
2015-06-01
Full Text Available The increased consumption of appliance and electronic products by lower-income population represented a growth opportunity for companies in the sector. The overall objective of this paper is to investigate how appliance and electronic product manufacturers draw up their marketing planning for low-end products. An exploratory approach was taken in this study, comprising the literature review and the empirical research which was conducted in two stages by combining the qualitative and quantitative approaches. The study group comprised companies affiliated with National Association of Appliance and Electronic Product Manufacturers (ELETROS. Results indicate that in 87.5% of cases the marketing planning focuses on the product. The companies are concerned to differentiate the low-end products on the market mainly by design (87.5% and innovation (62.5%. Within this context, it seems that the opportunity for growth of the appliance and electronic product companies can be boosted when implementing specific marketing planning for low-end products. Innovation is needed in all processes from project design of the product to its distribution.
Energy Technology Data Exchange (ETDEWEB)
Aitken, Martin J; Emeleus, Vera M; Hall, Edward T [Research Laboratory for Archaeology and the History of Art, University of Oxford (United Kingdom); Kraay, Colin M [Heberden Coin Room, Ashmolean Museum, University of Oxford (United Kingdom)
1962-01-15
The amounts of gold and copper present as impurities in 500 Creek silver coins of the fifth century B.C. have been determined with a gamma-ray spectrometer, following neutron activation. The coinage from eight cities and kingdoms was studied; the average gold-content for different groups of coins varies between 0.02% and 0.3%, and the copper content between 0.1% and 10%. Evidence about trading connexions and of deliberate debasements of the coinage has been obtained, and several unsuspected plated coins were detected. The gold content was determined by measuring the intensity of the 0.411 MeV gamma-ray from Au{sup 198} (2.69 d); for the copper content the 0.511 MeV positron annihilation radiation from Cu{sup 64} (12.8 h) was used, and for silver the 0.884 MeV gamma-ray from Ag{sup 110m} (253 d). Decay measurements were used as a check of identity. The technique of using total gamma-activity decay curves by themselves is insufficiently sensitive. For accurate work, the importance of approximate facsimile standards is stressed. (author) [French] Apres activation neutronique, on a pu determiner, a l'aide d'un spectrometre gamma, les quantites d'or et de cuivre contenues comme impuretes dans 500 pieces d'argent grecques du cinquieme siecle avant J.C. On a etudie des pieces frappees par huit cites ou royaumes; la teneur moyenne en or des differentes pieces varie de 0,02 a 0,3%, tandis que la teneur en cuivre se situe entre 0,1 et 10%. Ces pieces ont permis, d'une part, de se rendre compte des relations commerciales existant a l'epoque et, d'autre part, de constater que certaines d'entre elles avaient ete deliberement alterees et que plusieurs autres etaient simplement plaquees. On a determine la teneur en or en mesurant l'intensite des rayons gamma de 0,411 MeV emis par l'or-198 (2,69 jours); pour la teneur en cuivre, on a utilise les rayonnements d'annihilation des positons de 0,511 MeV emis par le cuivre-64 (12,8 heures); pour la teneur en argent, les rayons gamma de
MODIS-derived daily PAR simulation from cloud-free images and its validation
Energy Technology Data Exchange (ETDEWEB)
Chen, Liangfu; Gu, Xingfa; Tian, Guoliang [State Key Laboratory of Remote Sensing Science, Jointly Sponsored by Institute of Remote Sensing Applications of Chinese Academy of Sciences and Beijing Normal University, Beijing 100101 (China); The Center for National Spaceborne Demonstration, Beijing 100101 (China); Gao, Yanhua [State Key Laboratory of Remote Sensing Science, Jointly Sponsored by Institute of Remote Sensing Applications of Chinese Academy of Sciences and Beijing Normal University, Beijing 100101 (China); Institute of Geographic Sciences and Natural Resources Research, Chinese Academy of Sciences, Beijing 100101 (China); Yang, Lei [State Key Laboratory of Remote Sensing Science, Jointly Sponsored by Institute of Remote Sensing Applications of Chinese Academy of Sciences and Beijing Normal University, Beijing 100101 (China); Jilin University, Changchun 130026 (China); Liu, Qinhuo [State Key Laboratory of Remote Sensing Science, Jointly Sponsored by Institute of Remote Sensing Applications of Chinese Academy of Sciences and Beijing Normal University, Beijing 100101 (China)
2008-06-15
In this paper, a MODIS-derived daily PAR (photosynthetically active radiation) simulation model from cloud-free image over land surface has been developed based on Bird and Riordan's model. In this model, the total downwelling spectral surface irradiance is divided into two parts: one is beam irradiance, and another is diffuse irradiance. The attenuation of solar beam irradiance comprises scattering by the gas mixture, absorption by ozone, the gas mixture and water vapor, and scattering and absorption by aerosols. The diffuse irradiance is scattered out of the direct beam and towards the surface. The multiple ground-air interactions have been taken into account in the diffuse irradiance model. The parameters needed in this model are atmospheric water vapor content, aerosol optical thickness and spectral albedo ranging from 400 nm to 700 nm. They are all retrieved from MODIS data. Then, the instantaneous photosynthetically available radiation (IPAR) is integrated by using a weighted sum at each of the visible MODIS wavebands. Finally, a daily PAR is derived by integration of IPAR. In order to validate the MODIS-derived PAR model, we compared the field PAR measurements in 2003 and 2004 against the simulated PAR. The measurements were made at the Qianyanzhou ecological experimental station, Chinese Ecosystem Research Network. A total of 54 days of cloud-free MODIS L1B level images were used for the PAR simulation. Our results show that the simulated PAR is consistent with field measurements, where the correlation coefficient of linear regression between calculated PAR and measured PAR is 0.93396. However, there were some uncertainties in the comparison of 1 km pixel PAR with the tower flux stand measurement. (author)
PAR-2 expression in the gingival crevicular fluid reflects chronic periodontitis severity.
Fukushima, Henrique; Alves, Vanessa Tubero Euzebio; Carvalho, Verônica Franco de; Ambrósio, Lucas Macedo Batitucci; Eichler, Rosangela Aparecida Dos Santos; Carvalho, Maria Helena Catelli de; Saraiva, Luciana; Holzhausen, Marinella
2017-01-26
Recent studies investigating protease-activated receptor type 2 (PAR-2) suggest an association between the receptor and periodontal inflammation. It is known that gingipain, a bacterial protease secreted by the important periodontopathogen Porphyromonas gingivalis can activate PAR-2. Previous studies by our group found that PAR-2 is overexpressed in the gingival crevicular fluid (GCF) of patients with moderate chronic periodontitis (MP). The present study aimed at evaluating whether PAR-2 expression is associated with chronic periodontitis severity. GCF samples and clinical parameters, including plaque and bleeding on probing indices, probing pocket depth and clinical attachment level, were collected from the control group (n = 19) at baseline, and from MP patients (n = 19) and severe chronic periodontitis (SP) (n = 19) patients before and 6 weeks after periodontal non-surgical treatment. PAR-2 and gingipain messenger RNA (mRNA) in the GCF of 4 periodontal sites per patient were evaluated by Reverse Transcription Polymerase Chain Reaction (RT-qPCR). PAR-2 and gingipain expressions were greater in periodontitis patients than in control group patients. In addition, the SP group presented increased PAR-2 and gingipain mRNA levels, compared with the MP group. Furthermore, periodontal treatment significantly reduced (p periodontitis. In conclusion, PAR-2 is associated with chronic periodontitis severity and with gingipain levels in the periodontal pocket, thus suggesting that PAR-2 expression in the GCF reflects the severity of destruction during periodontal infection.
Molecular mechanism of bundle formation by the bacterial actin ParM
Energy Technology Data Exchange (ETDEWEB)
Popp, David, E-mail: dpopp@imcb.a-star.edu.sg [ERATO ' Actin Filament Dynamics' Project, Japan Science and Technology Corporation, c/o RIKEN Harima Institute at Spring 8, 1-1-1 Kouto, Sayo, Hyogo 679-5148 (Japan); Institute of Molecular and Cell Biology, 61 Biopolis Drive, Proteos, 138673 Singapore (Singapore); Narita, Akihiro [ERATO ' Actin Filament Dynamics' Project, Japan Science and Technology Corporation, c/o RIKEN Harima Institute at Spring 8, 1-1-1 Kouto, Sayo, Hyogo 679-5148 (Japan); Nagoya University Graduate School of Science, Structural Biology Research Center and Division of Biological Sciences, Furo-cho, Chikusa-ku, Nagoya 464-8601 (Japan); Iwasa, Mitsusada [ERATO ' Actin Filament Dynamics' Project, Japan Science and Technology Corporation, c/o RIKEN Harima Institute at Spring 8, 1-1-1 Kouto, Sayo, Hyogo 679-5148 (Japan); Maeda, Yuichiro [ERATO ' Actin Filament Dynamics' Project, Japan Science and Technology Corporation, c/o RIKEN Harima Institute at Spring 8, 1-1-1 Kouto, Sayo, Hyogo 679-5148 (Japan); Nagoya University Graduate School of Science, Structural Biology Research Center and Division of Biological Sciences, Furo-cho, Chikusa-ku, Nagoya 464-8601 (Japan); Robinson, Robert C. [Institute of Molecular and Cell Biology, 61 Biopolis Drive, Proteos, 138673 Singapore (Singapore)
2010-01-22
The actin homolog ParM plays a microtubule-like role in segregating DNA prior to bacterial cell division. Fluorescence and cryo-electron microscopy have shown that ParM forms filament bundles between separating DNA plasmids in vivo. Given the lack of ParM bundling proteins it remains unknown how ParM bundles form at the molecular level. Here we show using time-lapse TIRF microscopy, under in vitro molecular crowding conditions, that ParM-bundle formation consists of two distinct phases. At the onset of polymerization bundle thickness and shape are determined in the form of nuclei of short helically disordered filaments arranged in a liquid-like lattice. These nuclei then undergo an elongation phase whereby they rapidly increase in length. At steady state, ParM bundles fuse into one single large aggregate. This behavior had been predicted by theory but has not been observed for any other cytomotive biopolymer, including F-actin. We employed electron micrographs of ParM rafts, which are 2-D analogs of 3-D bundles, to identify the main molecular interfilament contacts within these suprastructures. The interface between filaments is similar for both parallel and anti-parallel orientations and the distribution of filament polarity is random within a bundle. We suggest that the interfilament interactions are not due to the interactions of specific residues but rather to long-range, counter ion mediated, electrostatic attractive forces. A randomly oriented bundle ensures that the assembly is rigid and that DNA may be captured with equal efficiency at both ends of the bundle via the ParR binding protein.
2010-04-01
....06 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION EXCHANGE PROCEDURES FOR DISCIPLINARY, SUMMARY, AND MEMBERSHIP DENIAL ACTIONS Disciplinary Procedure § 8.06 Investigations. (a) Each exchange shall establish and maintain a disciplinary procedure which requires the enforcement staff of the...
Energy Technology Data Exchange (ETDEWEB)
Galiev, G. B., E-mail: galiev-galib@mail.ru [Russian Academy of Sciences, Institute of Ultra-High Frequency Semiconductor Electronics (Russian Federation); Grekhov, M. M. [National Research Nuclear University “MEPhI” (Russian Federation); Kitaeva, G. Kh. [Moscow State University, Faculty of Physics (Russian Federation); Klimov, E. A.; Klochkov, A. N. [Russian Academy of Sciences, Institute of Ultra-High Frequency Semiconductor Electronics (Russian Federation); Kolentsova, O. S. [National Research Nuclear University “MEPhI” (Russian Federation); Kornienko, V. V.; Kuznetsov, K. A. [Moscow State University, Faculty of Physics (Russian Federation); Maltsev, P. P.; Pushkarev, S. S. [Russian Academy of Sciences, Institute of Ultra-High Frequency Semiconductor Electronics (Russian Federation)
2017-03-15
The spectrum and waveforms of broadband terahertz-radiation pulses generated by low-temperature In{sub 0.53}Ga{sub 0.47}As epitaxial films under femtosecond laser pumping are investigated by terahertz time-resolved spectroscopy. The In{sub 0.53}Ga{sub 0.47}As films are fabricated by molecular-beam epitaxy at a temperature of 200°C under different arsenic pressures on (100)-oriented InP substrates and, for the first time, on (411)A InP substrates. The surface morphology of the samples is studied by atomic-force microscopy and the structural quality is established by high-resolution X-ray diffraction analysis. It is found that the amplitude of terahertz radiation from the LT-InGaAs layers on the (411)A InP substrates exceeds that from similar layers formed on the (100) InP substrates by a factor of 3–5.
International Nuclear Information System (INIS)
Sato, Renato Cesar
2010-01-01
This research is an exploratory cross-sectional study about the relationship of chronic disease and the use of nuclear technology. There is a concern over the increase of the prevalence of chronic disease in developing countries and it should hence be carefully evaluated in the context of societies, organizations and individuals. The technological advances experienced in the last decades especially in the nuclear technology area have created expectations to deal more efficiently with the challenge of chronic diseases. However little has been explored in this area under the point-of-view of medical doctors as agents who make this system of relations between disease and technology. The necessity for public and private planning to deal with this set of problems can benefit through an initial evaluation about the forthcoming theme, but should incorporate the agenda of health and technology planning for the following years. Using mixed methodology, made up of qualitative and quantitative approach, this research sought to reveal and configure important dimensions around the theme of this study. The field research was made up of interviews analyzed using techniques of fundamental theory and also of questionnaires sent by web analyzed statistically using exploratory factor analysis. These ventures allowed dimensions to be revealed that make up the perception of chronic disease and the use of nuclear technology. These dimensions presented in a form of a theoretical construct that were then discussed under the point of view of social theory and technological innovation. (author)
Par Pond vegetation status Summer 1995 -- October survey descriptive summary
International Nuclear Information System (INIS)
Mackey, H.E. Jr.; Riley, R.S.
1995-11-01
The water level of Par Pond was lowered approximately 20 feet in mid-1991 in order to protect downstream residents from possible dam failure suggested by subsidence on the downstream slope of the dam and to repair the dam. This lowering exposed both emergent and nonemergent macrophyte beds to drying conditions resulting in extensive losses. A survey of the emergent shoreline aquatic plant communities began in June 1995, three months after the refilling of Par Pond to approximately 200 feet above mean sea level and continued with this late October survey. Communities similar to the pre-drawdown Par Pond aquatic plant communities are becoming re-established; especially, beds of maiden cane, lotus, waterlily, and watershield are now extensive and well established. Cattail occurrence continues to increase, but large beds common to Par Pond prior to the drawdown have not formed. Future surveys throughout 1996 and 1997, along with the continued evaluation of satellite data to map the areal extent of the macrophyte beds of Par Pond, are planned
Par Pond vegetation status Summer 1995 -- September survey descriptive summary
International Nuclear Information System (INIS)
Mackey, H.E. Jr.; Riley, R.S.
1995-09-01
The water level of Par Pond was lowered approximately 20 feet in mid-1991 in order to protect downstream residents from possible dam failure suggested by subsidence on the downstream slope of the dam and to repair the dam. This lowering exposed both emergent and nonemergent macrophyte beds to drying conditions resulting in extensive losses. A survey of the emergent shoreline aquatic plant communities began in June 1995, three months after the refilling of Par Pond to approximately 200 feet above mean sea level and continued with this mid-September survey. Communities similar to the pre-drawdown Par Pond aquatic plant communities are becoming re-established; especially, beds of maidencane, lotus, waterlily, and watershield are now extensive and well established. Cattail occurrence continues to increase, but large beds common to Par Pond prior to the drawdown have not formed. Future surveys during the late growing seasons of 1995, and throughout 1996 and 1997, along with the evaluation of satellite data to map the areal extent of the macrophyte beds of Par Pond, are planned
Improved Satellite-based Photosysnthetically Active Radiation (PAR) for Air Quality Studies
Pour Biazar, A.; McNider, R. T.; Cohan, D. S.; White, A.; Zhang, R.; Dornblaser, B.; Doty, K.; Wu, Y.; Estes, M. J.
2015-12-01
One of the challenges in understanding the air quality over forested regions has been the uncertainties in estimating the biogenic hydrocarbon emissions. Biogenic volatile organic compounds, BVOCs, play a critical role in atmospheric chemistry, particularly in ozone and particulate matter (PM) formation. In southeastern United States, BVOCs (mostly as isoprene) are the dominant summertime source of reactive hydrocarbon. Despite significant efforts in improving BVOC estimates, the errors in emission inventories remain a concern. Since BVOC emissions are particularly sensitive to the available photosynthetically active radiation (PAR), model errors in PAR result in large errors in emission estimates. Thus, utilization of satellite observations to estimate PAR can help in reducing emission uncertainties. Satellite-based PAR estimates rely on the technique used to derive insolation from satellite visible brightness measurements. In this study we evaluate several insolation products against surface pyranometer observations and offer a bias correction to generate a more accurate PAR product. The improved PAR product is then used in biogenic emission estimates. The improved biogenic emission estimates are compared to the emission inventories over Texas and used in air quality simulation over the period of August-September 2013 (NASA's Discover-AQ field campaign). A series of sensitivity simulations will be performed and evaluated against Discover-AQ observations to test the impact of satellite-derived PAR on air quality simulations.
SAFARI 2000 PAR Measurements, Kalahari Transect, Botswana, Wet Season 2000
National Aeronautics and Space Administration — Ceptometer data from a Decagon AccuPAR (Model PAR-80) were collected at four sites in Botswana during the SAFARI 2000 Kalahari Transect Wet Season Campaign (March,...
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Reimbursement obligations of primary payers and... Provisions § 411.22 Reimbursement obligations of primary payers and entities that received payment from... reimburse CMS for any payment if it is demonstrated that the primary payer has or had a responsibility to...
Lumbar lordosis and pars interarticularis fractures: a case-control study
International Nuclear Information System (INIS)
Bugg, William G.; Lewis, Mark; Juette, Arne; Cahir, John G.; Toms, Andoni P.
2012-01-01
The aim of this study is to examine the relationship between lumbar lordosis and pars interarticularis fractures. In this retrospective case-control study we compare the angle of lumbar lordosis and the angle of the S1 vertebral endplate (as a measure of pelvic tilt) in patients with bilateral L5 pars interarticularis fractures with age- and sex-matched control cases with normal MRI examinations of the lumbar spine. Twenty-nine cases of bilateral L5 pars interarticularis fractures with matched control-cases were identified on MRI (16 male, 13 female, age 9-63 years). The angle of lordosis was measured between the inferior L4 and superior S1 vertebral endplates on a standing lateral lumbar spine radiograph for both groups. The mean angle of lordosis about the L5 vertebra was 36.9 (SD = 6.5 ) in the pars interarticularis fracture group, and 30.1 (SD = 6.4 ) in the control group. The difference between the two groups was significant (mean difference 6.8 , Student's t test: P < 0.001). The mean angle of sacral tilt measured was 122.2 (SD = 10.16 ) for controls and 136.4 (SD = 10.86 ) for patients with pars defects. The difference in the means of 14.2 was statistically significantly different (P < 0.0001). Sacral tilt represented by a steeply angled superior endplate of S1 is associated with a significantly increased angle of lordosis, between L4 and S1, and pars fractures at L5. Steep angulation of the first sacral vertebral segment maybe the predisposing biomechanical factor that leads to pincer-like impingement of the pars interarticularis and then spondylolysis. (orig.)
Lumbar lordosis and pars interarticularis fractures: a case-control study
Energy Technology Data Exchange (ETDEWEB)
Bugg, William G; Lewis, Mark; Juette, Arne; Cahir, John G; Toms, Andoni P [Cotman Centre, Norwich Radiology Academy, Norwich, Norfolk (United Kingdom)
2012-07-15
The aim of this study is to examine the relationship between lumbar lordosis and pars interarticularis fractures. In this retrospective case-control study we compare the angle of lumbar lordosis and the angle of the S1 vertebral endplate (as a measure of pelvic tilt) in patients with bilateral L5 pars interarticularis fractures with age- and sex-matched control cases with normal MRI examinations of the lumbar spine. Twenty-nine cases of bilateral L5 pars interarticularis fractures with matched control-cases were identified on MRI (16 male, 13 female, age 9-63 years). The angle of lordosis was measured between the inferior L4 and superior S1 vertebral endplates on a standing lateral lumbar spine radiograph for both groups. The mean angle of lordosis about the L5 vertebra was 36.9 (SD = 6.5 ) in the pars interarticularis fracture group, and 30.1 (SD = 6.4 ) in the control group. The difference between the two groups was significant (mean difference 6.8 , Student's t test: P < 0.001). The mean angle of sacral tilt measured was 122.2 (SD = 10.16 ) for controls and 136.4 (SD = 10.86 ) for patients with pars defects. The difference in the means of 14.2 was statistically significantly different (P < 0.0001). Sacral tilt represented by a steeply angled superior endplate of S1 is associated with a significantly increased angle of lordosis, between L4 and S1, and pars fractures at L5. Steep angulation of the first sacral vertebral segment maybe the predisposing biomechanical factor that leads to pincer-like impingement of the pars interarticularis and then spondylolysis. (orig.)
Lumbar lordosis and pars interarticularis fractures: a case-control study
Energy Technology Data Exchange (ETDEWEB)
Bugg, William G.; Lewis, Mark; Juette, Arne; Cahir, John G.; Toms, Andoni P. [Cotman Centre, Norwich Radiology Academy, Norwich, Norfolk (United Kingdom)
2012-07-15
The aim of this study is to examine the relationship between lumbar lordosis and pars interarticularis fractures. In this retrospective case-control study we compare the angle of lumbar lordosis and the angle of the S1 vertebral endplate (as a measure of pelvic tilt) in patients with bilateral L5 pars interarticularis fractures with age- and sex-matched control cases with normal MRI examinations of the lumbar spine. Twenty-nine cases of bilateral L5 pars interarticularis fractures with matched control-cases were identified on MRI (16 male, 13 female, age 9-63 years). The angle of lordosis was measured between the inferior L4 and superior S1 vertebral endplates on a standing lateral lumbar spine radiograph for both groups. The mean angle of lordosis about the L5 vertebra was 36.9 (SD = 6.5 ) in the pars interarticularis fracture group, and 30.1 (SD = 6.4 ) in the control group. The difference between the two groups was significant (mean difference 6.8 , Student's t test: P < 0.001). The mean angle of sacral tilt measured was 122.2 (SD = 10.16 ) for controls and 136.4 (SD = 10.86 ) for patients with pars defects. The difference in the means of 14.2 was statistically significantly different (P < 0.0001). Sacral tilt represented by a steeply angled superior endplate of S1 is associated with a significantly increased angle of lordosis, between L4 and S1, and pars fractures at L5. Steep angulation of the first sacral vertebral segment maybe the predisposing biomechanical factor that leads to pincer-like impingement of the pars interarticularis and then spondylolysis. (orig.)
Croissance epitaxiale de GaAs sur substrats de Ge par epitaxie par faisceaux chimiques
Belanger, Simon
La situation energetique et les enjeux environnementaux auxquels la societe est confrontee entrainent un interet grandissant pour la production d'electricite a partir de l'energie solaire. Parmi les technologies actuellement disponibles, la filiere du photovoltaique a concentrateur solaire (CPV pour concentrator photovoltaics) possede un rendement superieur et mi potentiel interessant a condition que ses couts de production soient competitifs. La methode d'epitaxie par faisceaux chimiques (CBE pour chemical beam epitaxy) possede plusieurs caracteristiques qui la rendent interessante pour la production a grande echelle de cellules photovoltaiques a jonctions multiples a base de semi-conducteurs III-V. Ce type de cellule possede la meilleure efficacite atteinte a ce jour et est utilise sur les satellites et les systemes photovoltaiques a concentrateur solaire (CPV) les plus efficaces. Une des principales forces de la technique CBE se trouve dans son potentiel d'efficacite d'utilisation des materiaux source qui est superieur a celui de la technique d'epitaxie qui est couramment utilisee pour la production a grande echelle de ces cellules. Ce memoire de maitrise presente les travaux effectues dans le but d'evaluer le potentiel de la technique CBE pour realiser la croissance de couches de GaAs sur des substrats de Ge. Cette croissance constitue la premiere etape de fabrication de nombreux modeles de cellules solaires a haute performance decrites plus haut. La realisation de ce projet a necessite le developpement d'un procede de preparation de surface pour les substrats de germanium, la realisation de nombreuses sceances de croissance epitaxiale et la caracterisation des materiaux obtenus par microscopie optique, microscopie a force atomique (AFM), diffraction des rayons-X a haute resolution (HRXRD), microscopie electronique a transmission (TEM), photoluminescence a basse temperature (LTPL) et spectrometrie de masse des ions secondaires (SIMS). Les experiences ont permis
2010-07-01
... AND IMPLEMENTATION OF STATE SOLID WASTE MANAGEMENT PLANS Purpose, General Requirements, Definitions... public (including interstate) solid or hazardous waste management authority, or other public agency below... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Definitions. 256.06 Section 256.06...
Lichtenberg, Frank R; Tatar, Mehtap; Çalışkan, Zafer
2014-09-01
We investigate the impact of pharmaceutical innovation on longevity, hospitalization and medical expenditure in Turkey during the period 1999-2010 using longitudinal, disease-level data. From 1999 to 2008, mean age at death increased by 3.6 years, from 63.0 to 66.6 years. We estimate that in the absence of any pharmaceutical innovation, mean age at death would have increased by only 0.6 years. Hence, pharmaceutical innovation is estimated to have increased mean age at death in Turkey by 3.0 years during the period 1999-2008. We also examine the effect of pharmaceutical innovation on hospital utilization. We estimate that pharmaceutical innovation has reduced the number of hospital days by approximately 1% per year. We use our estimates of the effect of pharmaceutical innovation on age at death, hospital utilization and pharmaceutical expenditure to assess the incremental cost-effectiveness of pharmaceutical innovation, i.e., the cost per life-year gained from the introduction of new drugs. The baseline estimate of the cost per life-year gained from pharmaceutical innovation is $2776. Even the latter figure is a very small fraction of leading economists' estimates of the value of (or consumers' willingness to pay for) a one-year increase in life expectancy. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
Economic Constitution, social democracy, innovation and economic culture of Basque Cooperativism
Directory of Open Access Journals (Sweden)
Santiago Larrazabal Basañez
2009-12-01
Full Text Available In the study of Constitutional Law, the author calls for more attention to be paid to the part in which almost all Constitutions set down economic models, the guiding principles of social and economic policy and economic and social rights. He makes this suggestion with a view to going beyond a formal democracy and moving towards a material democracy. For this purpose, he focuses on the values and economic culture of the cooperative movement and advocates inspiration in these values to innovate and search for a fairer economic and social model which will enable us to overcome the present crisis. Lastly, he poses some issues related to innovation in the specific contextof Basque cooperativism.Received: 06.07.2009Accepted: 08.07.2009
ParTIES: a toolbox for Paramecium interspersed DNA elimination studies.
Denby Wilkes, Cyril; Arnaiz, Olivier; Sperling, Linda
2016-02-15
Developmental DNA elimination occurs in a wide variety of multicellular organisms, but ciliates are the only single-celled eukaryotes in which this phenomenon has been reported. Despite considerable interest in ciliates as models for DNA elimination, no standard methods for identification and characterization of the eliminated sequences are currently available. We present the Paramecium Toolbox for Interspersed DNA Elimination Studies (ParTIES), designed for Paramecium species, that (i) identifies eliminated sequences, (ii) measures their presence in a sequencing sample and (iii) detects rare elimination polymorphisms. ParTIES is multi-threaded Perl software available at https://github.com/oarnaiz/ParTIES. ParTIES is distributed under the GNU General Public Licence v3. © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.
Medical innovation laws: an unnecessary innovation.
Richards, Bernadette
2016-06-01
Objective This paper aims to demonstrate that any suggestion that there is a need for specific innovation laws is flawed. Innovation is central to good medical practice and is adequately supported by current law. Methods The paper reviews the nature of medical innovation and outlines recent attempts in the UK to introduce specific laws aimed at 'encouraging' and 'supporting' innovation. The current legal framework is outlined and the role of the law in relation to medical innovation explored. Results The analysis demonstrates the cyclic relationship between medical advancement and the law and concludes that there is no requirement for specific innovation laws. Conclusions The law not only supports innovation and development in medical treatment but encourages it as central to a functioning medical system. There is no need to introduce specific laws aimed at medical innovation; to do so represents an unnecessary legal innovation and serves to complicate matters. What is known about the topic? Over recent months, there has been a great deal of discussion surrounding the law in the context of medical innovation. This was driven by the attempts in the UK to introduce specific laws in the Medical Innovation Bill. The general subject matter - negligence and the expected standard of care in the provision of treatment - is very well understood, but not in cases where the treatment can be described as innovative. The general rhetoric in both the UK and Australia around the Medical Innovation Bill demonstrates a lack of understanding of the position of the law with regards to innovative treatment. What does this paper add? This paper adds clarity to the debate. It presents the law and explains the manner in which the law can operate around innovative treatment. The paper asserts that medical innovation is both supported and encouraged by existing legal principles. What are the implications for practitioners? The paper presents an argument that can guide the policy position
Effect of simvastatin and ezetimibe on suPAR levels and outcomes
DEFF Research Database (Denmark)
Hodges, Gethin W; Bang, Casper N; Forman, Julie L
2018-01-01
-lowering therapy also lowers suPAR levels is unknown. METHODS: We investigated whether treatment with Simvastatin 40 mg and Ezetimibe 10 mg lowered plasma suPAR levels in 1838 patients with mild-moderate, asymptomatic aortic stenosis, included in the Simvastatin and Ezetimibe in Aortic Stenosis (SEAS) study, using...... and Ezetimibe treatment impeded the progression of the time-related increase in plasma suPAR levels. Year-1 suPAR was associated with all-cause mortality, MCE, and AVE irrespective of baseline levels (SEAS study: NCT00092677)....... cardiovascular events (MCE) composed of ischemic cardiovascular events (ICE) and aortic valve related events (AVE). RESULTS: After 4.3 years of follow-up, suPAR levels had increased by 9.2% (95% confidence interval [CI]: 7.0%-11.5%) in the placebo group, but only by 4.1% (1.9%-6.2%) in the group with lipid...
Impaired exploratory eye movements in children with Asperger's syndrome.
Ohya, Takashi; Morita, Kiichiro; Yamashita, Yushiro; Egami, Chiyomi; Ishii, Youhei; Nagamitsu, Shinichiro; Matsuishi, Toyojiro
2014-03-01
Previous eye-tracking studies using an eye mark recorder have reported that disturbances in exploratory eye movements in adult schizophrenic patients are associated with social functioning. The current study sought to determine whether exploratory eye-movement disturbances are present in children with Asperger's syndrome (AS) compared with typically developing (TD) children. MATERIALS/PARTICIPANTS: The participants were 23 children with AS and 23 age-matched TD children. We measured exploratory eye movements using an EMR-8B eye mark recorder and an exploratory eye movement-measuring device. Eye movements were recorded while participants freely observed a geometric figure (free viewing task), and while they complied with the instructions of an experimenter (repeat-comparison task). We assessed eye fixation points (EFPs) and total eye scanning length (TESL) in all tasks, and measured the responsive search score (RSS) in the repeat-comparison task. In the free viewing task, children with AS exhibited significantly shorter TESL compared with TD children. In the repeat-comparison task, children with AS exhibited significantly lower RSS. Autism Spectrum Screening Questionnaire scores were negatively correlated with both EFP and TESL, but not RSS. The current results revealed that children with AS exhibited dysfunction in exploratory eye movements. Thus, assessing exploratory eye movements in a repeat-comparison task may be useful for detecting social impairment among children with AS. Copyright © 2013 The Japanese Society of Child Neurology. Published by Elsevier B.V. All rights reserved.
Institute of Scientific and Technical Information of China (English)
Yinxing Hong; Yao Lu; Jianghuai Zheng
2017-01-01
In light of the relationship and the current disconnection between science & technology (S&T) innovation and industrial innovation in China,it is necessary to put forward and emphasize the concept of industrialized innovation.Industrialized innovation is the bridge and intermediation between S&T innovation and industrial innovation,which is not only a concept,but also a mechanism and combination force.There are two ways to achieve industrialized innovation:through industry-university-research coordination and through technology entrepreneurship.The meaning of industry-university-research coordination is not about coordination among industry,university and research sectors in an institutional sense;rather it is about the coordination of the functions of cultivation and development in new industries,new technologies,and new talents of industrialized innovation.The incentive mechanism for industrialized innovation should motivate not only innovation but also coordination.Technology entrepreneurship is the industrialization of new technology through business start-ups,which occurs beyond the stage of incubation and development of new technology.The capital of technology entrepreneurship is the set consisting of knowledge capital manifested through technological innovation,human capital manifested through entrepreneurs,and physical capital in the form of venture capital.While physical capital is indispensable,knowledge capital and human capital play the decisive role in technology entrepreneurship.The industrialization of technological innovation involves two requirements:one is to enable the new technology industry to achieve a large scale rapidly,and the other is to fully realize the potential value of the new technology.Both requirements are reliant on effective innovation in business models.
Paracrine Apoptotic Effect of p53 Mediated by Tumor Suppressor Par-4
Directory of Open Access Journals (Sweden)
Ravshan Burikhanov
2014-01-01
Full Text Available The guardian of the genome, p53, is often mutated in cancer and may contribute to therapeutic resistance. Given that p53 is intact and functional in normal tissues, we harnessed its potential to inhibit the growth of p53-deficient cancer cells. Specific activation of p53 in normal fibroblasts selectively induced apoptosis in p53-deficient cancer cells. This paracrine effect was mediated by p53-dependent secretion of the tumor suppressor Par-4. Accordingly, the activation of p53 in normal mice, but not p53−/− or Par-4−/− mice, caused systemic elevation of Par-4, which induced apoptosis of p53-deficient tumor cells. Mechanistically, p53 induced Par-4 secretion by suppressing the expression of its binding partner, UACA, which sequesters Par-4. Thus, normal cells can be empowered by p53 activation to induce Par-4 secretion for the inhibition of therapy-resistant tumors.
Directory of Open Access Journals (Sweden)
Manuel Diaz-Llopis
2010-05-01
Full Text Available Manuel Diaz-Llopis1,2,3, David Salom1,3, Salvador García-Delpech1,2,3, Patricia Udaondo1,3, Jose Maria Millan3,5, J Fernando Arevalo61Department of Ophthalmology, La Fe University Hospital of Valencia, Valencia, Spain; 2Department of Ophthalmology of the Valencia University, Valencia, Spain; 3Biomedical Network Research Centre on Rare Diseases (CIBERER, Valencia, Spain; 4Catholic University San Vicente Martir, Valencia, Spain; 5Department of Genetics, La Fe University Hospital of Valencia, Valencia, Spain; 6Clinica Oftalmologica Centro Caracas, Retina and VItreous Service, Caracas, DC, VenezuelaPurpose: To evaluate the efficacy and safety of the pars plana clip (PPC in the Ahmed valve tube inserted via the pars plana in patients with secondary refractory glaucomas.Methods: Prospective and interventional case series that included 10 patients with secondary refractory glaucoma. The pars plana vitrectomy and the implant of the modified tube were performed during the same surgery. Control of intraocular pressure (IOP and the development of intra- and postoperative complications were evaluated during the follow-up.Results: Follow-up time was twelve months in all the patients. Control of IOP was achieved in 90% of patients, and 70% needed no antiglaucoma treatment. The complications that occurred were transient hypotony in three cases, choroidal detachment in two cases, and one case of intraocular hemorrhage. No case of tube extrusion or tube kink was observed.Conclusions: Our data suggests that implantation of the Ahmed tube modified with the PPC via the pars plana is safe and effective in patients with secondary refractory glaucomas. Keywords: pars plana clip, Ahmed valve, refractory glaucoma, pars plana vitrectomy
Exploratory shaft conceptual design report: Permian Basin
International Nuclear Information System (INIS)
1983-07-01
This conceptual design report summarizes the conceptualized design for an exploratory shaft facility at a representative site in the Permian Basin locatd in the western part of Texas. Conceptualized designs for other possible locations (Paradox Basin in Utah and Gulf Interior Region salt domes in Louisiana and Mississippi) are summarized in separate reports. The purpose of the exploratory shaft facility is to provide access to the reference repository horizon to permit in situ testing of the salt. The in situ testing is necessary to verify repository salt design parameters, evaluate isotropy and homogeneity of the salt, and provide a demonstration of the constructability and confirmation of the design to gain access to the repository. The fundamental purpose of this conceptual design report is to assure the feasibility of the exploratory shaft project and to develop a reliable cost estimate and realistic schedule. Because a site has not been selected and site-specific subsurface data are not available, it has been necessary to make certain assumptions in order to develop a conceptual design for an exploratory shaft facility in salt. As more definitive information becomes available to support the design process, adjustments in the projected schedule and estimated costs will be required
Exploratory shaft conceptual design report: Paradox Basin
International Nuclear Information System (INIS)
1983-07-01
This conceptual design report summarizes the conceptualized design for an exploratory shaft facility at a representative site in the Paradox Basin located in the southeastern part of Utah. Conceptualized designs for other possible locations (Permian Basin in Texas and Gulf Interior Region salt domes in Louisiana and Mississippi) are summarized in separate reports. The purpose of the exploratory shaft facility is to provide access to the reference repository horizon to permit in situ testing of the salt. The in-situ testing is necessary to verify repository salt design parameters, evaluate isotropy and homogeneity of the salt, and provide a demonstration of the constructability and confirmation of the design to gain access to the repository. The fundamental purpose of this conceptual design report is to assure the feasibility of the exploratory shaft project and to develop a reliable cost estimate and realistic schedule. Because a site has not been selected and site-specific subsurface data are not available, it has been necessary to make certain assumptions in order to develop a conceptual design for an exploratory shaft facility in salt. As more definitive information becomes available to support the design process, adjustments in the projected schedule and estimated costs will be required
Ps.Plutarch/Aëtius Plac. 4.11. Some comments on sensation and concept formation in Stoic Thought
Mansfeld, J
2014-01-01
Ps.Plutarch Plac. ch. 4.11 is an abridged Aëtian chapter. Material that has been cut can be identified. In its original shape the chapter not only provided information on the perception of external objects but also, presumably, on inner perception, i.e. self-awareness. The mind of the newborn infant
Innover en illustration jeunesse : les focalisations
Directory of Open Access Journals (Sweden)
Anne Guibert-Lassalle
2010-09-01
Full Text Available L’activité éditoriale pour la jeunesse est caractérisée en France depuis 1990 par une très forte multiplication du nombre d’acteurs et un accroissement constant du nombre de publications. L’innovation est considérée comme la principale voie de survie. Ces enjeux culturels et économiques contribuent à promouvoir l’originalité de l’illustration. Pourtant le succès commercial ne couronne pas toujours les inventions graphiques. Une enquête sur l’émergence, dans les années 2000, d’une tendance porteuse, fondée sur un usage nouveau des focalisations, révèle le caractère intuitif, étroitement daté et collaboratif, de l’innovation en illustration pour la jeunesse.Innovating in illustration for the youth: the focalisationsSince 1990, publishing for the youth in France is a sector of activity where the number of actors and items produced has been constantly increased. Innovation is considered as the main way for survival. These cultural and economical stakes tend to promote originality in illustration. Since, commercial profit does not always reward graphic inventiveness. A sociological enquiry upon the emerging in the 2000’ of a successful trend, based on a fresh use of focalisations, reveals how intuitive, strictly dated and joint can be innovating in illustration for the youth.La innovación en las revistas ilustradas para jóvenes. La focalizaciónLa actividad editorial para la juventud se ha caracterizado en Francia desde 1990 por un fuerte aumento de agentes y por un crecimiento constante del número de publicaciones. La innovación es la vía esencial para sobrevivir. Las apuestas culturales y económicas contribuyen a promover la originalidad de las ilustraciones. Sin embargo el éxito comercial no siempre subraya la originalidad de estas. A principios de este siglo, una encuesta acerca de la emergencia de una tendencia prometedora, basada en una manera diferente de efectuar las focalizaciones, ha revelado el
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI06Q.Seq.d/ Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in
Effects of solar PAR and UV radiation on tropical biofouling communities
Dobretsov, SV
2010-03-08
We investigated the effect of solar ultraviolet radiation (UVR) and photosynthetically active radiation (PAR) on the development of tropical micro- and macrofouling communities for 30 d. The experimental design involved 3 treatments: full spectrum (PAR+UVR), PAR only, and minimal light (reduced PAR and UVR). Terminal restriction fragment length polymorphism analysis demonstrated that different light conditions resulted in the formation of highly different microbial communities. The lowest densities of bacteria were found under the full spectrum treatment, while the lowest densities of diatoms were found in the minimal light treatment. Macrofouling communities consisted of 13 species and differed among light treatments. In the presence of UVR, communities had low species diversity, evenness, and richness, while in minimal light and PAR treatments, communities had high species diversity, evenness, and richness. Similarity percentage (SIMPER) analysis revealed that the tubeworm Hydroides elegans, the alga Ulva (Enteromorpha) sp., and the bivalve Perna viridis were the species responsible for most of the dissimilarities in macrofouling communities among treatments. While densities of H. elegans were similar in the PAR and minimal light treatments, this polychaete had higher growth rates under minimal light conditions. We conclude that UVR and PAR directly control the development of shallow micro- and macrofouling communities by inhibiting the recruitment and growth of sensitive species and promoting the growth of resistant species, but also that these forms of solar radiation influence the surface cues available to competent larvae by altering the development of the microbial community.
Paternal age related schizophrenia (PARS): Latent subgroups detected by k-means clustering analysis.
Lee, Hyejoo; Malaspina, Dolores; Ahn, Hongshik; Perrin, Mary; Opler, Mark G; Kleinhaus, Karine; Harlap, Susan; Goetz, Raymond; Antonius, Daniel
2011-05-01
Paternal age related schizophrenia (PARS) has been proposed as a subgroup of schizophrenia with distinct etiology, pathophysiology and symptoms. This study uses a k-means clustering analysis approach to generate hypotheses about differences between PARS and other cases of schizophrenia. We studied PARS (operationally defined as not having any family history of schizophrenia among first and second-degree relatives and fathers' age at birth ≥ 35 years) in a series of schizophrenia cases recruited from a research unit. Data were available on demographic variables, symptoms (Positive and Negative Syndrome Scale; PANSS), cognitive tests (Wechsler Adult Intelligence Scale-Revised; WAIS-R) and olfaction (University of Pennsylvania Smell Identification Test; UPSIT). We conducted a series of k-means clustering analyses to identify clusters of cases containing high concentrations of PARS. Two analyses generated clusters with high concentrations of PARS cases. The first analysis (N=136; PARS=34) revealed a cluster containing 83% PARS cases, in which the patients showed a significant discrepancy between verbal and performance intelligence. The mean paternal and maternal ages were 41 and 33, respectively. The second analysis (N=123; PARS=30) revealed a cluster containing 71% PARS cases, of which 93% were females; the mean age of onset of psychosis, at 17.2, was significantly early. These results strengthen the evidence that PARS cases differ from other patients with schizophrenia. Hypothesis-generating findings suggest that features of PARS may include a discrepancy between verbal and performance intelligence, and in females, an early age of onset. These findings provide a rationale for separating these phenotypes from others in future clinical, genetic and pathophysiologic studies of schizophrenia and in considering responses to treatment. Copyright © 2011 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Rogge, Karoline S.; Hoffmann, Volker H.
2010-01-01
This paper provides an overview of early changes in the sectoral innovation system for power generation technologies which have been triggered by the European Emission Trading System (EU ETS). Based on a broad definition of the sector, our research analyses the impact of the EU ETS on the four building blocks 'knowledge and technologies', 'actors and networks', 'institutions', and 'demand' by combining two streams of literature, namely systems of innovation and environmental economics. Our analysis for Germany is based on 42 exploratory interviews with experts in the field of the EU ETS, the power sector, and technological innovation. We find that the EU ETS mainly affects the rate and direction of technological change of power generation technologies within the large-scale, coal-based power generation technological regime, to which carbon capture technologies are added as a new technological trajectory. While this impact can be interpreted as the defensive behaviour of incumbents, the observed changes should not be underestimated. We argue that the EU ETS' impact on corporate CO 2 culture and routines may prepare the ground for the transition to a low-carbon sectoral innovation system for power generation technologies.
Par Pond vegetation status Summer 1995 -- June survey descriptive summary
International Nuclear Information System (INIS)
Mackey, H.E. Jr.; Riley, R.S.
1995-06-01
The water level of Par Pond was lowered approximately 20 feet in mid-1991 in order to protect downstream residents from possible dam failure suggested by subsidence on the downstream slope of the dam and to repair the dam. This lowering exposed both emergent and nonemergent macrophyte beds to drying conditions resulting in extensive losses. A survey of the shoreline aquatic plant communities in June 1995, three months after the refilling of Par Pond to approximately 200 feet above mean sea level, indicated that much of the original plant communities and the intermediate shoreline communities present on the exposed sediments have been lost. The extensive old-field and emergent marsh communities that were present on the exposed shoreline during the drawdown have been flooded and much of the pre-drawdown Par Pond aquatic plant communities have not had sufficient time for re-establishment. The shoreline does, however, have extensive beds of maidencane which extend from the shoreline margin to areas as deep as 2 and perhaps 3 meters. Scattered individual plants of lotus and watershield are common and may indicate likely directions of future wetland development in Par Pond. In addition, within isolated coves, which apparently received ground water seepage and/or stream surface flows during the period of the Par Pond draw down, extensive beds of waterlilies and spike rush are common. Invasion of willow and red maple occurred along the lake shoreline as well. Although not absent from this survey, evidence of the extensive redevelopment of the large cattail and eel grass beds was not observed in this first survey of Par Pond. Future surveys during the growing seasons of 1995, 1996, and 1997 along with the evaluation of satellite date to map the areal extent of the macrophyte beds of Par Pond are planned
Mathisen, Gro Ellen; Einarsen, Ståle; Jørstad, Kari; Brønnick, Kolbjørn S
2004-11-01
The present study assessed the psychometric properties and the validity of the Norwegian translation of the Team Climate Inventory (TCI). The TCI is a measure of climate for innovation within groups at work and is based on the four-factor theory of climate for innovation (West, 1990). Cronbach's alpha revealed satisfactory reliabilities and exploratory factor analysis successfully extracted the four original factors as well as a fifth factor that has also been reported in other studies (N = 195 teams from a wide range of professions). Results from confirmatory factor analysis, using a different sample (N = 106 teams from the Norwegian public postal service), suggested that the five-factor solution had the most parsimonious fit. Criterion validity was explored by correlating TCI scores from 92 post offices and 395 postal distribution teams with customer satisfaction scores. Significant positive relationships were found between three of four TCI scales and customer satisfaction.
PROJECT - RESOURCE MANAGEMENT OF INNOVATIONS IN EDUCATION: ANTHROPOLOGICAL PROJECTION
Directory of Open Access Journals (Sweden)
Galina Aleksandrovna Ignat’eva
2015-08-01
Full Text Available The purpose of the research was to denote a way to solve the problem of education mana-gement ΄s insufficient efficiency considered from the point of view of education opportunities to influence on the formation of mechanisms for sustainable development of society as a whole and its educational component. The concept «project-resource management of innovation in education» regarded on the basis of the anthropological project-transforming paradigm. Conceptually-categorical context presented by conceptual cluster composed of coordinated concepts «project», «resource», «educational reality», «organizational-resource potential», «project commonality». In the theoretical part of the study on the basis of analysis of the normative and exploratory approaches to educational innovations organization and management it was established the search approach ΄s leading role in the methodological substantiation of project-resource management. The study have indicated that in the presence of variable models of innovation management in education, corresponding to various predictive models of continuing education post-industrial society, project-resource management is an universal mechanism for the transition from separate innovation΄s precedents to the an authentic reality of innovative education. In the technological part of the study the main concern was to submit the project-resource management by the management goal’s system, each of which includes the specific management actions, projected results and the organizational forms. The project-resource management ΄s professional – activity context of the study showed evolution of managerial positions: an effective performer – an effective leader – strategist, implemented during the transition from directly directive management to the project management and further to the project-resource management. Based on the findings identified the key factors of initiatively-problem projects
[Ambroise Paré, his death and his historians].
Dumaître, P
2001-01-01
Ambroise Paré died December the 20th., 1590. What happened after his death and what are we knowing about his life? Never forgotten, though a lack of care, we were waiting till the XIXth. century to get recollection upon a subject sustained only by accounts of his travels. After Percy, a surgeon who tried to write Paré's biography through the "Biographie universelle ancienne et moderne, de Michaud (1822)" and some second rank authors, Malgaigne is the first who inside a printing of the "Oeuvres complétes de Paré (1840-41)" has a fine look upon the question, though his work is incomplete and allows many mistakes. Doctors Chéreau and Jal, an historian, analysing civil status records, gave new information enlarged by doctors Le Paulmier, Turner and the U.S. native Janet Doe.
20 CFR 411.551 - How are EN payments calculated for transition cases pending on July 21, 2008?
2010-04-01
... these rules (work in three months with gross earnings in each of these months equal to a trial work... subtract the total dollar amount already paid from the total value of the ticket under the new rules for... ADMINISTRATION THE TICKET TO WORK AND SELF-SUFFICIENCY PROGRAM Employment Network Payment Systems § 411.551 How...
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Delegations. 15.06 Section 15... § 15.06 Delegations. (a) The Commission hereby delegates, until the Commission orders otherwise, the... Director of the Division of Market Oversight, to be exercised by such Director or by such other employee or...
Where are All the Female Innovators? Nurses as Innovators in a Public Sector Innovation
Directory of Open Access Journals (Sweden)
Johanna Nählinder
2010-03-01
Full Text Available The field of innovation does not see the innovator and is therefore gender-blind. Still, there is an implicit understanding of who is innovative, and this understanding includes gender and profession of the innovator. The female nurse is not seen as innovative and few innovation policies target her. The lack of innovativeness is due to many factors and two of these are tested empirically in this article: that women work in professions which are not associated with innovation and that women lack confidence to carry out innovative work. The empirical investigation presents evidence in line with both hypothesis and also notes that men and women ends their innovative efforts for different reasons. Therefore, innovation policy targeting these groups mobilises otherwise dormant potential innovators.
DEFF Research Database (Denmark)
Ebersbach, G.; Gerdes, Kenn
2004-01-01
The par2 locus of Escherichia coli plasmid pB171 encodes oscillating ATPase ParA, DNA binding protein ParB and two cis-acting DNA regions to which ParB binds (parC1 and parC2). Three independent techniques were used to investigate the subcellular localization of plasmids carrying par2. In cells......A-GFP oscillated in spiral-shaped structures. Amino acid substitutions in ParA simultaneously abolished ParA spiral formation, oscillation and either plasmid localization or plasmid separation at mid-cell. Therefore, our results suggest that ParA spirals position plasmids at the middle of the bacterial nucleoid...
DEFF Research Database (Denmark)
Harste, Gorm
2009-01-01
, at innovation af innovationen forsøges gennemført på en måde, hvor tiden kræves at forholde sig til sin egen tidslighed i form af fremtid, nutid, fortid og ikke mindst i form af samtidighed. I tiden skal vi iagttage, hvordan vi iagttager tiden. Vi dobbelt-koder tiden på samme måde, som forskning forsker i...... organisationssystemerne. De to typer systemer kan noget helt bestemt med fænomenet tid. De kan synkronisere. Analyseres organisationssystemer ser vi, imidlertid at innovation kræver ro. Stærkt innovative systemer er militærsystemet og kunstsystemet, der også inddrages, og hvor vi ser paradokset mellem innovation og...... involution. Tid er med et medium og ikke et lufttomt rum. Tid er end ikke en gasart, men udgør et solidt fluidum, som samfundet bader i og flyder i, konstant i bevægelse. Reformer forudsætter former, og innovation forudsætter involution. Kun sådan muliggøres evolution....
Directory of Open Access Journals (Sweden)
Andréa Cristina Fermiano Fidelis
2017-03-01
Full Text Available The growth of health structures and their complexity have led Clinical Engineering professionals to carry out studies to develop and implement health technology management programs. In this way, employees of this area, integrated with the health system teams, have contributed to make feasible the use of technologies that offer greater security, functionality and reliability. The radiotherapy area, with the increase in the incidence of new cases of cancer, together with the contingency of the financial resources for health, high cost and complexity of the equipment, motivate studies for its adequate management. This research aimed to identify the technologies applied in the radiotherapy treatment, in particular the linear accelerator, as well as the concept of innovation, innovation in services, innovation in processes and the competitiveness acquired with the aid of innovation. The method used in the research has a qualitative approach, with an exploratory and descriptive objective, with semistructured and open questions and involved bibliographic research on the topic of Innovation and on Linear Accelerator, document analysis, Unit of High Complexity in Oncology visit and interviews at the General Hospital of Caxias do Sul South, presenting, finally, the impacts suffered in the hospital and in the community after the arrival of the Line Accelerator. The results showed that there was process and product innovation, incrementally, in the services offered by the hospital.
TMS suppression of right pars triangularis, but not pars opercularis, improves naming in aphasia
Naeser, Margaret A.; Martin, Paula I.; Theoret, Hugo; Kobayashi, Masahito; Fregni, Felipe; Nicholas, Marjorie; Tormos, Jose M.; Steven, Megan S.; Baker, Errol H.; Pascual-Leone, Alvaro
2011-01-01
This study sought to discover if an optimum 1 cm2 area in the non-damaged right hemisphere (RH) was present, which could temporarily improve naming in chronic, nonfluent aphasia patients when suppressed with repetitive transcranial magnetic stimulation (rTMS). Ten minutes of slow, 1 Hz rTMS was applied to suppress different RH ROIs in eight aphasia cases. Picture naming and response time (RT) were examined before, and immediately after rTMS. In aphasia patients, suppression of right pars triangularis (PTr) led to significant increase in pictures named, and significant decrease in RT. Suppression of right pars opercularis (POp), however, led to significant increase in RT, but no change in number of pictures named. Eight normals named all pictures correctly; similar to aphasia patients, RT significantly decreased following rTMS to suppress right PTr, versus right POp. Differential effects following suppression of right PTr versus right POp suggest different functional roles for these regions. PMID:21864891
International Nuclear Information System (INIS)
Gianoulakis, C.; Seidah, N.G.; Routhier, R.; Chretien, M.
1980-01-01
Rats pars intermedia cells were incubated for 3 h with the following amino-acids: a) 35 S-methionine and 3 H-phenylalamine; b) 3 H-valine; and c) 3 H-valine and 3 H-lysine. Radioactive gamma-lipotropin, beta-lipotropin and beta-endorphin were purified on carboxy- methyl-cellulose and characterized by polyacrylamide disc gel electrophoresis af pH 4.5, molecular weight estimation and microsequencing. Rat gamma-lipotropin was shown to differ slightly from ovine gamma-lipotropin in its NH 2 -terminal amino acid sequence, in containing no methionine and having phenylalanine at position 6, valine at positions 13 and 27, and lysine at position 20. The same variations were observed in the sequence of rat beta-lipotropin, while rat beta-endorphin was shown to be identical to the ovine beta-endorphin. Following a 3-h pulse of rat pars distalis, the cells were extracted with care to avoid beta-lipotropin degradation by proteolytic enzymes. A peptide was purified and identified to be rat beta-endorphin, thus demonstrating that beta-endorphin is biosynthesized in pars distalis and is not an extraction artifact. (author)
Energy Technology Data Exchange (ETDEWEB)
Southern Company Services, Inc.
2003-08-01
This report discusses test campaign TC06 of the Kellogg Brown & Root, Inc. (KBR) Transport Reactor train with a Siemens Westinghouse Power Corporation (Siemens Westinghouse) particle filter system at the Power Systems Development Facility (PSDF) located in Wilsonville, Alabama. The Transport Reactor is an advanced circulating fluidized-bed reactor designed to operate as either a combustor or a gasifier using a particulate control device (PCD). The Transport Reactor was operated as a pressurized gasifier during TC06. Test run TC06 was started on July 4, 2001, and completed on September 24, 2001, with an interruption in service between July 25, 2001, and August 19, 2001, due to a filter element failure in the PCD caused by abnormal operating conditions while tuning the main air compressor. The reactor temperature was varied between 1,725 and 1,825 F at pressures from 190 to 230 psig. In TC06, 1,214 hours of solid circulation and 1,025 hours of coal feed were attained with 797 hours of coal feed after the filter element failure. Both reactor and PCD operations were stable during the test run with a stable baseline pressure drop. Due to its length and stability, the TC06 test run provided valuable data necessary to analyze long-term reactor operations and to identify necessary modifications to improve equipment and process performance as well as progressing the goal of many thousands of hours of filter element exposure.
Koelbl, Philipp Simon; Koch, Frank H. J.; Lingenfelder, Christian; Hessling, Martin
2018-02-01
The illumination of the intraocular space during pars plana vitrectomy always bears the risk of retina damage by irradiation. Conventional illumination systems consist of an external light source and an optical fiber to transfer the visible light (radiation) into the eye. Often xenon arc and halogen lamps are employed for this application with some disadvantageous properties like high phototoxicity and low efficiency. Therefore, we propose to generate the light directly within the eye by inserting a white micro LED with a diameter of 0.6 mm. The LED offers a luminous flux of 0.6 lm of white light with a blue peak @ 450 nm and a yellow peak @ 555 nm. The presented prototypes fit through a standard 23 G trocar and are the first intraocular light sources worldwide. Two different single-use approaches have already been developed: a handguided and a chandelier device. The hand-guided applicator enables a directly navigation and illumination up to a working distance of 6 mm. The chandelier device is much smaller and does not need an active navigation of the light cone. The brightness and homogeneity of the illumination of these LED devices have been successfully tested on porcine eyes. Presented measurements and calculations prove that even for high LED currents and small distances to the retina these intraocular micro LED devices expose the retina to less hazard than conventional illumination sources like fiber based xenon systems. Even under the worst circumstances application durations of 180 hours would be justifiable.
20 CFR 411.410 - Does each referral from an EN to a State VR agency require its own agreement?
2010-04-01
... agency for services, although an EN and a State VR agency may want to enter into an individualized agreement to meet the needs of a single beneficiary. ...' Participation Agreements Between Employment Networks and State Vr Agencies § 411.410 Does each referral from an...
Directory of Open Access Journals (Sweden)
Xiang Xu
Full Text Available The urokinase plasminogen activator receptor (uPAR plays a role in tumor progression and has been proposed as a target for the treatment of cancer. We recently described the development of a novel humanized monoclonal antibody that targets uPAR and has anti-tumor activity in multiple xenograft animal tumor models. This antibody, ATN-658, does not inhibit ligand binding (i.e. uPA and vitronectin to uPAR and its mechanism of action remains unclear. As a first step in understanding the anti-tumor activity of ATN-658, we set out to identify the epitope on uPAR to which ATN-658 binds. Guided by comparisons between primate and human uPAR, epitope mapping studies were performed using several orthogonal techniques. Systematic site directed and alanine scanning mutagenesis identified the region of aa 268-275 of uPAR as the epitope for ATN-658. No known function has previously been attributed to this epitope Structural insights into epitope recognition were obtained from structural studies of the Fab fragment of ATN-658 bound to uPAR. The structure shows that the ATN-658 binds to the DIII domain of uPAR, close to the C-terminus of the receptor, corroborating the epitope mapping results. Intriguingly, when bound to uPAR, the complementarity determining region (CDR regions of ATN-658 closely mimic the binding regions of the integrin CD11b (αM, a previously identified uPAR ligand thought to be involved in leukocyte rolling, migration and complement fixation with no known role in tumor progression of solid tumors. These studies reveal a new functional epitope on uPAR involved in tumor progression and demonstrate a previously unrecognized strategy for the therapeutic targeting of uPAR.
The protein kinase SIK downregulates the polarity protein Par3
DEFF Research Database (Denmark)
Vanlandewijck, Michael; Dadras, Mahsa Shahidi; Lomnytska, Marta
2018-01-01
on Par3. Functionally, this mechanism impacts on tight junction downregulation. Furthermore, SIK contributes to the loss of epithelial polarity and examination of advanced and invasive human cancers of diverse origin displayed high levels of SIK expression and a corresponding low expression of Par3...
DEFF Research Database (Denmark)
Nielsen, Janni; Yaganeh, Suzanne; Bloch Rasmussen, Leif
2013-01-01
This paper contributes to a theoretical discussion of creation of innovation with participants in, or outside, organisations. We address the creation of innovation with a complex theoretical understanding drawing on the Scandinavian and the Participatory Design tradition introducing two approaches...... to the processes of innovation. We ask if innovation can be initiated and enhanced looking at two collaborative approaches; participatory innovation (PIN) and cooperative innovation (COIN). We invite to dialogue and reflections on PIN’s conflict and creative frictions on one side and COIN’s complexity......, complementarity in diversity and the didactic scaffolding of the innovation process on the other side. Our contribution focuses on the methods and practices for facilitation of co-creating activities between different groups leading to cooperation, and innovation in thinking....
PET imaging of urokinase-type plasminogen activator receptor (uPAR) in prostate cancer
DEFF Research Database (Denmark)
Skovgaard, Dorthe; Persson, Morten; Kjaer, Andreas
2016-01-01
Overexpression of urokinase-type plasminogen activator receptors (uPAR) represents an important biomarker for aggressiveness in most common malignant diseases, including prostate cancer (PC). Accordingly, uPAR expression either assessed directly in malignant PC tissue or assessed directly in plasma...... and prognostic imaging method. In this review, we will focus on the recent development of uPAR PET and the relevance within prostate cancer imaging. Novel antibody and small-molecule radiotracers-targeting uPAR, including a series of uPAR-targeting PET ligands, based on the high affinity peptide ligand AE105......, have been synthesized and tested in vitro and in vivo in preclinical murine xenograft models and, recently, in a first-ever clinical uPAR PET study in cancer patients, including patients with PC. In this phase I study, a high and specific uptake of the tracer 64Cu-DOTA-AE105 was found in both primary...
Exploratory multivariate analysis by example using R
Husson, Francois; Pages, Jerome
2010-01-01
Full of real-world case studies and practical advice, Exploratory Multivariate Analysis by Example Using R focuses on four fundamental methods of multivariate exploratory data analysis that are most suitable for applications. It covers principal component analysis (PCA) when variables are quantitative, correspondence analysis (CA) and multiple correspondence analysis (MCA) when variables are categorical, and hierarchical cluster analysis.The authors take a geometric point of view that provides a unified vision for exploring multivariate data tables. Within this framework, they present the prin
Exploratory Bi-factor Analysis: The Oblique Case
Jennrich, Robert L.; Bentler, Peter M.
2011-01-01
Bi-factor analysis is a form of confirmatory factor analysis originally introduced by Holzinger and Swineford (1937). The bi-factor model has a general factor, a number of group factors, and an explicit bi-factor structure. Jennrich and Bentler (2011) introduced an exploratory form of bi-factor analysis that does not require one to provide an explicit bi-factor structure a priori. They use exploratory factor analysis and a bi-factor rotation criterion designed to produce a rotated loading mat...
Directory of Open Access Journals (Sweden)
Marian E. Raley
2016-04-01
Full Text Available Food technology innovation has the potential to deliver many benefits to society, although some technologies have been problematic in terms of public acceptance. In promoting the commercial success of innovative technological processes and resultant products it will be important to incorporate information relating to consumer preferences and concerns during their development. The barriers to the utilisation of consumer information during technological development was explored using a two round Delphi study involving 75 experts with an interest in new food technology (food technologists and consumer scientists. There was overall agreement that consumer information should be used in technology implementation and product design, and that good communication between key actors at pivotal stages during the development of new food technologies and products was important. However disciplinary differences were perceived to be a barrier to communication, as were difficulties associated with producing consumer information usable by food technologists. A strategy to improve inter-disciplinary communication is proposed, involving the creation of multi-disciplinary teams working together throughout the development project’s duration, including those with interdisciplinary experience. Deficiencies in the specification of the information required from consumer scientists need to be overcome. Consumer science results need to be concrete and presented as salient to and usable by food technologists.
Par3L enhances colorectal cancer cell survival by inhibiting Lkb1/AMPK signaling pathway
International Nuclear Information System (INIS)
Li, Taiyuan; Liu, Dongning; Lei, Xiong; Jiang, Qunguang
2017-01-01
Partitioning defective 3-like protein (Par3L) is a recently identified cell polarity protein that plays an important role in mammary stem cell maintenance. Previously, we showed that high expression of Par3L is associated with poor survival in malignant colorectal cancer (CRC), but the underlying mechanism remained unknown. To this end, we established a Par3L knockout colorectal cancer cell line using the CRISPR/Cas system. Interestingly, reduced proliferation, enhanced cell death and caspase-3 activation were observed in Par3L knockout (KO) cells as compared with wildtype (WT) cells. Consistent with previous studies, we showed that Par3L interacts with a tumor suppressor protein liver kinase B1 (Lkb1). Moreover, Par3L depletion resulted in abnormal activation of Lkb1/AMPK signaling cascade. Knockdown of Lkb1 in these cells could significantly reduce AMPK activity and partially rescue cell death caused by Par3L knockdown. Furthermore, we showed that Par3L KO cells were more sensitive to chemotherapies and irradiation. Together, these results suggest that Par3L is essential for colorectal cancer cell survival by inhibiting Lkb1/AMPK signaling pathway, and is a putative therapeutic target for CRC. - Highlights: • Par3L knockout using the CRISPR/Cas system induces apoptosis in colorectal cancer cells. • Par3L interacts with Lkb1 and regulates the activity of AMPK signaling cascade. • Par3L knockout cells are more sensitive to treatment of different chemotherapy drugs and irradiation.
Innovative sludge pretreatment technology for impurity separation using micromesh.
Mei, Xiaojie; Han, Xiaomeng; Zang, Lili; Wu, Zhichao
2018-05-23
In order to reduce the impacts on sludge treatment facilities caused by impurities such as fibers, hairs, plastic debris, and coarse sand, an innovative primary sludge pretreatment technology, sludge impurity separator (SIS), was proposed in this study. Non-woven micromesh with pore size of 0.40 mm was used to remove the impurities from primary sludge. Results of lab-scale tests showed that impurity concentration, aeration intensity, and channel gap were the key operation parameters, of which the optimized values were below 25 g/L, 0.8 m 3 /(m 2 min), and 2.5 cm, respectively. In the full-scale SIS with treatment capacity of 300 m 3 /day, over 88% of impurities could be removed from influent and the cleaning cycle of micromesh was more than 16 days. Economic analysis revealed that the average energy consumption was 1.06 kWh/m 3 treated sludge and operation cost was 0.6 yuan/m 3 treated sludge.
Profils des enfants infectes par le vih en debut du traitement ...
African Journals Online (AJOL)
But : Décrire les profils des enfants infectés par le VIH au début du traitement antirétroviral. Matériels et méthode: Les dossiers des enfants infectés par le VIH dans la région maritime ont été analysés de mai 2008 à février 2010 par le comité thérapeutique. Résultats: Parmi les 96 dossiers analysés, 66,67% venaient du ...
From Innovation Community to Community Innovation User-initiated Innovation in Wireless Leiden
van Oost, Elizabeth C.J.; Verhaegh, Stefan; Oudshoorn, Nelly E.J.
2009-01-01
The role of users in innovation processes has gained increasing attention in innovation studies, technology studies, and media studies. Scholars have identified users and use practices as a source of innovation. So far, however, little insight has been generated in innovation processes in which
Brief communication: Population variation in human maxillary premolar accessory ridges (MxPAR).
Burnett, Scott E; Hawkey, Diane E; Turner, Christy G
2010-02-01
The purpose of this brief communication is to report the results of an analysis of maxillary premolar accessory ridges (MxPAR), a common but understudied accessory ridge that may occur both mesial and distal to the central ridge of the buccal cusp of upper premolars. We developed a new five-grade scoring plaque to better categorize MxPAR variation. Subsequently, we conducted a population analysis of MxPAR frequency in 749 dental casts of South African Indian, American Chinese, Alaskan Eskimo, Tohono O'odham (Papago), Akimel O'odham (Pima), Solomon Islander, South African Bantu, and both American and South African Whites. Northeast Asian and Asian-derived populations exhibited the highest MxPAR frequencies while Indo-European samples (South African Indians, American and South African Whites) exhibited relatively low frequencies. The Solomon Islanders and South African Bantu samples exhibited intermediate frequencies. Our analysis indicates that statistically significant differences in MxPAR frequency exist between major geographic populations. As a result, the MxPAR plaque has now been added to the Arizona State University Dental Anthropology System, an important contribution as maxillary premolar traits are underrepresented in analyses of dental morphology. 2009 Wiley-Liss, Inc.
Directory of Open Access Journals (Sweden)
Jerry Haar
2009-10-01
Full Text Available Cet article s’attache à mettre en évidence le lien entre innovation, entreprenariat et développement de réseaux d’entreprises au sein de pôles régionaux. L’innovation y est ainsi abordée à la fois dans sa relation avec l’entreprenariat et dans sa dimension géographique. L’accent est plus particulièrement mis sur les facteurs et les forces qui alimentent l’innovation dans un secteur d’activité dont l’importance va croissant, celui des biotechnologies. L’exemple de trois pôles régionaux, respectivement situés autour de la Baie de San Francisco, à Boston et dans sa périphérie, et dans une zone couvrant une partie de la Pennsylvanie et la vallée de la Delaware, montre que l’innovation résulte de processus qui varient considérablement d’une région à l’autre. En effet, si les trois bioclusters qu’étudie l’article sont caractérisés par un taux élevé d’activité innovante, un équilibre différent dans chaque cas s’y est établi entre les variables liées à l’entreprenariat et celles qui sont relatives à la constitution d’un réseau régional d’entreprises. Il n’existe donc pas de formule éprouvée pour stimuler l’innovation. Une conclusion s’impose, toutefois : l’entreprenariat et la constitution de clusters sont des facteurs de première importance.
Intoxication par la paraphényléne-diamine
African Journals Online (AJOL)
raoul
9 mars 2011 ... remède contre la douleur par Averbukh [8], ou contre la constipation par Schemesh [9], mais l´utilisation à des fins autolytique reste toujours prédominante. Le tableau clinique de l´intoxication à ... une anurie ayant nécessité le recours à l´hémodialyse. Ce taux de survenue d´IRA anurique est relativement ...
Exploratory wine consumer behavior in a transitional market: The case of Poland
Directory of Open Access Journals (Sweden)
Renata Schaefer
2018-06-01
Full Text Available This paper investigates exploratory behavior among wine consumers in Poland where the country's wine culture is in a state of rapid change. This study investigates the extent to which demographics, values, and wine preferences relate to exploratory behavior.Data obtained from 198 Polish wine consumers was used in the analysis. Exploratory behavior was measured using the VARSEEK scale adapted to wine. Other measures included the Schwartz Value Inventory, wine knowledge and involvement, and measures relevant for wine purchasing behavior. Demographic variables were also used to profile consumers.The findings show that Polish wine consumers’ level of exploratory behavior is not related to demographics, but is influenced by personal values. The consumers who were most likely to engage in exploratory behavior valued creativity, fun, and risk taking and were less concerned about behaving properly. They also had more global outlook as they were more likely to purchase wine in other countries and desired more wines from regions outside Poland.The findings are useful for wine marketers when developing strategies for wine consumers in transitional markets based on their unique needs and expectations.This is the first known research conducted in Poland focusing on wine consumers’ exploratory behavior and subsequent wine preferences. Keywords: Polish wine market, Consumer behavior, Exploratory behavior, Consumer segmentation
Social Enterprises in Brazil: Socially Produced Knowledge Versus Social Innovation.
Directory of Open Access Journals (Sweden)
Edileusa Godói-de-Sousa
2013-04-01
Full Text Available This study investigated whether socially produced knowledge in social ventures in Brazil has promoted social innovation and local development. The research is exploratory and descriptive, and was developed in two stages. At first, the sample group was composed of 378 projects selected from the mapping of Solidarity Economic Enterprises, conducted by the National Secretary of Solidarity Economy (Secretaria Nacional de Economia Solidária. The sample was surveyed to verify the main characteristics of these enterprises. After that, interviews were conducted with key managers in a sample of 32 projects. The results indicate challenges in the long path of favoring dynamic learning, with a generation of knowledge from the collective experiences of socialization: there is a lack of joint discussion and a predominance of individualized learning actions.
Sustainable Innovation: A Competitive Advantage for Innovation Ecosystems
Oksanen, Kaisa; Hautamäki, Antti
2015-01-01
In this article, we elaborate the emerging concept of sustainable innovation and analyze the relevance of innovation as a means to solve wicked problems and enhancing sustainable well-being. We also examine the changing conditions for innovation creation: building global knowledge hubs and local innovation ecosystems. As a result, the drivers of innovation and opportunities to utilize the untapped innovation potential of people outside traditional innovation contexts are expand...
Group Innovation Ability of Agricultural Technological Innovation Strategic Alliance
Institute of Scientific and Technical Information of China (English)
Chishun; MA; Jintian; YU
2013-01-01
Agricultural technological innovation strategic alliance, as an important form of strategic alliance, has steadily strengthened the collaborative management among organizations and raised competitive power with the backing of improved group innovation ability. This article studies innovation ability from individual innovation ability to the group innovation ability. Firstly, basic connotation of group innovation ability is to be concluded through the comparison of individual and group innovation ability. Secondly, evaluation index system is to be established based on the influencing factors of the group innovation ability of agricultural technological innovation strategic alliance and evaluation is based on three dimensions, namely organization technological innovation ability, alliance collaborative innovation ability as well as innovation environment. Furthermore, basic methods for promoting the group innovation ability of alliance are to be proposed.
Directory of Open Access Journals (Sweden)
Jacky Y Suen
Full Text Available Protease-Activated Receptor-2 (PAR2 has been implicated through genetic knockout mice with cytokine regulation and arthritis development. Many studies have associated PAR2 with inflammatory conditions (arthritis, airways inflammation, IBD and key events in tumor progression (angiogenesis, metastasis, but they have relied heavily on the use of single agonists to identify physiological roles for PAR2. However such probes are now known not to be highly selective for PAR2, and thus precisely what PAR2 does and what mechanisms of downstream regulation are truly affected remain obscure. Effects of PAR2 activation on gene expression in Human Embryonic Kidney cells (HEK293, a commonly studied cell line in PAR2 research, were investigated here by comparing 19,000 human genes for intersecting up- or down-regulation by both trypsin (an endogenous protease that activates PAR2 and a PAR2 activating hexapeptide (2f-LIGRLO-NH(2. Among 2,500 human genes regulated similarly by both agonists, there were clear associations between PAR2 activation and cellular metabolism (1,000 genes, the cell cycle, the MAPK pathway, HDAC and sirtuin enzymes, inflammatory cytokines, and anti-complement function. PAR-2 activation up-regulated four genes more than 5 fold (DUSP6, WWOX, AREG, SERPINB2 and down-regulated another six genes more than 3 fold (TXNIP, RARG, ITGB4, CTSD, MSC and TM4SF15. Both PAR2 and PAR1 activation resulted in up-regulated expression of several genes (CD44, FOSL1, TNFRSF12A, RAB3A, COPEB, CORO1C, THBS1, SDC4 known to be important in cancer. This is the first widespread profiling of specific activation of PAR2 and provides a valuable platform for better understanding key mechanistic roles of PAR2 in human physiology. Results clearly support the development of both antagonists and agonists of human PAR2 as potential disease modifying therapeutic agents.
Directory of Open Access Journals (Sweden)
Casart Yveth
2008-03-01
Full Text Available Abstract Background The ParA/Soj and ParB/Spo0J proteins, and the cis-acting parS site, participate actively in chromosome segregation and cell cycle progression. Genes homologous to parA and parB, and two putative parS copies, have been identified in the Mycobacterium bovis BCG and Mycobacterium smegmatis chromosomes. As in Mycobacterium tuberculosis, the parA and parB genes in these two non-pathogenic mycobacteria are located near the chromosomal origin of replication. The present work focused on the determination of the transcriptional organisation of the ~6 Kb orf60K-parB region of M. bovis BCG and M. smegmatis by primer extension, transcriptional fusions to the green fluorescence protein (GFP and quantitative RT-PCR. Results The parAB genes were arranged in an operon. However, we also found promoters upstream of each one of these genes. Seven putative promoter sequences were identified in the orf60K-parB region of M. bovis BCG, whilst four were identified in the homologous region of M. smegmatis, one upstream of each open reading frame (ORF. Real-time PCR assays showed that in M. smegmatis, mRNA-parA and mRNA-parB levels decreased between the exponential and stationary phases. In M. bovis BCG, mRNA-parA levels also decreased between the exponential and stationary phases. However, parB expression was higher than parA expression and remained almost unchanged along the growth curve. Conclusion The majority of the proposed promoter regions had features characteristic of Mycobacterium promoters previously denoted as Group D. The -10 hexamer of a strong E. coli σ70-like promoter, located upstream of gidB of M. bovis BCG, overlapped with a putative parS sequence, suggesting that the transcription from this promoter might be regulated by the binding of ParB to parS.
Innovation in retail: impact on creating a positive experience when buying fashion products
Directory of Open Access Journals (Sweden)
Cristinel Vasiliu
2015-05-01
Full Text Available Innovation in fashion retail is critical in order to ensure competitive advantage in a constantly evolving market, in terms of consumer expectations. The modern customer is mobile, permanently connected to the Internet, well-informed about international trends, mindful of the quality of products, but more price sensitive and less loyal to a brand. The shopping experience provided by retailers is a crucial factor in purchase decision, encompassing all these variables in a complex concept of exogenous variable. As retailers’ efforts to provide excellence in shopping experience are focused on operating costs and thus on the profit margins, it is important to consider and identify which are the most relevant variables that form the perception of excellence for Romanian customers, so that retailers can innovate according to their expectations. The purpose of this article was to highlight the role of innovation in creating a positive experience for consumers buying clothes, shoes and accessories. The approach was based on the conduct of exploratory research. The research ? represented by five original objectives and as many different working scenarios ? resulted in the identification of thematic outlined exploratory opinions, exploiting a first investigation of its kind in Romania, less Pearson coefficients used in the analysis of ordinal variables or hierarchical, but quickly assessed using SPSS, version 21. As a pioneering research emphasis was on identifying potential associations and quantified correlations and less on rigorous delimitation of exogenous or endogenous quality in general, leaving room for future studies, sharper and with a higher degree of representation. Thus, we could highlight some useful aspects of the investigated retailers, by the dominant character of interested customers’ opinions according to their volunteer responses. Consumers are accustomed to using the Internet to obtain information; they rarely express opinions on
Foster, Michele; Burridge, Letitia; Donald, Maria; Zhang, Jianzhen; Jackson, Claire
2016-01-14
Service delivery innovation is at the heart of efforts to combat the growing burden of chronic disease and escalating healthcare expenditure. Small-scale, locally-led service delivery innovation is a valuable source of learning about the complexities of change and the actions of local change agents. This exploratory qualitative study captures the perspectives of clinicians and managers involved in a general practitioner-led integrated diabetes care innovation. Data on these change agents' perspectives on the local innovation and how it works in the local context were collected through focus groups and semi-structured interviews at two primary health care sites. Transcribed data were analysed thematically. Normalization Process Theory provided a framework to explore perspectives on the individual and collective work involved in putting the innovation into practice in local service delivery contexts. Twelve primary health care clinicians, hospital-based medical specialists and practice managers participated in the study, which represented the majority involved in the innovation at the two sites. The thematic analysis highlighted three main themes of local innovation work: 1) trusting and embedding new professional relationships; 2) synchronizing services and resources; and 3) reconciling realities of innovation work. As a whole, the findings show that while locally-led service delivery innovation is designed to respond to local problems, convincing others to trust change and managing the boundary tensions is core to local work, particularly when it challenges taken-for-granted practices and relationships. Despite this, the findings also show that local innovators can and do act in both discretionary and creative ways to progress the innovation. The use of Normalization Process Theory uncovered some critical professional, organizational and structural factors early in the progression of the innovation. The key to local service delivery innovation lies in building
Open innovation with an effective open innovation team.
Vanvoorden, Jonas
2014-01-01
This master's thesis explores how open innovation teams can successfully support open innovation inside of an organisation. Open innovation is a paradigm introduced by Henry Chesbrough (2003) a decade ago. It expands the innovation potential of organisations by opening them up to new ways of working with external partners. To implement open innovation, many companies rely on a small group of managers named open innovation teams. Although open innovation teams can potentially be vital for impl...
Par-4-mediated recruitment of Amida to the actin cytoskeleton leads to the induction of apoptosis
International Nuclear Information System (INIS)
Boosen, Meike; Vetterkind, Susanne; Koplin, Ansgar; Illenberger, Susanne; Preuss, Ute
2005-01-01
Par-4 (prostate apoptosis response-4) sensitizes cells to apoptotic stimuli, but the exact mechanisms are still poorly understood. Using Par-4 as bait in a yeast two-hybrid screen, we identified Amida as a novel interaction partner, a ubiquitously expressed protein which has been suggested to be involved in apoptotic processes. Complex formation of Par-4 and Amida occurs in vitro and in vivo and is mediated via the C-termini of both proteins, involving the leucine zipper of Par-4. Amida resides mainly in the nucleus but displays nucleo-cytoplasmic shuttling in heterokaryons. Upon coexpression with Par-4 in REF52.2 cells, Amida translocates to the cytoplasm and is recruited to actin filaments by Par-4, resulting in enhanced induction of apoptosis. The synergistic effect of Amida/Par-4 complexes on the induction of apoptosis is abrogated when either Amida/Par-4 complex formation or association of these complexes with the actin cytoskeleton is impaired, indicating that the Par-4-mediated relocation of Amida to the actin cytoskeleton is crucial for the pro-apoptotic function of Par-4/Amida complexes in REF52.2 cells. The latter results in enhanced phosphorylation of the regulatory light chain of myosin II (MLC) as has previously been shown for Par-4-mediated recruitment of DAP-like kinase (Dlk), suggesting that the recruitment of nuclear proteins involved in the regulation of apoptotic processes to the actin filament system by Par-4 represents a potent mechanism how Par-4 can trigger apoptosis
Directory of Open Access Journals (Sweden)
Laurent Pordié
2011-11-01
Full Text Available L’industrie du bien-être se caractérise à la fois par un fort potentiel d’innovation dans le domaine thérapeutique et par une prétention à l’ancienneté de ces nouvelles thérapies. Cet article propose d’analyser ce paradoxe en étudiant les logiques à l’œuvre dans la construction d’une marque identifiant et distinguant Mango Spa, une chaîne indienne de centres de soins et de remise en forme. Il s’intéresse aux sens et aux implications de l’innovation thérapeutique dans le cas d’une firme qui revendique l’authenticité de ses traitements tout en puisant dans des ressources d’influences multiples afin de s’adapter à une clientèle cosmopolite. Ces services et ces produits fondent leur légitimité sur la tradition ayurvédique, mais ils doivent toutefois la défier afin d’acquérir leur propre visibilité. C’est ainsi que Mango Spa se démarque de ses concurrents. De nouvelles thérapies « indiennes » sont créées en mobilisant clients internationaux, thérapeutes de cultures disparates et industriels établis hors de l’Inde. La marque est produite au travers d’un faisceau complexe de relations transnationales. En examinant les forces globales et le caractère multidimensionnel de la production d’une marque indienne, cet article renseigne plus généralement sur la circulation et la transformation des idées, des objets et des pratiques.The wellness industry is characterized by both a high innovation potential in the therapeutic field and a claim to the antiquity of these new therapies. This article aims to analyze this paradox by studying the logic at work in the construction of a brand identifying and distinguishing Mango Spa, an Indian chain of health and fitness centers. Particularly interesting are the meanings and implications of therapeutic innovation in the case of a firm claiming the authenticity of its treatments while drawing on multiples resources and influences to adapt them to a
Prognostic value of suPAR and hs-CRP on cardiovascular disease
DEFF Research Database (Denmark)
Diederichsen, Marie Zöga; Diederichsen, Søren Zöga; Mickley, Hans
2018-01-01
Background and aims: Studies have shown that soluble urokinase Plasminogen Activator Receptor (suPAR) and CRP (both inflammatory markers) and coronary artery calcification (CAC) are independent risk predictors for cardiovascular (CV) disease. The aim of this study is to assess whether suPAR and CRP...... have an increased predictive prognostic value beyond the traditional CV risk factors and the CAC score. Methods: A population sample of 1179 subjects, free of CV disease was included. The subjects underwent traditional CV risk evaluation, CAC assessment and blood sampling for suPAR and CRP. CV events...
mTORC2 activation is regulated by the urokinase receptor (uPAR) in bladder cancer.
Hau, Andrew M; Leivo, Mariah Z; Gilder, Andrew S; Hu, Jing-Jing; Gonias, Steven L; Hansel, Donna E
2017-01-01
Mammalian target of rapamycin complex 2 (mTORC2) has been identified as a major regulator of bladder cancer cell migration and invasion. Upstream pathways that mediate mTORC2 activation remain poorly defined. Urokinase-type plasminogen activator receptor (uPAR) is a GPI-anchored membrane protein and known activator of cell-signaling. We identified increased uPAR expression in 94% of invasive human bladder cancers and in 54-71% of non-invasive bladder cancers, depending on grade. Normal urothelium was uPAR-immunonegative. Analysis of publicly available datasets identified uPAR gene amplification or mRNA upregulation in a subset of bladder cancer patients with reduced overall survival. Using biochemical approaches, we showed that uPAR activates mTORC2 in bladder cancer cells. Highly invasive bladder cancer cell lines, including T24, J82 and UM-UC-3 cells, showed increased uPAR mRNA expression and protein levels compared with the less aggressive cell lines, UROtsa and RT4. uPAR gene-silencing significantly reduced phosphorylation of Serine-473 in Akt, an mTORC2 target. uPAR gene-silencing also reduced bladder cancer cell migration and Matrigel invasion. S473 phosphorylation was observed by immunohistochemistry in human bladder cancers only when the tumors expressed high levels of uPAR. S473 phosphorylation was not controlled by uPAR in bladder cancer cell lines that are PTEN-negative; however, this result probably did not reflect altered mTORC2 regulation. Instead, PTEN deficiency de-repressed alternative kinases that phosphorylate S473. Our results suggest that uPAR and mTORC2 are components of a single cell-signaling pathway. Targeting uPAR or mTORC2 may be beneficial in patients with bladder cancer. Copyright © 2016. Published by Elsevier Inc.
Energy Technology Data Exchange (ETDEWEB)
Rogge, Karoline [Fraunhofer-Institut fuer Systemtechnik und Innovationsforschung (ISI), Karlsruhe (Germany); Swiss Federal Inst. of Technology Zurich (ETH Zurich) (Switzerland). Dept. of Management, Technology, and Economics; Hoffmann, Volker [Swiss Federal Inst. of Technology Zurich (ETH Zurich) (Switzerland). Dept. of Management, Technology, and Economics
2009-07-01
This paper provides an overview of early changes in the sectoral innovation system for power generation technologies which have been triggered by the European Emission Trading Scheme (EU ETS). Based on a broad definition of the sector, our research analyses the impact of the EU ETS on the four building blocks 'knowledge and technologies', 'actors and networks', 'institutions' and 'demand' by combining two streams of literature, namely systems of innovation and environmental economics. Our analysis is based on 42 exploratory inter-views with German and European experts in the field of the EU ETS, the power sector and technological innovation. We find that the EU ETS mainly affects the rate and direction of the technological change of power generation technologies within the large-scale, coal-based power generation technological regime to which carbon capture technologies are added as a new technological trajectory. While this impact can be interpreted as defensive behaviour of incumbents, the observed changes should not be underestimated. We argue that the EU ETS' impact on corporate CO2 culture and routines may prepare the ground for the transition to a low carbon sectoral innovation system for power generation technologies. (orig.)
Innovation Processes and Entrepreneurial Culture for Radical Innovations
Directory of Open Access Journals (Sweden)
Ľubica Knošková
2015-02-01
Full Text Available To survive and prosper, the organizations need to embed the processes and mechanisms to discover major technology and consumer trends and respond to them through new growth areas. Based on profound literature review providing insight into organizational factors that affect firms’ ability to manage innovation this paper asks which innovation processes and entrepreneurial culture support radical innovations. The aim of the paper is to specify the company behaviour that leads to innovative outputs with high level of novelty in country specific context of Slovakia. We conducted two-stage empirical research in 2009 and 2014 mapping companies’ approach to innovation management during the last 10 years. After surveying 102 firms in the first stage and 287 firms in the second stage we derive success factors for radical innovations. The findings demonstrate growing importance of corporate strategic orientation, highly developed innovation processes and parallel mechanisms for radical innovation, ability to manage internally and externally open innovation and support entrepreneurial culture. This study makes unique contribution to the understanding of innovation processes, organizational factors, and their significance and dynamics. It should attract managerial attention to recognize the importance of innovation management factors for building firm’s innovation competency.
Daranas, Núria; Bonaterra, Anna; Francés, Jesús; Cabrefiga, Jordi; Montesinos, Emilio; Badosa, Esther
2018-03-09
A viability qPCR (v-qPCR) assay was developed for the unambiguous detection and quantification of Lactobacillus plantarum PM411 viable cells in aerial plant surfaces. A 972 bp region of a PM411 predicted prophage with mosaic architecture enabled the identification of a PM411 strain-specific molecular marker. Three primer sets, with different amplicon lengths (92, 188, and 317 bp), and one TaqMan probe were designed. All the qPCR assays showed good linearity over a 4-log range and good efficiencies, but differed in sensitivity. The nucleic acid-binding dye PEMAX was used for selectively detecting and enumerating viable bacteria by v-qPCR. The primer set amplifying a 188 bp DNA fragment was selected as the most suitable for v-qPCR. The performance of the method was assessed on apple blossoms, pear, strawberry and kiwifruit leaves in potted plants under controlled environmental conditions, and pear and apple blossoms under field conditions, by comparing v-qPCR population estimation to those obtained by qPCR and specific plate counting on MRS-rifampicin. The population estimation did not differ significantly between methods when conditions were conducive to bacterial survival. However, under stressful conditions, differences between methods were observed due to cell death or viable but non-culturable state induction. While qPCR overestimated the population level, plate counting underestimated this value in comparison to v-qPCR. PM411 attained stable population levels of viable cells on flower environment under high relative humidity. However, the unfavourable conditions onto the leaf surface and the relatively dryness in the field caused an important decrease of viable population. IMPORTANCE The v-qPCR method in combination with plate counting and qPCR is a powerful tool for studies of colonization and survival in field conditions, to improve formulations and delivery strategies of PM411, or to optimize the dose and timing of spray schedules. It is expected that PEMAX
Réduction du risque d'infection par le VIH au Botswana - essais ...
International Development Research Centre (IDRC) Digital Library (Canada)
Au Botswana, ce sont les jeunes femmes qui sont le plus touchées par les nouvelles infections par le VIH. Le présent projet a pour but de réduire le nombre de nouveaux cas d'infection par le VIH, en particulier chez les femmes de 15 à 29 ans. Bien que l'on recense des cas de VIH/sida dans la plupart des régions du ...
Plasma engineering innovations for the ORNL TNS reactor
International Nuclear Information System (INIS)
Peng, Y.K.M.; Houlberg, W.A.; Mense, A.T.; Rome, J.A.; Uckan, N.A.
1977-01-01
Recent plasma engineering studies have ascertained a viable concept for The Next Step (TNS) reactor based on medium toroidal fields between 4 T and 7 T at the plasma center, plasma β values up to 10 percent and averaged densities between 0.6 x 10 14 cm -3 and 2.5 x 10 14 cm -3 . Plasma engineering innovations that can substantially reduce the size, cost, and complexity of the TNS reactor have been explored and are summarized. It is shown that the previously anticipated requirement of high pellet velocities can be substantially reduced; the toroidal field (TF) ripple requirements may be relaxed to reduce the number of TF coils and improve machine access; hybrid equilibrium field (EF) coils have been shown to require building only small interior coils and to reduce the power supply required by the exterior coils; proper approaches of microwave plasma preheating may reduce the peak loop voltage for start-up by an order of magnitude. The medium-field TNS reactor concepts and the plasma engineering innovations discussed should be applicable to other designs of tokamak reactors
Zeng Wu; Tian Zhilong
2010-01-01
With the method of duopoly game theory, the effect of firms’ innovation ability on the choice between product and process innovation is studied. The concept of cost coefficient of product innovation is introduced, and the criterion equation for the innovation type is derived. The following conclusions are made: the more the product innovation ability, the more the possibility for the firms to carry out the product innovation in both the Bertrand and the Cournot competitions. Wi...
Workplace innovation, social innovation and social quality
Oeij, P.R.A.; Dhondt, S.; Korver, T.
2011-01-01
Social innovation is becoming a core value of the EU flagship initiative Innovation Union, but it is not clearly demarcated as it covers a wide field of topics. To understand social innovation within European policymaking a brief outline is given of EC policy developments on innovation and on
Directory of Open Access Journals (Sweden)
Rosenda Valdés Arencibia
2013-06-01
Full Text Available Este trabajo presenta la evaluación de la incertidumbre de las mediciones realizadas para la determinación de los parámetros de consumo de electrodos de recargue, dando énfasis a la medición de masa. Para ello fueron realizados tres depósitos a tres niveles de corriente (120 A, 145 A y 160 A, respectivamente, registrándose el tiempo de soldadura, la longitud del cordón, así como la masa inicial y final de las probetas y de los electrodos. A partir de los datos anteriores fueron determinados los parámetros de consumo. Fue calculada la incertidumbre asociada a la masa de las probetas, a la masa consumida del electrodo, a la masa depositada y a los parámetros de consumo. Al finalizar el trabajo se comprobó que el rendimiento del depósito muestra un comportamiento decreciente con la corriente, siendo el mejor resultado de (74,12 % para una corriente de soldadura de 120 A. Los valores de incertidumbre expandida para el rendimiento varían entre 1,47 % y 2,41 %, para la tasa de consumo fueron obtenidos valores entre 0,4 g/min y 0,6 g/min, mientras que para la tasa de deposición la incertidumbre varía de 0,6 g/min a 0,7 g/min.This work presents the evaluation of the uncertainty of the measurements to determine the consumption parameters of hardfacing electrode, emphasizing the mass measurement. The experimentation was carried out obtaining deposits at three levels of current (120 A, 145 A y 160 A and measuring the time spent in welding, the length of the welds the test plate and electrode mass (initial and final. Based on these results, the consumption parameters were also determined. The uncertainty related to the measurements the mass of the samples, the mass consumption of the electrode, the deposited mass and consumption parameters was determined. The results showed that the deposition efficiency increase as a function of the current, turning the best result (74.12 % at 120 A. The expanded measurement uncertainty associated to
DEFF Research Database (Denmark)
Hunding, Axel; Gerdes, Kenn; Charbon, Gitte Ebersbach
2003-01-01
in an autocatalytic process. We discuss this mechanism in relation to recent models for MinDE oscillations in E.coli and to microtubule degradation in mitosis. The study points to an ancestral role for the presented pattern types in generating bipolarity in prokaryotes and eukaryotes.......Prokaryotic plasmids encode partitioning (par) loci involved in segregation of DNA to daughter cells at cell division. A functional fusion protein consisting of Walker-type ParA ATPase and green fluorescent protein (Gfp) oscillates back and forth within nucleoid regions with a wave period of about...
[Ambroise Paré in French literature].
Dumaitre, P
1995-01-01
The 16th century by its passionate side has been the favourite one of authors of historical novels in which among the heroes of "cloak and dagger stories" appears sometime Ambroise Paré. Alexandre Dumas (the father) has shown him at the court of Charles IX in La Reine Margot (1845) where he does not however play a great role. On the contrary, Balzac in Le Martyr calviniste (1842) has given him a capital part close to the dying François II, whom he intended to trepanize but had to give up this idea as a consequence of the opposition of the queen-mother Catherine de Médicis. In the present century, Robert Merle in Paris ma bonne ville (Fortune de France, 3, 1980) shows Paré at the time of the Saint Barthélemy.
Les dispensées par fantaisie en éducation physique et sportive ...
African Journals Online (AJOL)
Cette étude vise à comprendre les raisons avancées par les élèves dispensés par fantaisie des cours d'EPS, pour justifier leur attitude et principalement leur forfait. Une enquête par questionnaire écrit a été menée dans 13 établissements publics de la ville de Porto-Novo au Bénin. Au total, 203 élèves parmi les 771 élèves ...
Complexation de l'aluminium par des hétéropolyanions lacunaires ...
African Journals Online (AJOL)
L'objectif visé par cette étude est la dépollution des eaux à partir de la complexation d'un métal toxique, l'aluminium en solution, par des hétéropolyanions lacunaires (HPA) de type Dawson. Les complexes formés sont récupérés par membrane liquide émulsionnée (MEL).Les résultats de la complex1ation de l'aluminium ...
Removal of focal segmental glomerulosclerosis (FSGS) factor suPAR using CytoSorb.
Schenk, Heiko; Müller-Deile, Janina; Schmitt, Roland; Bräsen, Jan Hinrich; Haller, Hermann; Schiffer, Mario
2017-12-01
Treatment of primary focal segmental glomerulosclerosis (FSGS) and its recurrence after kidney transplantation associated with rapid deterioration of kidney function remains to be challenging despite advances in immunosuppressive therapy. The presence of circulating factors has been postulated to be a pivotal player in the pathogenesis of FSGS, although suPAR and CLCF-1 have been identified as the most promising causative factors. The potential therapeutic effect of suPAR elimination in an FSGS patient using CytoSorb, a hemoadsorption device that gained attention in the cytokine elimination in septic patients, was studied. Efficiency of total plasma exchange to remove suPAR was determined. CytoSorb hemoadsorption caused a 27.33% reduction of the suPAR level in a single treatment, whereas total plasma exchange showed a suPAR level reduction of 25.12% (n = 3; 95% confidence interval, 0.2777-0.8090; P < 0.01), which may indicate therapeutic potential in the treatment of primary FSGS and its recurrence in a kidney transplant. © 2017 Wiley Periodicals, Inc.
Thrombin induces rapid PAR1-mediated non-classical FGF1 release
International Nuclear Information System (INIS)
Duarte, Maria; Kolev, Vihren; Soldi, Raffaella; Kirov, Alexander; Graziani, Irene; Oliveira, Silvia Marta; Kacer, Doreen; Friesel, Robert; Maciag, Thomas; Prudovsky, Igor
2006-01-01
Thrombin induces cell proliferation and migration during vascular injury. We report that thrombin rapidly stimulated expression and release of the pro-angiogenic polypeptide fibroblast growth factor 1 (FGF1). Thrombin failed to induce FGF1 release from protease-activated receptor 1 (PAR1) null fibroblasts, indicating that this effect was dependent on PAR1. Similarly to thrombin, FGF1 expression and release were induced by TRAP, a specific oligopeptide agonist of PAR1. These results identify a novel aspect of the crosstalk between FGF and thrombin signaling pathways which both play important roles in tissue repair and angiogenesis
33 CFR 151.06 - Special areas.
2010-07-01
....06 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION... Pertains to Pollution from Ships General § 151.06 Special areas. (a) For the purposes of this part, the... that portion of the Atlantic Ocean within the boundary constituted by the 30° N parallel from Florida...
Exploratory Research and Development Fund, FY 1990
Energy Technology Data Exchange (ETDEWEB)
1992-05-01
The Lawrence Berkeley Laboratory Exploratory R D Fund FY 1990 report is compiled from annual reports submitted by principal investigators following the close of the fiscal year. This report describes the projects supported and summarizes their accomplishments. It constitutes a part of an Exploratory R D Fund (ERF) planning and documentation process that includes an annual planning cycle, projection selection, implementation, and review. The research areas covered in this report are: Accelerator and fusion research; applied science; cell and molecular biology; chemical biodynamics; chemical sciences; earth sciences; engineering; information and computing sciences; materials sciences; nuclear science; physics and research medicine and radiation biophysics.
EPA frames innovation as critical to the protection of human health and the environment through initiatives such as sustainable practices, innovative research, prize competitions, innovation awards, partnerships, and community activities.
Chan, Zenobia C Y
2013-08-01
To explore students' attitude towards problem-based learning, creativity and critical thinking, and the relevance to nursing education and clinical practice. Critical thinking and creativity are crucial in nursing education. The teaching approach of problem-based learning can help to reduce the difficulties of nurturing problem-solving skills. However, there is little in the literature on how to improve the effectiveness of a problem-based learning lesson by designing appropriate and innovative activities such as composing songs, writing poems and using role plays. Exploratory qualitative study. A sample of 100 students participated in seven semi-structured focus groups, of which two were innovative groups and five were standard groups, adopting three activities in problem-based learning, namely composing songs, writing poems and performing role plays. The data were analysed using thematic analysis. There are three themes extracted from the conversations: 'students' perceptions of problem-based learning', 'students' perceptions of creative thinking' and 'students' perceptions of critical thinking'. Participants generally agreed that critical thinking is more important than creativity in problem-based learning and clinical practice. Participants in the innovative groups perceived a significantly closer relationship between critical thinking and nursing care, and between creativity and nursing care than the standard groups. Both standard and innovative groups agreed that problem-based learning could significantly increase their critical thinking and problem-solving skills. Further, by composing songs, writing poems and using role plays, the innovative groups had significantly increased their awareness of the relationship among critical thinking, creativity and nursing care. Nursing educators should include more types of creative activities than it often does in conventional problem-based learning classes. The results could help nurse educators design an appropriate
Examining relational empowerment for elementary school students in a yPAR program.
Langhout, Regina Day; Collins, Charles; Ellison, Erin Rose
2014-06-01
This paper joins relational empowerment, youth empowerment, and Bridging Multiple Worlds frameworks to examine forms of relational empowerment for children in two intermediary institutions-school and a youth participatory action research after-school program (yPAR ASP). Participants were twelve children, most of whom were Latina/o and from im/migrant families, enrolled in a yPAR ASP for 2 years. A mixed-method approach was utilized; we analyzed children's interviews, self-defined goals, and their social networks to examine their experiences of relational empowerment. We conclude that children experienced each of the five relational empowerment factors-collaborative competence, bridging social divisions, facilitating others' empowerment, mobilizing networks, and passing on a legacy-in the yPAR ASP setting, and some factors in school. These experiences, however, were more pronounced in the yPAR ASP setting. Additionally, social network analyses revealed that a small but meaningful percentage of actors bridged worlds, especially home and family, but by year 2, also school and the yPAR ASP. Finally, most helpers for school-based goals came from school, but a sizable number came from family, friends, and home worlds, and by year 2, also came from the yPAR ASP. Implications range from theoretical to methodological development, including the use of social network analysis as a tool to descriptively examine relational power in context.
DEFF Research Database (Denmark)
Mölkänen, T; Ruotsalainen, E; Thorball, C W
2011-01-01
The soluble form of urokinase-type plasminogen activator receptor (suPAR) is a new inflammatory marker. High suPAR levels have been shown to associate with mortality in cancer and in chronic infections like HIV and tuberculosis, but reports on the role of suPAR in acute bacteremic infections...... are scarce. To elucidate the role of suPAR in a common bacteremic infection, the serum suPAR levels in 59 patients with Staphylococcus aureus bacteremia (SAB) were measured using the suPARnostic ELISA assay and associations to 1-month mortality and with deep infection focus were analyzed. On day three, after...... the first positive blood culture for S. aureus, suPAR levels were higher in 19 fatalities (median 12.3; range 5.7-64.6 ng/mL) than in 40 survivors (median 8.4; range 3.7-17.6 ng/mL, p = 0.002). This difference persisted for 10 days. The presence of deep infection focus was not associated with elevated su...
Bagot, Kathleen L; Cadilhac, Dominique A; Vu, Michelle; Moss, Karen; Bladin, Christopher F
2015-12-01
Telemedicine is a disruptive innovation within health care settings as consultations take place via audio-visual technology rather than traditional face-to-face. Specialist perceptions and experiences of providing audio-visual consultations in emergency situations, however, are not well understood. The aim of this exploratory study was to describe the experience of medical specialists providing acute stroke decision-making support via telemedicine. Data from the Victorian Stroke Telemedicine (VST) programme were used. The experiences of specialists providing an acute clinical telemedicine service to rural emergency departments were explored, drawing on disruptive innovation theory. Document analysis of programme consultation records, meeting minutes and in-depth individual interviews with three neurologists were analysed using triangulation. Since February 2014, 269 stroke telemedicine consultations with 12 neurologists have occurred. Retention on the roster has varied between 1 and >4 years. Overall, neurologists reported benefits of participation, as they were addressing health equity gaps for rural patients. Negative effects were the unpredictability of consultations impacting on their personal life, the mixed level of experience of colleagues initiating the consult and not knowing patient outcomes since follow-up communication was not routine. Insights into workforce experience and satisfaction were identified to inform strategies to support specialists to adapt to the disruptive innovation of telemedicine. © The Author(s) 2015.
An economic and financial exploratory
Cincotti, S.; Sornette, D.; Treleaven, P.; Battiston, S.; Caldarelli, G.; Hommes, C.H.; Kirman, A.
2012-01-01
This paper describes the vision of a European Exploratory for economics and finance using an interdisciplinary consortium of economists, natural scientists, computer scientists and engineers, who will combine their expertise to address the enormous challenges of the 21st century. This Academic
The polarity protein Par6 is coupled to the microtubule network during molluscan early embryogenesis
Energy Technology Data Exchange (ETDEWEB)
Homma, Taihei [Department of Biophysics and Biochemistry, Graduate School of Science, The University of Tokyo, Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Shimizu, Miho [Kuroda Chiromorphology Team, ERATO-SORST, JST, Komaba, Meguro-ku, Tokyo 153-8902 (Japan); Kuroda, Reiko, E-mail: ckuroda@mail.ecc.u-tokyo.ac.jp [Department of Biophysics and Biochemistry, Graduate School of Science, The University of Tokyo, Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Kuroda Chiromorphology Team, ERATO-SORST, JST, Komaba, Meguro-ku, Tokyo 153-8902 (Japan); Department of Life Sciences, Graduate School of Arts and Sciences, The University of Tokyo, Komaba, Meguro-ku, Tokyo 153-8902 (Japan)
2011-01-07
Research highlights: {yields} The cDNAs encoding Par6 and aPKC homologues were cloned from the snail Lymnaea stagnalis. {yields} L. stagnalis Par6 directly interacts with tubulin and microtubules and localizes to the microtubule cytoskeleton during the early embryogenesis. {yields} Identical sequence and localization of LsPar6 for the dextral and the sinistral snails exclude the possibility of the gene being the primary determinant of body handedness. -- Abstract: Cell polarity, which directs the orientation of asymmetric cell division and segregation of fate determinants, is a fundamental feature of development and differentiation. Regulators of polarity have been extensively studied, and the critical importance of the Par (partitioning-defective) complex as the polarity machinery is now recognized in a wide range of eukaryotic systems. The Par polarity module is evolutionarily conserved, but its mechanism and cooperating factors vary among different systems. Here we describe the cloning and characterization of a pond snail Lymnaea stagnalis homologue of partitioning-defective 6 (Lspar6). The protein product LsPar6 shows high affinity for microtubules and localizes to the mitotic apparatus during embryonic cell division. In vitro assays revealed direct binding of LsPar6 to tubulin and microtubules, which is the first evidence of the direct interaction between the two proteins. The interaction is mediated by two distinct regions of LsPar6 both located in the N-terminal half. Atypical PKC, a functional partner of Par6, was also found to localize to the mitotic spindle. These results suggest that the L. stagnalis Par complex employs the microtubule network in cell polarity processes during the early embryogenesis. Identical sequence and localization of LsPar6 for the dextral and the sinistral snails exclude the possibility of the gene being the primary determinant of handedness.
The polarity protein Par6 is coupled to the microtubule network during molluscan early embryogenesis
International Nuclear Information System (INIS)
Homma, Taihei; Shimizu, Miho; Kuroda, Reiko
2011-01-01
Research highlights: → The cDNAs encoding Par6 and aPKC homologues were cloned from the snail Lymnaea stagnalis. → L. stagnalis Par6 directly interacts with tubulin and microtubules and localizes to the microtubule cytoskeleton during the early embryogenesis. → Identical sequence and localization of LsPar6 for the dextral and the sinistral snails exclude the possibility of the gene being the primary determinant of body handedness. -- Abstract: Cell polarity, which directs the orientation of asymmetric cell division and segregation of fate determinants, is a fundamental feature of development and differentiation. Regulators of polarity have been extensively studied, and the critical importance of the Par (partitioning-defective) complex as the polarity machinery is now recognized in a wide range of eukaryotic systems. The Par polarity module is evolutionarily conserved, but its mechanism and cooperating factors vary among different systems. Here we describe the cloning and characterization of a pond snail Lymnaea stagnalis homologue of partitioning-defective 6 (Lspar6). The protein product LsPar6 shows high affinity for microtubules and localizes to the mitotic apparatus during embryonic cell division. In vitro assays revealed direct binding of LsPar6 to tubulin and microtubules, which is the first evidence of the direct interaction between the two proteins. The interaction is mediated by two distinct regions of LsPar6 both located in the N-terminal half. Atypical PKC, a functional partner of Par6, was also found to localize to the mitotic spindle. These results suggest that the L. stagnalis Par complex employs the microtubule network in cell polarity processes during the early embryogenesis. Identical sequence and localization of LsPar6 for the dextral and the sinistral snails exclude the possibility of the gene being the primary determinant of handedness.
On Innovation: A Theoretical Approach on the Challenges of Utilities Marketing
Directory of Open Access Journals (Sweden)
Florina PÎNZARU
2012-06-01
Full Text Available One of the markets not long ago closed and completely regulated is now in the growing process of liberalization and deregulation: it is the utilities market we refer to (water, sewege, gas, electricity, waste collection. The deregulation of a market is usually followed by the appearance of competition expression conditions and, unassailably, the occurrence of specific marketing strategies. This paper investigates the specific of utilities marketing as it develops now, an bourgeoning domain, although with a rather discreet presence in this field’s theoretical analysis studies. Exploratory research on the analysis type products, promotional offers and communication of this market’s players shows an effervescent players practice, but also a continuous innovation necessary in a market where consumers are unfamiliar with bein persuaded by commercial means
MARK/Par1 Kinase Is Activated Downstream of NMDA Receptors through a PKA-Dependent Mechanism.
Directory of Open Access Journals (Sweden)
Laura P Bernard
Full Text Available The Par1 kinases, also known as microtubule affinity-regulating kinases (MARKs, are important for the establishment of cell polarity from worms to mammals. Dysregulation of these kinases has been implicated in autism, Alzheimer's disease and cancer. Despite their important function in health and disease, it has been unclear how the activity of MARK/Par1 is regulated by signals from cell surface receptors. Here we show that MARK/Par1 is activated downstream of NMDA receptors in primary hippocampal neurons. Further, we show that this activation is dependent on protein kinase A (PKA, through the phosphorylation of Ser431 of Par4/LKB1, the major upstream kinase of MARK/Par1. Together, our data reveal a novel mechanism by which MARK/Par1 is activated at the neuronal synapse.
Magnussen, Synnøve; Hadler-Olsen, Elin; Latysheva, Nadezhda; Pirila, Emma; Steigen, Sonja E.; Hanes, Robert; Salo, Tuula; Winberg, Jan-Olof; Uhlin-Hansen, Lars; Svineng, Gunbjørg
2014-01-01
Background The urokinase plasminogen activator receptor (uPAR) is associated with poor prognosis in oral squamous cell carcinoma (OSCC), and increased expression of uPAR is often found at the invasive tumour front. The aim of the current study was to elucidate the role of uPAR in invasion and metastasis of OSCC, and the effects of various tumour microenvironments in these processes. Furthermore, we wanted to study whether the cells’ expression level of uPAR affected the activity of gelatinolytic enzymes. Methods The Plaur gene was both overexpressed and knocked-down in the murine OSCC cell line AT84. Tongue and skin tumours were established in syngeneic mice, and cells were also studied in an ex vivo leiomyoma invasion model. Soluble factors derived from leiomyoma tissue, as well as purified extracellular matrix (ECM) proteins, were assessed for their ability to affect uPAR expression, glycosylation and cleavage. Activity of gelatinolytic enzymes in the tissues were assessed by in situ zymography. Results We found that increased levels of uPAR did not induce tumour invasion or metastasis. However, cells expressing low endogenous levels of uPAR in vitro up-regulated uPAR expression both in tongue, skin and leiomyoma tissue. Various ECM proteins had no effect on uPAR expression, while soluble factors originating from the leiomyoma tissue increased both the expression and glycosylation of uPAR, and possibly also affected the proteolytic processing of uPAR. Tumours with high levels of uPAR, as well as cells invading leiomyoma tissue with up-regulated uPAR expression, all displayed enhanced activity of gelatinolytic enzymes. Conclusions Although high levels of uPAR are not sufficient to induce invasion and metastasis, the activity of gelatinolytic enzymes was increased. Furthermore, several tumour microenvironments have the capacity to induce up-regulation of uPAR expression, and soluble factors in the tumour microenvironment may have an important role in the
Directory of Open Access Journals (Sweden)
Synnøve Magnussen
Full Text Available The urokinase plasminogen activator receptor (uPAR is associated with poor prognosis in oral squamous cell carcinoma (OSCC, and increased expression of uPAR is often found at the invasive tumour front. The aim of the current study was to elucidate the role of uPAR in invasion and metastasis of OSCC, and the effects of various tumour microenvironments in these processes. Furthermore, we wanted to study whether the cells' expression level of uPAR affected the activity of gelatinolytic enzymes.The Plaur gene was both overexpressed and knocked-down in the murine OSCC cell line AT84. Tongue and skin tumours were established in syngeneic mice, and cells were also studied in an ex vivo leiomyoma invasion model. Soluble factors derived from leiomyoma tissue, as well as purified extracellular matrix (ECM proteins, were assessed for their ability to affect uPAR expression, glycosylation and cleavage. Activity of gelatinolytic enzymes in the tissues were assessed by in situ zymography.We found that increased levels of uPAR did not induce tumour invasion or metastasis. However, cells expressing low endogenous levels of uPAR in vitro up-regulated uPAR expression both in tongue, skin and leiomyoma tissue. Various ECM proteins had no effect on uPAR expression, while soluble factors originating from the leiomyoma tissue increased both the expression and glycosylation of uPAR, and possibly also affected the proteolytic processing of uPAR. Tumours with high levels of uPAR, as well as cells invading leiomyoma tissue with up-regulated uPAR expression, all displayed enhanced activity of gelatinolytic enzymes.Although high levels of uPAR are not sufficient to induce invasion and metastasis, the activity of gelatinolytic enzymes was increased. Furthermore, several tumour microenvironments have the capacity to induce up-regulation of uPAR expression, and soluble factors in the tumour microenvironment may have an important role in the regulation of posttranslational
Ulijn, J.M.; Lincke, A.; Wynstra, J.Y.F.
2004-01-01
Different business settings may induce different types of negotiation behavior. More specifically, clearly defined problems in an operations management (OM) setting may lead to different negotiation behavior than more diffuse innovation management (IM) problems. In addition, negotiators from
Learning morphological phenomena of Modern Greek an exploratory approach
Kotsanis, Y.; Dimitrios, A. Kokkinos; Manousopoulou, A.G.; Papakonstantinou, G.
1996-01-01
Educational technology is influenced by and closely related to the fields of generative epistemology, Artificial Intelligence, and the learning sciences. Relevant research literature refers to the term constructionism (Papert, 1993) and exploratory learning (diSessa et al, 1995). Constructionism and exploratory learning are a synthesis of the constructivist theory of Piaget and the opportunities offered by technology to education on thinking concretely, on learning while constructing intellig...
MARKETING AND INNOVATION: YOUNG PEOPLE'S ATTITUDE TOWARDS NEW PRODUCTS
Directory of Open Access Journals (Sweden)
Onisor Lucian-Florin
2012-07-01
Full Text Available This paper explores the perceptions of young students, who are training in the field of economics, to the very new products and outlines the role that marketing plays in bringing to market products based on innovative technologies. The study is conducted in Romania and tries to highlight Romanian specific features about the relationship between marketing and innovation. The goal is to outline in a clear and actual image of young people thoughts about new technologies insertion on the market. The pursued objectives are: motivation investigation of option for new products; determining predisposition to the radical or incremental innovations, assessing perceptions of the link between marketing and innovation. Research have been made in this field on various areas of activity. At the level of the European Community there are several organizations which activate in the field of innovation research. Eurobarometer through its subdivision Innobarometer brings in the attention of the public on a regular basis, through a series of publications, the results of researches undertaken from the business perspective, and are concerning all areas of action. Research aims to identify the impact that new technologies have on the consumers most open to innovation. This exploratory research is based on a direct gathering of information, using an online questionnaire. Data are processed using SPSS software package, and the results show the type and nature of links between variables to be examined by applying bivariate and multivariate correlation tests. Analysis report provides descriptive, easy to follow, for all the situations covered and investigated in the questionnaire. The results show a clear output of the relationship between compromises that those open to using new technologies are making to obtain superior advantages from the newest products on the market. Research carried out by the author being the first one in this area, only manages to outline the
2018-05-06T17:06:19Z https://www.ajol.info/index.php/all/oai oai:ojs ...
African Journals Online (AJOL)
article/86634 2018-05-06T17:06:19Z wajiar:ART Managing Associated Risks in Cloud Computer Applications Souley, B Umara, AM Google App Engine, Java Programming Language, cloud infrastructure Cloud Computing, the long-held dream of ...
Innovative learning for innovation
Dr.Ir. Hay Geraedts
2010-01-01
Introduction Innovation is crucial for companies who have to react to constantly changing markets. Several national and European research institutes stress the importance of developing innovation for small and medium size enterprises (SMEs). This was a trigger to design a minor on strategic
Directory of Open Access Journals (Sweden)
F. de la Torre Silva
2008-01-01
Full Text Available Este trabajo muestra el estudio realizado en turbinas de vapor de pequeña capacidad de generación de las centrales termoeléctricas cubanas, relacionadas con la influencia estadística entre parámetros de proceso de la turbina, respecto al parámetro vibración absoluta, medidos en las chumaceras de la turbina. Se utilizan las bases de datos de los sistemas de monitoreado on-line de la turbina. Se exponen las relaciones existentes entre los principales parámetros seleccionados para este estudio.This work show the study in small steam turbine capacity of generation in cubans thermoelectric power station to relative with statistical influence between steam process parameters regarding absolute vibration parameter, in the steam housing measurements. Themselves use database as steam on-line monitoring systems. Expose the existing relation between the principal selection parameters for this study.
Contamination potentielle des aliments par des ...
African Journals Online (AJOL)
SARA Computers
la notion de la pollution et de l'exposition aux PCBs, lorsque 77% n'ont pas conscience de cette situation de risque ... 2018). Quoique la contamination par les. PCBs soit de faible niveau, elle est ...... Université Paris-Est, Paris, France ; 183.
Branching innovation, recombinant innovation, and endogenous technological transitions
Frenken, K.; Izquierdo, L.; Zeppini, P.
2012-01-01
We propose a model of technological transitions based on two different types of innovations. Branching innovations refer to technological improvements along a particular path, while recombinant innovations represent fusions of multiple paths. Recombinant innovations create "short-cuts" which reduce
Directory of Open Access Journals (Sweden)
Margarida Saraiva-Neves
2006-12-01
Full Text Available In this paper we present findings of an exploratory study, included in a wider investigation which intends to promote meaningful learning of physics concepts, based on experimental work and supported by metacognition tools. The aim of this research was to recognize promoting learning situations in Physics lab. Interviews and questionnaires were applied to teachers and students from four Lisbon high schools. Results show that lab work in physics has a low frequency and, generally, has a demonstration format. Both teachers and students recognize potentialities of lab work to promote learning. Learning is poor when students just observe and/or accomplish commands. Both teachers and students consider the relation theory/experimentation and students doing themselves as fundamental to achieve better learning. In addition to pointing out several problems concerning lab work, teachers envisage it in a very traditional way. So, innovative strategies and methodologies, such as computer use and open-ended problems, pointed by research in science investigation as promoting learning, are left aside.
Directory of Open Access Journals (Sweden)
Faruk Ülgen
2012-11-01
Full Text Available Le présent article pose la question de savoir si les innovations financières peuvent être pensées dans le cadre du processus de destruction créatrice. Dans cet objectif, la dynamique schumpeterienne de l’économie capitaliste est interprétée en termes d’une économie monétaire dans laquelle les innovations bancaires et financières affectent structurellement les activités entrepreneuriales et jouent un rôle crucial sur la stabilité macroéconomique. À l’opposé des effets, souvent jugés positifs, des innovations des entrepreneurs schumpeteriens sur la croissance, les marchés financiers libéralisés génèrent des déséquilibres cumulés à travers le développement d’une financiarisation spéculative qui peut être étudiée en termes de la deuxième vague des cycles schumpeteriens. Le processus de destruction créatrice des innovations peut se transformer en une création destructrice. Par conséquent, la redéfinition des mécanismes de régulation dans une optique minskienne s’avère nécessaire pour faire face aux déséquilibres macroéconomiques.This paper asks the question to know if financial innovations can be thought within the framework of a creative destruction process. In this aim, the Schumpeterian dynamics of the capitalist economy is studied in terms of a monetary economy where banking and financial innovations affect structurally entrepreneurs’ activities and play a crucial role on the macroeconomic stability. Contrary to the effects, usually assumed to be positive, of innovations of the Schumpeterian entrepreneurs on the growth, liberalized financial markets generate accumulated imbalances through the development of a speculative financialization which can be studied in terms of the second wave of Schumpeterian business cycles. The process of creative destruction of innovations may turn to be a destructive creation. Then, redefining of regulatory mechanisms in a Minskian perspective seems to be
46 CFR 57.06-5 - Production toughness testing.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Production toughness testing. 57.06-5 Section 57.06-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE ENGINEERING WELDING AND BRAZING Production Tests § 57.06-5 Production toughness testing. (a) In addition to the test specimens required by...
Directory of Open Access Journals (Sweden)
F. Marchesi
2011-01-01
Full Text Available Translocation t(4;11(q21;q23 leading to formation of MLL-AF4 fusion gene is found in about 10% of newly diagnosed B-cell acute lymphoblastic leukemia (ALL in adult patients. Patients expressing this chromosomal aberration present typical biological, immunophenotypic, and clinical features. This form of leukemia is universally recognized as high-risk leukemia and treatment intensification with allogeneic hematopoietic stem cell transplantation (HSCT in first complete remission (CR could be a valid option to improve prognosis, but data obtained from the literature are controversial. In this review, we briefly describe pathogenetic, clinical, and prognostic characteristics of adult t(4;11(q21;q23/MLL-AF4 positive ALL and provide a review of the clinical outcome reported by the most important cooperative groups worldwide.
Accouchement par césarienne et mortalité maternelle du postpartum
Deneux-Tharaux , Catherine; Carmona , Elodie; Bouvier-Colle , Marie-Hélène; Bréart , Gérard
2006-01-01
Objectifs Une augmentation continue du taux d'accouchements par césarienne (CS)est observée dans la plupart des pays depuis 20 ans. Cette évolution a suscité l'émergence d'un débat controversé sur les risques et les bénéfices associés à la CS. L'objectif de cette étude était d'estimer le risque de mort maternelle du postpartum lié directement à la CS par comparaison à l'accouchement par voie basse, globalement et en distinguant les CS pre- ou intra- partum . Méthode Etude cas/témoins. Les cas...
Prise en charge des intoxications par envenimation chez les enfants ...
African Journals Online (AJOL)
Les signes cliniques étaient dominés par les douleurs (98%) suivies des hémorragies (73,80%) pour les morsures de serpent, la douleur pour les piqures de scorpion (100%) et les oedèmes pour les piqures d'abeilles (100%). Les cas de morsure de serpent ont été traités par le sérum antivenimeux polyvalent. Conclusion: ...
Strengthening regional innovation through network-based innovation brokering
Svare, Helge; Gausdal, Anne Haugen
2015-01-01
The primary objective of this paper is to demonstrate how regional innovation system theory may be translated into manageable micro-level methods with the potential for strengthening the productive dynamics of a regional innovation system. The paper meets this objective by presenting network-based innovation brokering (NBIB), a practical method designed using insights from regional innovation system theory and trust theory. Five cases from two Norwegian regional innovation networks show that ...
Otolith dysfunction alters exploratory movement in mice.
Blankenship, Philip A; Cherep, Lucia A; Donaldson, Tia N; Brockman, Sarah N; Trainer, Alexandria D; Yoder, Ryan M; Wallace, Douglas G
2017-05-15
The organization of rodent exploratory behavior appears to depend on self-movement cue processing. As of yet, however, no studies have directly examined the vestibular system's contribution to the organization of exploratory movement. The current study sequentially segmented open field behavior into progressions and stops in order to characterize differences in movement organization between control and otoconia-deficient tilted mice under conditions with and without access to visual cues. Under completely dark conditions, tilted mice exhibited similar distance traveled and stop times overall, but had significantly more circuitous progressions, larger changes in heading between progressions, and less stable clustering of home bases, relative to control mice. In light conditions, control and tilted mice were similar on all measures except for the change in heading between progressions. This pattern of results is consistent with otoconia-deficient tilted mice using visual cues to compensate for impaired self-movement cue processing. This work provides the first empirical evidence that signals from the otolithic organs mediate the organization of exploratory behavior, based on a novel assessment of spatial orientation. Copyright © 2017 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Hui-Lin Mao
2017-11-01
Full Text Available Objective: To study the regulating effect of Par-4 gene overexpression on the nephroblastoma sensitivity to cisplatin. Methods: Nephroblastoma SK-NEP-1 cells were cultured and divided into four groups, control group were treated with RMPI-1640 without serum or drugs, cisplatin group were treated with serum-free RMPI-1640 containing 5 μg/mL cisplatin, Par-4 group were transfected by Par-4 overexpression plasmids with serum-free RMPI-1640, and cisplatin + Par-4 group were transfected by Par-4 overexpression plasmid with serum-free RMPI-1640 containing 5 μg/mL cisplatin. The cell proliferation activity as well the expression of apoptosis genes, migration genes and invasion genes was measured. Results: 8 h, 16 h and 24 h after different conditions of treatment, the cell proliferation activity of cisplatin group, Par-4 group and cisplatin + Par-4 group were significantly lower than that of control group, and the cell proliferation activity of cisplatin + Par-4 group was significantly lower than that of cisplatin group and Par-4 group; 24 h after different conditions of treatment, Bim, PDCD4, WT1, RGS4, Axin, KAI1, E-cadherin, PPARγ and PTEN mRNA expression in cisplatin group, Par-4 group and cisplatin + Par-4 group were greatly higher than those in control group whereas GDNF, GFRα1, TUBB3, NME1 and FGF1 mRNA expression were greatly lower than those in control group; Bim, PDCD4, WT1, RGS4, Axin, KAI1, E-cadherin, PPARγ and PTEN mRNA expression in cisplatin + Par-4 group were greatly higher than those in cisplatin group and Par-4 group whereas GDNF, GFRα1, TUBB3, NME1 and FGF1 mRNA expression were greatly significantly lower than those in cisplatin group and Par-4 group. Conclusion: Par-4 gene overexpression can increase the nephroblastoma sensitivity to cisplatin, reduce cell proliferation activity, promote apoptosis and inhibit cell migration and invasion.
Nanomechanical recognition of prognostic biomarker suPAR with DVD-ROM optical technology
International Nuclear Information System (INIS)
Bache, Michael; Bosco, Filippo G; Brøgger, Anna L; Frøhling, Kasper B; Boisen, Anja; Alstrøm, Tommy Sonne; Hwu, En-Te; Chen, Ching-Hsiu; Hwang, Ing-Shouh; Eugen-Olsen, Jesper
2013-01-01
In this work the use of a high-throughput nanomechanical detection system based on a DVD-ROM optical drive and cantilever sensors is presented for the detection of urokinase plasminogen activator receptor inflammatory biomarker (uPAR). Several large scale studies have linked elevated levels of soluble uPAR (suPAR) to infectious diseases, such as HIV, and certain types of cancer. Using hundreds of cantilevers and a DVD-based platform, cantilever deflection response from antibody–antigen recognition is investigated as a function of suPAR concentration. The goal is to provide a cheap and portable detection platform which can carry valuable prognostic information. In order to optimize the cantilever response the antibody immobilization and unspecific binding are initially characterized using quartz crystal microbalance technology. Also, the choice of antibody is explored in order to generate the largest surface stress on the cantilevers, thus increasing the signal. Using optimized experimental conditions the lowest detectable suPAR concentration is currently around 5 nM. The results reveal promising research strategies for the implementation of specific biochemical assays in a portable and high-throughput microsensor-based detection platform. (paper)
The Search Performance Evaluation and Prediction in Exploratory Search
LIU, FEI
2016-01-01
The exploratory search for complex search tasks requires an effective search behavior model to evaluate and predict user search performance. Few studies have investigated the relationship between user search behavior and search performance in exploratory search. This research adopts a mixed approach combining search system development, user search experiment, search query log analysis, and multivariate regression analysis to resolve the knowledge gap. Through this study, it is shown that expl...
Culture's influence on consumers : exploratory behavior and risk taking
Soares, Ana Maria; Farhangmehr, Minoo; Shoham, Aviv
2003-01-01
This theoretical paper addresses the influence of culture on risk taking and exploratory behavior. The cultural dimensions of long-term orientation, power distance, uncertainty avoidance, collectivism, and masculinity (Hofstede, 1984, 2001) are hypothesized to influence risk-taking behavior in general, and, through it, exploratory consumption behavior, risk taking, and risk attitudes and perception towards specific products. We also propose an empirical study to test the emergent model. Fu...
Effect of a physical activity intervention on suPAR levels
DEFF Research Database (Denmark)
Rohde, Christopher; Polcwiartek, Christoffer; Andersen, Eivind
2018-01-01
OBJECTIVES: Soluble urokinase-type plasminogen activator receptor (suPAR) is a novel inflammatory marker, associated with lifestyle diseases and mortality risk. No studies have investigated whether physical activity may reduce suPAR levels using a randomized controlled design. DESIGN AND METHODS......: suPAR and C-reactive protein (CRP) levels were determined in blood samples from a previous randomized controlled trial with Pakistani immigrants in Norway, 2008. The study included physically inactive men that were randomized to an intervention group (supervised group exercises) or a control group...... and followed for 5 months. A linear regression model was used and adjusted for age, inactivity level at baseline, and mean difference in CRP levels. RESULTS: Overall, 80 and 53 participants were included in the intervention and control group, respectively. Obesity and smoking were associated with higher su...
uPAR Expression Pattern in Patients with Urothelial Carcinoma of the Bladder
DEFF Research Database (Denmark)
Dohn, Line Hammer; Pappot, Helle; Iversen, Benedikte Richter
2015-01-01
The objective of the present study was to confirm the expression and localisation pattern of the urokinase-type plasminogen activator receptor (uPAR) focusing on its possible clinical relevance in patients with urothelial neoplasia of the bladder. uPAR is a central molecule in tissue remodelling...... during cancer invasion and metastasis and is an established prognostic marker in various cancer diseases other than bladder cancer. Formalin-fixed and paraffin-embedded tumour-tissue blocks from 186 patients treated with radical cystectomy were analysed. uPAR expression was scored as either negative...... or positive as well as by the actual score. Separate scores were obtained for cancer cells, macrophages and myofibroblasts at the invasive front and in tumour core. We were able to confirm, in an independent patient cohort, the tissue expression and localisation pattern of uPAR as investigated...
Exploratory Research and Development Fund, FY 1990
International Nuclear Information System (INIS)
1992-05-01
The Lawrence Berkeley Laboratory Exploratory R ampersand D Fund FY 1990 report is compiled from annual reports submitted by principal investigators following the close of the fiscal year. This report describes the projects supported and summarizes their accomplishments. It constitutes a part of an Exploratory R ampersand D Fund (ERF) planning and documentation process that includes an annual planning cycle, projection selection, implementation, and review. The research areas covered in this report are: Accelerator and fusion research; applied science; cell and molecular biology; chemical biodynamics; chemical sciences; earth sciences; engineering; information and computing sciences; materials sciences; nuclear science; physics and research medicine and radiation biophysics
Ingegnoli, Francesca; Boracchi, Patrizia; Gualtierotti, Roberta; Smith, Vanessa; Cutolo, Maurizio; Foeldvari, Ivan
2015-11-01
Qualitative capillaroscopy patterns in juvenile- and adult-onset systemic sclerosis (SSc) were studied in adulthood using data from the EULAR Scleroderma Trials and Research (EUSTAR) database. Data collected between June 2004 and April 2013 were examined with focus on capillaroscopy. In this retrospective exploratory study, series of patients with juvenile-onset SSc were matched with series of adult-onset SSc having the same gender and autoantibody profile. 30 of 123 patients with juvenile-onset and 2108 of 7133 with adult-onset SSc had data on capillaroscopy. Juvenile-onset SSc showed scleroderma pattern more frequently than adult-onset SSc (93.3% and 88%). The OR was 2.44 and 95% CI 0.57-10.41. An active scleroderma pattern was present in 58% of juvenile- and 61% of adult-onset SSc. The OR was 0.91 and 95% CI 0.28-2.93. The late scleroderma pattern was present in 61% of juvenile- and 55.5% of adult-onset SSc. The OR was 1.06 and 95% CI 0.34-3.56. This is the first exploratory study on the comparison of capillaroscopy between juvenile- and adult-onset SSc in adulthood. Juvenile-onset SSc had an increase prevalence of scleroderma pattern, but a similar distribution of the three patterns was suggested. Further studies are needed to define this issue. Copyright © 2015 Elsevier Inc. All rights reserved.
2018-05-06T06:53:16Z https://www.ajol.info/index.php/all/oai oai:ojs ...
African Journals Online (AJOL)
article/41690 2018-05-06T06:53:16Z ijer:ART Responses of African Universities to HIV and Aids: Students' Perspectives from University of Cape Coast, Ghana Ocansey, F This study sought to determine the views of students of University of Cape ...
Internal Determinants of Product Innovation and Management Innovation
Harder, Mie
2011-01-01
This paper adopts a behavioral theory of the firm perspective in order to compare the antecedents of two types of innovation: Management innovation refers to the adoption of new management practices or organizational structures, whereas product innovation refers to the introduction of new products or services on the market. The study further distinguishes between two categories of innovation within each type: new to the firm and new to the industry innovations. The findings indica...
Analogical Thinking for Generation of Innovative Ideas: An Exploratory Study of Influential Factors
Directory of Open Access Journals (Sweden)
Eunyoung Kim
2016-07-01
Full Text Available Analogical thinking is one of the most effective tools to generate innovative ideas. It enables us to develop new ideas by transferring information from well-known domains and utilizing them in a novel domain. However, using analogical thinking does not always yield appropriate ideas, and there is a lack of consensus among researchers regarding the evaluation methods for assessing new ideas. Here, we define the appropriateness of generated ideas as having high structural and low superficial similarities with their source ideas. This study investigates the relationship between thinking process and the appropriateness of ideas generated through analogical thinking. We conducted four workshops with 22 students in order to collect the data. All generated ideas were assessed based on the definition of appropriateness in this study. The results show that participants who deliberate more before reaching the creative leap stage and those who are engaged in more trial and error for deciding the final domain of a new idea have a greater possibility of generating appropriate ideas. The findings suggest new strategies of designing workshops to enhance the appropriateness of new ideas.
Directory of Open Access Journals (Sweden)
JHON WILDER ZARTHA SOSSA
2009-12-01
Full Text Available El proyecto contempló en una forma preliminar, el análisis de los indicadores de innovación de empresas del sector de elaboración de productos alimenticios*, según la encuesta del DANE [1] en donde se clasifican las empresas por su grado de innovación. Posteriormente se analizaron los fundamentos matemáticos de la difusión de la innovación tecnológica en tres empresas del sector agroindustrial de Colombia, así como las variables involucradas en este fenómeno; para ello se estudiaron los parámetros de desempeño, ventas y producción en el tiempo, los cuales presentan un comportamiento de curvas en "S" o curva logística con el fin de poder analizar los puntos de inflexión y otros parámetros de innovaciones tecnológicas a través de correlaciones matemáticas. Para analizar las curvas en "S" se tomaron varios modelos matemáticos de distribución logística y luego de encontrar el que se ajustó a los datos de las empresas se procedió a realizar la correlación empleando el software Statgraphics; con esta herramienta se encontraron los valores de las constantes que existen en el modelo. Con las curvas generadas por los datos obtenidos en el sector agroindustrial, con series de tiempos entre uno y cinco años y con los valores de las constantes se analizaron los puntos de inflexión, parámetros de crecimiento y las asíntotas de cada una de las curvas en "S" propuestas, y se generaron conclusiones relacionadas con ciclos de innovación, estrategia de mercadeo, tiempos para la protección de innovaciones y otros parámetros de desempeño que son útiles para las empresas del sector.This project looked at, in a preliminary phase, the innovation indicators analysis for companies from food manufacturing sector according to the survey by DANE in this survey the companies are classified according its innovation level. After that, the mathematical foundations of the technological innovation diffusion were analyzed in three companies
uPA/uPAR system activation drives a glycolytic phenotype in melanoma cells.
Laurenzana, Anna; Chillà, Anastasia; Luciani, Cristina; Peppicelli, Silvia; Biagioni, Alessio; Bianchini, Francesca; Tenedini, Elena; Torre, Eugenio; Mocali, Alessandra; Calorini, Lido; Margheri, Francesca; Fibbi, Gabriella; Del Rosso, Mario
2017-09-15
In this manuscript, we show the involvement of the uPA/uPAR system in the regulation of aerobic glycolysis of melanoma cells. uPAR over-expression in human melanoma cells controls an invasive and glycolytic phenotype in normoxic conditions. uPAR down-regulation by siRNA or its uncoupling from integrins, and hence from integrin-linked tyrosine kinase receptors (IL-TKRs), by an antagonist peptide induced a striking inhibition of the PI3K/AKT/mTOR/HIF1α pathway, resulting into impairment of glucose uptake, decrease of several glycolytic enzymes and of PKM2, a checkpoint that controls metabolism of cancer cells. Further, binding of uPA to uPAR regulates expression of molecules that govern cell invasion, including extracellular matrix metallo-proteinases inducer (EMPPRIN) and enolase, a glycolytyc enzyme that also serves as a plasminogen receptor, thus providing a common denominator between tumor metabolism and phenotypic invasive features. Such effects depend on the α5β1-integrin-mediated uPAR connection with EGFR in melanoma cells with engagement of the PI3K-mTOR-HIFα pathway. HIF-1α trans-activates genes whose products mediate tumor invasion and glycolysis, thus providing the common denominator between melanoma metabolism and its invasive features. These findings unveil a unrecognized interaction between the invasion-related uPAR and IL-TKRs in the control of glycolysis and disclose a new pharmacological target (i.e., uPAR/IL-TKRs axis) for the therapy of melanoma. © 2017 UICC.
Directory of Open Access Journals (Sweden)
Pamela Beach
2014-08-01
Full Text Available This qualitative study examined an innovative methodology, combining screen capture technology and a retrospective think aloud, for exploring the use of Internet-based resources by elementary teachers. Pre-service and in-service teachers explored The Balanced Literacy Diet, a free, interactive, and evidenced-informed professional development website. As participants navigated through this complex site, each visual step was captured using Camtasia Studio, a screen recording computer software program developed by TechSmith. Immediately following their 10-minute exploration, participants revisited their online choices virtually and verbalized their thoughts while viewing their screen recording. Qualitative analysis confirmed the usefulness of the methodology and provided insights about the factors that motivate teachers to use professional development websites. Results of the analysis can contribute to the ongoing development of high quality online learning environments. Cette étude qualitative s’est penchée sur une méthodologie innovatrice combinant les technologies de saisie d’écran et la pensée rétrospective à voix haute pour l’exploration de l’utilisation des ressources dans Internet par les enseignants de l’élémentaire. Des enseignants en formation initiale et des enseignants sur place ont exploré The Balanced Literacy Diet, un site Web de perfectionnement professionnel gratuit, interactif et s’appuyant sur des données probantes. Tandis que les participants naviguaient dans ce site complexe, chaque étape visuelle était captée à l’aide de Camtasia Studio, un logiciel d’enregistrement de l’écran développé par TechSmith. Immédiatement après leur exploration de 10 minutes, les participants ont revisité virtuellement leurs choix en ligne et ont verbalisé leurs réflexions en regardant l’enregistrement de l’écran. L’analyse qualitative a confirmé l’utilité de la méthodologie et a fourni des
Directory of Open Access Journals (Sweden)
Line Hammer Dohn
Full Text Available The objective of the present study was to confirm the expression and localisation pattern of the urokinase-type plasminogen activator receptor (uPAR focusing on its possible clinical relevance in patients with urothelial neoplasia of the bladder. uPAR is a central molecule in tissue remodelling during cancer invasion and metastasis and is an established prognostic marker in various cancer diseases other than bladder cancer. Formalin-fixed and paraffin-embedded tumour-tissue blocks from 186 patients treated with radical cystectomy were analysed. uPAR expression was scored as either negative or positive as well as by the actual score. Separate scores were obtained for cancer cells, macrophages and myofibroblasts at the invasive front and in tumour core. We were able to confirm, in an independent patient cohort, the tissue expression and localisation pattern of uPAR as investigated by Immunohistochemistry as well as a significant association between uPAR positivity and increasing tumour stage and tumour grade. This demonstrates the robustness of our previous and current findings. In addition the association between uPAR positive myofibroblasts and poor survival was reproduced. The highest hazard ratios for survival were seen for uPAR positive myofibroblasts both at the invasive front and in tumour core. Evaluating uPAR expression by the actual score showed a significant association between uPAR positive myofibroblasts in tumour core and an increased risk of cancer specific mortality. Our investigations have generated new and valuable biological information about the cell types being involved in tumour invasion and progression through the plasminogen activation system.
2010-04-01
... the cost reimbursement payment system if a continuous 9-month period of substantial gainful activity... Systems § 411.582 Can a State VR agency receive payment under the cost reimbursement payment system if a... under the cost reimbursement payment system under subpart V of part 404 (or subpart V of part 416) of...
Workplace innovation and social innovation : an introduction
Jürgen Howaldt; Dr. Ben Fruytier; Peter R.A. Oeij; Steven Dhondt
2016-01-01
This is the introduction to the special issue of World Review of Entrepreneurship, Management and Sustainable Development (WREMSD) dedicated to workplace innovation and social innovation related to work and organisation. As technological and business model innovations alone are not sufficient to
Workplace innovation and social innovation: an introduction
Howaldt, J.; Oeij, P.R.A.; Dhondt, S.; Fruytier, B.
2016-01-01
This is the introduction to this special issue of World Review of Entrepreneurship, Management and Sustainable Development (WREMSD) dedicated to workplace innovation and social innovation related to work and organisation. As technological and business model innovations alone are not sufficient to