Potau, J M; Arias-Martorell, J; Bello-Hellegouarch, G; Casado, A; Pastor, J F; de Paz, F; Diogo, R
2018-01-01
We have analyzed anatomic variations in the pectoralis major and pectoralis minor muscles of common chimpanzees (Pan troglodytes) and bonobos (Pan paniscus) and compared them to anatomic variations in these muscles in humans (Homo sapiens) . We have macroscopically dissected these muscles in six adult Pan troglodytes , five Pan paniscus of ages ranging from fetus to adult, and five adult Homo sapiens . Although Pan troglodytes are thought to lack a separate pectoralis abdominis muscle, we have identified this muscle in three of the Pan troglodytes ; none of the Pan paniscus , however, had this muscle. We have also found deep supernumerary fascicles in the pectoralis major of two Pan troglodytes and all five Pan paniscus . In all six Pan troglodytes , the pectoralis minor was inserted at the supraspinatus tendon, while, in Pan paniscus and Homo sapiens , it was inserted at the coracoid process of the scapula. Some of the anatomic features and variations of these muscles in common chimpanzees and bonobos are similar to those found in humans, therefore enhancing our knowledge of primate comparative anatomy and evolution and also shedding light on several clinical issues.
Directory of Open Access Journals (Sweden)
J. M. Potau
2018-01-01
Full Text Available We have analyzed anatomic variations in the pectoralis major and pectoralis minor muscles of common chimpanzees (Pan troglodytes and bonobos (Pan paniscus and compared them to anatomic variations in these muscles in humans (Homo sapiens. We have macroscopically dissected these muscles in six adult Pan troglodytes, five Pan paniscus of ages ranging from fetus to adult, and five adult Homo sapiens. Although Pan troglodytes are thought to lack a separate pectoralis abdominis muscle, we have identified this muscle in three of the Pan troglodytes; none of the Pan paniscus, however, had this muscle. We have also found deep supernumerary fascicles in the pectoralis major of two Pan troglodytes and all five Pan paniscus. In all six Pan troglodytes, the pectoralis minor was inserted at the supraspinatus tendon, while, in Pan paniscus and Homo sapiens, it was inserted at the coracoid process of the scapula. Some of the anatomic features and variations of these muscles in common chimpanzees and bonobos are similar to those found in humans, therefore enhancing our knowledge of primate comparative anatomy and evolution and also shedding light on several clinical issues.
Potau, J. M.; Arias-Martorell, J.; Bello-Hellegouarch, G.; Casado, A.; Pastor, J. F.; de Paz, F.; Diogo, R.
2018-01-01
We have analyzed anatomic variations in the pectoralis major and pectoralis minor muscles of common chimpanzees (Pan\\ud troglodytes) and bonobos(Pan paniscus) and compared them to anatomic variations in these muscles in humans(Homo sapiens). We\\ud have macroscopically dissected these muscles in six adult Pan troglodytes, five Pan paniscus of ages ranging from fetus to adult, and\\ud five adult Homo sapiens. Although Pan troglodytes are thought to lack a separate pectoralis abdominis muscle, we...
Can Chimpanzees ("Pan troglodytes") Discriminate Appearance from Reality?
Krachun, Carla; Call, Josep; Tomasello, Michael
2009-01-01
A milestone in human development is coming to recognize that how something looks is not necessarily how it is. We tested appearance-reality understanding in chimpanzees ("Pan troglodytes") with a task requiring them to choose between a small grape and a big grape. The apparent relative size of the grapes was reversed using magnifying and…
Measurements of postnatal growth of the skull of Pan troglodytes verus using lateral cephalograms.
Arnold, Wolfgang H; Protsch von Zieten, Reiner; Schmidt, Ekehard
2003-03-01
The postnatal growth of the viscerocranium in relation to the neurocranium of Pan troglodytes verus has been investigated using standardized lateral cephalograms. Sex and age were determined on the basis of cranial morphology and the skulls were divided into four age groups: infantile, juvenile, subadult and adult. The cephalograms were traced on transparencies and specific anatomical landmarks were identified for the measurement of lines angles and the area of the neurocranium and viscerocranium. The results showed that the skull of Pan troglodytes verus exhibits klinorhynchy. During postnatal growth it develops towards airorhynchy, but never shows true airorhynchy. In the infantile age group the measured area of the neurocranium is larger than that of the viscerocranium. The measured area of the viscerocranium increases until adulthood and is larger than that of the neurocranium in the subadult and adult group. From the results we conclude that in Pan troglodytes verus growth of the neurocranium seizes early in juvenile individuals, whereas the viscerocranium grows until adulthood. This may reflect an adaptation to the masticatory system.
Czech Academy of Sciences Publication Activity Database
Kalousová, B.; Piel, A. K.; Pomajbíková, Kateřina; Modrý, David; Stewart, F.A.; Petrželková, Klára Judita
2014-01-01
Roč. 35, č. 2 (2014), s. 463-475 ISSN 0164-0291 Institutional support: RVO:60077344 Keywords : hominoid * Pan troglodytes schweinfurthii * gastrointestinal parasites * savanna * Spirurids * transmission * Ugalla * Tanzania Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.993, year: 2014
Potau, J M; Casado, A; de Diego, M; Ciurana, N; Arias-Martorell, J; Bello-Hellegouarch, G; Barbosa, M; de Paz, F J; Pastor, J F; Pérez-Pérez, A
2018-04-21
To analyze the muscle architecture and the expression pattern of the myosin heavy chain (MyHC) isoforms in the supraspinatus of Pan troglodytes and Homo sapiens in order to identify differences related to their different types of locomotion. We have analyzed nine supraspinatus muscles of Pan troglodytes and ten of Homo sapiens. For each sample, we have recorded the muscle fascicle length (MFL), the pennation angle, and the physiological cross-sectional area (PCSA). In the same samples, by real-time quantitative polymerase chain reaction, we have assessed the percentages of expression of the MyHC-I, MyHC-IIa, and MyHC-IIx isoforms. The mean MFL of the supraspinatus was longer (p = 0.001) and the PCSA was lower (p sapiens than in Pan troglodytes. Although the percentage of expression of MyHC-IIa was lower in Homo sapiens than in Pan troglodytes (p = 0.035), the combination of MyHC-IIa and MyHC-IIx was expressed at a similar percentage in the two species. The longer MFL in the human supraspinatus is associated with a faster contractile velocity, which reflects the primary function of the upper limbs in Homo sapiens-the precise manipulation of objects-an adaptation to bipedal locomotion. In contrast, the larger PCSA in Pan troglodytes is related to the important role of the supraspinatus in stabilizing the glenohumeral joint during the support phase of knuckle-walking. These functional differences of the supraspinatus in the two species are not reflected in differences in the expression of the MyHC isoforms. © 2018 Wiley Periodicals, Inc.
Czech Academy of Sciences Publication Activity Database
Kalousová, B.; Piel, A. K.; Pomajbíková, K.; Modrý, D.; Stewart, F. A.; Petrželková, Klára Judita
2014-01-01
Roč. 35, č. 2 (2014), s. 436-475 ISSN 0164-0291 R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:68081766 Keywords : Hominoid * Pan troglodytes schweinfurthii * Gastrointestinal parasites * Savanna * Spirurids * Transmission * Ugalla * Tanzania Subject RIV: EG - Zoology Impact factor: 1.993, year: 2014
Drakulovski, Pascal; Bertout, Sébastien; Locatelli, Sabrina; Butel, Christelle; Pion, Sébastien; Mpoudi-Ngole, Eitel; Delaporte, Eric; Peeters, Martine; Mallié, Michèle
2014-07-01
We tested 114 faecal samples from wild simian immunodeficiency virus (SIV)-positive (n = 43) and SIV-negative (n = 71) chimpanzees (Pan troglodytes troglodytes) in southeast Cameroon for the presence of gastrointestinal parasites by direct smear. We observed cysts from different protozoa (Entamoeba coli and Entamoeba histolytica / Entamoeba dispar, Endolimax nana, Iodamoeba butschlii, Chilomastix mesnili, Balantidium coli and Blastocystis cells) and trophozoites from Troglodytella abrassarti and Balantidium coli. Eggs from different helminths (strongylids, Ascaris lumbricoides, Abbreviata caucasica, Trichuris sp., Capillaria sp., Enterobius anthropopeci, Bertiella sp., Hymenolepis diminuta and an undetermined fluke) were also observed. Finally, we observed eggs that could not be properly identified and classified. We did not observe any differences between the SIV+ and SIV- samples except for the unidentified eggs. The studied chimpanzees were highly parasitised by strongylid (85.1% of prevalence), Troglodytella (43.8%) and Blastocystis (2.9%), and the frequency of the other parasites ranged from 0.9 to 8.8%. These high levels of parasite infections could represent an additional burden in a population where there is a high rate of the SIV virus in circulation.
Role of lianas for introduced chimpanzees (Pan troglodytes) on Rubondo Island, Tanzania
Czech Academy of Sciences Publication Activity Database
Moscovice, L. R.; Petrželková, Klára Judita; Issa, M. H.; Huffman, M. A.; Snowdon, C. T.; Mbago, F.; Kaur, T.; Singh, J.; Graziani, G.
2004-01-01
Roč. 75, S1 (2004), s. 308 ISSN 0015-5713. [Congress of the International Primatological Society /20./. Torino, 22.08.2004-28.08.2004] Institutional research plan: CEZ:AV0Z6093917 Keywords : Pan troglodytes * reintroduction * Rubondo Subject RIV: EH - Ecology, Behaviour Impact factor: 0.913, year: 2004
The chromosomal radiosensitivity of lymphocytes from the chimpanzee (Pan troglodytes)
International Nuclear Information System (INIS)
Leonard, A.; Decat, G.; Leonard, E.D.; Mortelmans, J.
1977-01-01
The yield of chromosomal aberrations induced by exposure to X-irradiation in vitro was studied in the lymphocytes of the chimpanzee (Pan troglodytes), a hominoid ape phylogenically and chromosomally closely related to man. In agreement with the similarity of the chromosome characteristics, no significant difference was observed between man and chimpanzee with respect to the incidence of dicentrics and fragments. It is obvious that the nuclear area, which apparently constitutes the most evident difference between the nuclei of man and chimpanzee lymphocytes, did not play an important role in the yields of aberrations
Poti, Patrizia; Hayashi, Misato; Matsuzawa, Tetsuro
2009-01-01
Spatial construction tasks are basic tests of visual-spatial processing. Two studies have assessed spatial construction skills in chimpanzees (Pan troglodytes) and young children (Homo sapiens sapiens) with a block modelling task. Study 1a subjects were three young chimpanzees and five adult chimpanzees. Study 1b subjects were 30 human children…
Directory of Open Access Journals (Sweden)
Aghokeng Avelin F
2011-01-01
Full Text Available Abstract Background Data on the evolution of natural SIV infection in chimpanzees (SIVcpz and on the impact of SIV on local ape populations are only available for Eastern African chimpanzee subspecies (Pan troglodytes schweinfurthii, and no data exist for Central chimpanzees (Pan troglodytes troglodytes, the natural reservoir of the ancestors of HIV-1 in humans. Here, we report a case of naturally-acquired SIVcpz infection in a P.t.troglodytes chimpanzee with clinical and biological data and analysis of viral evolution over the course of infection. Results A male chimpanzee (Cam155, 1.5 years, was seized in southern Cameroon in November 2003 and screened SIV positive during quarantine. Clinical follow-up and biological analyses have been performed for 7 years and showed a significant decline of CD4 counts (1,380 cells/mm3 in 2004 vs 287 in 2009, a severe thrombocytopenia (130,000 cells/mm3 in 2004 vs 5,000 cells/mm3 in 2009, a weight loss of 21.8% from August 2009 to January 2010 (16 to 12.5 kg and frequent periods of infections with diverse pathogens. DNA from PBMC, leftover from clinical follow-up samples collected in 2004 and 2009, was used to amplify overlapping fragments and sequence two full-length SIVcpzPtt-Cam155 genomes. SIVcpzPtt-Cam155 was phylogenetically related to other SIVcpzPtt from Cameroon (SIVcpzPtt-Cam13 and Gabon (SIVcpzPtt-Gab1. Ten molecular clones 5 years apart, spanning the V1V4 gp120 env region (1,100 bp, were obtained. Analyses of the env region showed positive selection (dN-dS >0, intra-host length variation and extensive amino acid diversity between clones, greater in 2009. Over 5 years, N-glycosylation site frequency significantly increased (p Conclusions Here, we describe for the first time the clinical history and viral evolution of a naturally SIV infected P.t.troglodytes chimpanzee. The findings show an increasing viral diversity over time and suggest clinical progression to an AIDS-like disease, showing that
Directory of Open Access Journals (Sweden)
J.A. Vega
2014-05-01
Full Text Available Natural populations of Chimpanzees Pan troglodytes are declining because of hunting and illegal live animal trafficking. Four subspecies of Chimpanzee have been reported: Pan troglodytes troglodytes, P.t. schweinfurthii, P.t. verus and P.t. ellioti, which have remained geographically separated by natural barriers such as the rivers Niger, Sanaga and Ubangi in central Africa. Sequence analysis of mitochondrial DNA (mtDNA has been used for the determination of these subspecies, which indirectly can also suggest their geographic origin. It was decided to identify the subspecies and the geographic origin of three captive chimpanzees of the National Zoo of the Metropolitan Park of Santiago (Chile, by analyzing their mitochondrial DNA. DNA was extracted from the saliva of three adult chimpanzees (two males and one female. After the analysis of sequences of the mitochondrial hypervariable region (HVI, a phylogenetic tree was constructed using mitochondrial sequences of known Pan troglodytes subspecies. Molecular phylogeny analysis revealed that the chimpanzees are likely to belong to three different subspecies: P.t. schweinfurthii, P.t. verus and P.t. troglodytes. Identification of subspecies of the three chimpanzees of the National Zoo of the Metropolitan Park of Santiago (Chile was possible due to mtDNA analysis. Future identification of chimpanzees will allow the development of a studbook for the chimpanzee subspecies in other Latin American zoos.
Fournier's gangrene syndrome in a chimpanzee (Pan troglodytes).
Okeson, Danelle M; Marrow, Judilee; Carpenter, James W; Armbrust, Laura J; Ragsdale, John M; Klocke, Emily
2010-03-01
A 37-yr-old male chimpanzee (Pan troglodytes) was evaluated for intermittent diarrhea, scrotal swelling, and lethargy of 2 days duration. Physical examination revealed marked swelling of the scrotum and perineal tissues with mild pitting edema and crepitus. Computed tomography revealed a mixed gas and soft-tissue density extending from the caudal ventral subcutaneous tissues caudally to the scrotum and perineal tissues. Surgical exploration and castration were performed to establish drainage, and culture revealed a polymicrobial infection. A diagnosis of scrotal and fascial plane abscessation consistent with Fournier's gangrene was made. Although castration with open drainage was performed, the animal died 36 hr after surgery. Postmortem examination and histopathology revealed necrotizing fasciitis of the penis, vaginal tunic, and subcutaneous perineal and perianal tissues.
Occlusal relief changes with molar wear in Pan troglodytes troglodytes and Gorilla gorilla gorilla.
M'kirera, Francis; Ungar, Peter S
2003-06-01
Most research on primate tooth form-function relationships has focused on unworn teeth. This study presents a morphological comparison of variably worn lower second molars (M(2)s) of lowland gorillas (Gorilla gorilla gorilla; n=47) and common chimpanzees (Pan troglodytes troglodytes; n=54) using dental topographic analysis. High-resolution replicas of occlusal surfaces were prepared and scanned in 3D by laser scanning. The resulting elevation data were used to create a geographic information system (GIS) for each tooth. Occlusal relief, defined as the ratio of 3D surface area to 2D planometric area of the occlusal table, was calculated and compared between wear stages, taxa, and sexes. The results failed to show a difference in occlusal relief between males and females of a given taxon, but did evince differences between wear stages and between taxa. A lack of significant interaction between wear stage and taxon factors suggests that differences in occlusal relief between chimpanzees and gorillas are maintained throughout the wear sequence. These results add to a growing body of information on how molar teeth change with wear, and how differences between primate species are maintained at comparable points throughout the wear sequence. Such studies provide new insights into form-function relationships, which will allow us to infer certain aspects of diet in fossils with worn teeth.
Hand use and gestural communication in chimpanzees (Pan troglodytes).
Hopkins, W D; Leavens, D A
1998-03-01
Hand use in gestural communication was examined in 115 captive chimpanzees (Pan troglodytes). Hand use was measured in subjects while they gestured to food placed out of their reach. The distribution of hand use was examined in relation to sex, age, rearing history, gesture type, and whether the subjects vocalized while gesturing. Overall, significantly more chimpanzees, especially females and adults, gestured with their right than with their left hand. Foods begs were more lateralized to the right hand than pointing, and a greater prevalence of right-hand gesturing was found in subjects who simultaneously vocalized than those who did not. Taken together, these data suggest that referential, intentional communicative behaviors, in the form of gestures, are lateralized to the left hemisphere in chimpanzees.
Ely, John J; Dye, Brent; Frels, William I; Fritz, Jo; Gagneux, Pascal; Khun, Henry H; Switzer, William M; Lee, D Rick
2005-10-01
Chimpanzees are presently classified into three subspecies: Pan troglodytes verus from west Africa, P.t. troglodytes from central Africa, and P.t. schweinfurthii from east Africa. A fourth subspecies (P.t. vellerosus), from Cameroon and northern Nigeria, has been proposed. These taxonomic designations are based on geographical origins and are reflected in sequence variation in the first hypervariable region (HVR-I) of the mtDNA D-loop. Although advances have been made in our understanding of chimpanzee phylogenetics, little has been known regarding the subspecies composition of captive chimpanzees. We sequenced part of the mtDNA HVR-I region in 218 African-born population founders and performed a phylogenetic analysis with previously characterized African sequences of known provenance to infer subspecies affiliations. Most founders were P.t. verus (95.0%), distantly followed by the troglodytes schweinfurthii clade (4.6%), and a single P.t. vellerosus (0.4%). Pedigree-based estimates of genomic representation in the descendant population revealed that troglodytes schweinfurthii founder representation was reduced in captivity, vellerosus representation increased due to prolific breeding by a single male, and reproductive variance resulted in uneven representation among male P.t.verus founders. No increase in mortality was evident from between-subspecies interbreeding, indicating a lack of outbreeding depression. Knowledge of subspecies and their genomic representation can form the basis for phylogenetically informed genetic management of extant chimpanzees to preserve rare genetic variation for research, conservation, or possible future breeding. Copyright 2005 Wiley-Liss, Inc.
Directory of Open Access Journals (Sweden)
Rory Bowden
Full Text Available In spite of its evolutionary significance and conservation importance, the population structure of the common chimpanzee, Pan troglodytes, is still poorly understood. An issue of particular controversy is whether the proposed fourth subspecies of chimpanzee, Pan troglodytes ellioti, from parts of Nigeria and Cameroon, is genetically distinct. Although modern high-throughput SNP genotyping has had a major impact on our understanding of human population structure and demographic history, its application to ecological, demographic, or conservation questions in non-human species has been extremely limited. Here we apply these tools to chimpanzee population structure, using ∼700 autosomal SNPs derived from chimpanzee genomic data and a further ∼100 SNPs from targeted re-sequencing. We demonstrate conclusively the existence of P. t. ellioti as a genetically distinct subgroup. We show that there is clear differentiation between the verus, troglodytes, and ellioti populations at the SNP and haplotype level, on a scale that is greater than that separating continental human populations. Further, we show that only a small set of SNPs (10-20 is needed to successfully assign individuals to these populations. Tellingly, use of only mitochondrial DNA variation to classify individuals is erroneous in 4 of 54 cases, reinforcing the dangers of basing demographic inference on a single locus and implying that the demographic history of the species is more complicated than that suggested analyses based solely on mtDNA. In this study we demonstrate the feasibility of developing economical and robust tests of individual chimpanzee origin as well as in-depth studies of population structure. These findings have important implications for conservation strategies and our understanding of the evolution of chimpanzees. They also act as a proof-of-principle for the use of cheap high-throughput genomic methods for ecological questions.
Imitation of the sequential structure of actions by chimpanzees (Pan troglodytes).
Whiten, A
1998-09-01
Imitation was studied experimentally by allowing chimpanzees (Pan troglodytes) to observe alternative patterns of actions for opening a specially designed "artificial fruit." Like problematic foods primates deal with naturally, with the test fruit several defenses had to be removed to gain access to an edible core, but the sequential order and method of defense removal could be systematically varied. Each subject repeatedly observed 1 of 2 alternative techniques for removing each defense and 1 of 2 alternative sequential patterns of defense removal. Imitation of sequential organization emerged after repeated cycles of demonstration and attempts at opening the fruit. Imitation in chimpanzees may thus have some power to produce cultural convergence, counter to the supposition that individual learning processes corrupt copied actions. Imitation of sequential organization was accompanied by imitation of some aspects of the techniques that made up the sequence.
Czech Academy of Sciences Publication Activity Database
Hasegawa, H.; Ikeda, Y.; Fujisaki, A.; Moscovice, L. R.; Petrželková, Klára Judita; Kaur, T.; Huffman, M. A.
2005-01-01
Roč. 91, č. 6 (2005), s. 1314-1317 ISSN 0022-3395 Grant - others:National Science Foundation(JP) 0238069; Japan Society for the Promotion of Science(JP) 12640680; GA AV ČR(CZ) AV0Z6093917-I028 Institutional research plan: CEZ:AV0Z60930519 Keywords : Pan troglodytes * pinworm s Subject RIV: EG - Zoology Impact factor: 1.524, year: 2005
De Lathouwers, Mieke; Van Elsacker, Linda
2006-10-01
The dichotomy between the two Pan species, the bonobo (Pan paniscus) and chimpanzee (Pan troglodytes) has been strongly emphasized until very recently. Given that most studies were primarily based on adult individuals, we shifted the "continuity versus discontinuity" discussion to the infant and juvenile stage. Our aim was to test quantitatively, some conflicting statements made in literature considering species differences between immature bonobos and chimpanzees. On one hand it is suggested that infant bonobos show retardation in motor and social development when compared with chimpanzees. Additionally it is expected that the weaning process is more traumatic to chimpanzee than bonobo infants. But on the other hand the development of behaviors is expected to be very similar in both species. We observed eight mother-infant pairs of each species in several European zoos. Our preliminary research partially confirms that immature chimpanzees seem spatially more independent, spending more time at a larger distance from their mother than immature bonobos. However, the other data do not seem to support the hypothesis that bonobo infants show retardation of motor or social development. The development of solitary play, environmental exploration, social play, non-copulatory mounts and aggressive interactions do not differ between the species. Bonobo infants in general even groom other group members more than chimpanzee infants. We also found that older bonobo infants have more nipple contact than same aged chimpanzees and that the weaning process seems to end later for bonobos than for immature chimpanzee. Additionally, although immature bonobos show in general more signs of distress, our data suggest that the weaning period itself is more traumatic for chimpanzees.
Majlesi, Parandis
2014-01-01
Extractive foraging of underground storage organs (USOs) is believed to have played an important role in human evolution. This behavior is also present in wild chimpanzees (Pan troglodytes), who sometimes use tools in the task. Despite the importance of studying this behavior in chimpanzees to model how early hominins may have used tools in the context of USO excavation, it remains to be directly observed due to the chimpanzees lack of habituation in the two study sites that yielded evidence...
Gruber, Thibaud; Potts, Kevin B; Krupenye, Christopher; Byrne, Maisie-Rose; Mackworth-Young, Constance; McGrew, William C; Reynolds, Vernon; Zuberbühler, Klaus
2012-11-01
The influence of ecology on the development of behavioral traditions in animals is controversial, particularly for chimpanzees (Pan troglodytes), for which it is difficult to rule out environmental influences as a cause of widely observed community-specific behavioral differences. Here, we investigated 3 potential scenarios that could explain the natural variation in a key extractive tool behavior, "fluid-dip," among several communities of chimpanzees of the Pan troglodytes schweinfurthii subspecies in Uganda. We compared data from previous behavioral ecological studies, field experiments, and long-term records of chimpanzee tool-using behavior. We focused on the quality of the available food, dietary preferences, and tool sets of 5 different communities, and carried out a standardized field experiment to test systematically for the presence of fluid-dip in 4 of these communities. Our results revealed major differences in habitat, available diet, and tool use behavior between geographically close communities. However, these differences in ecology and feeding behavior failed to explain the differences in tool use across communities. We conclude that ecological variables may lead both to innovation and loss of behavioral traditions, while contributing little to their transmission within the community. Instead, as soon as a behavioral tradition is established, sociocognitive factors likely play a key maintenance role as long as the ecological conditions do not change sufficiently for the tradition to be abandoned.
Deblauwe, Isra; Guislain, Patrick; Dupain, Jef; Van Elsacker, Linda
2006-12-01
At the northern periphery of the Dja Biosphere Reserve (southeastern Cameroon) we recorded a new use of a tool-set by Pan troglodytes troglodytes to prey on Macrotermes muelleri, M. renouxi, M. lilljeborgi, and M. nobilis. We recovered 79 puncturing sticks and 47 fishing probes at 17 termite nests between 2002 and 2005. The mean length of the puncturing sticks (n = 77) and fishing probes (n = 45) was 52 cm and 56 cm, respectively, and the mean diameter was 9 mm and 4.5 mm, respectively. Sixty-eight percent of 138 chimpanzee fecal samples contained major soldiers of four Macrotermes species. The chimpanzees in southeastern Cameroon appeared to be selective in their choice of plant material to make their tools. The tools found at our study site resemble those from other sites in this region. However, in southeastern Cameroon only one tool-set type was found, whereas two tool-set types have been reported in Congo. Our study suggests that, along with the different vegetation types and the availability of plant material around termite nests, the nest and gallery structure and foraging behavior of the different Macrotermes spp. at all Central African sites must be investigated before we can attribute differences in tool-use behavior to culture. (c) 2006 Wiley-Liss, Inc.
Responses to a simple barter task in chimpanzees, Pan troglodytes.
Brosnan, Sarah F; de Waal, Frans B M
2005-07-01
Chimpanzees (Pan troglodytes) frequently participate in social exchange involving multiple goods and services of variable value, yet they have not been tested in a formalized situation to see whether they can barter using multiple tokens and rewards. We set up a simple barter economy with two tokens and two associated rewards and tested chimpanzees on their ability to obtain rewards by returning the matching token in situations in which their access to tokens was unlimited or limited. Chimpanzees easily learned to associate value with the tokens, as expected, and did barter, but followed a simple strategy of favoring the higher-value token, regardless of the reward proffered, instead of a more complex but more effective strategy of returning the token that matched the reward. This response is similar to that shown by capuchin monkeys in our previous study. We speculate that this response, while not ideal, may be sufficient to allow for stability of the social exchange system in these primates, and that the importance of social barter to both species may have led to this convergence of strategies.
Byrnit, Jill T; Høgh-Olesen, Henrik; Makransky, Guido
2015-08-01
All over the world, humans (Homo sapiens) display resource-sharing behavior, and common patterns of sharing seem to exist across cultures. Humans are not the only primates to share, and observations from the wild have long documented food sharing behavior in our closest phylogenetic relatives, chimpanzees (Pan troglodytes) and bonobos (Pan paniscus). However, few controlled studies have been made in which groups of Pan are introduced to food items that may be shared or monopolized by a first food possessor, and very few studies have examined what happens to these sharing patterns if the food in question is a highly attractive, monopolizable food source. The one study to date to include food quality as the independent variable used different types of food as high- and low-value items, making differences in food divisibility and size potentially confounding factors. It was the aim of the present study to examine the sharing behavior of groups of captive chimpanzees and bonobos when introducing the same type of food (branches) manipulated to be of 2 different degrees of desirability (with or without syrup). Results showed that the large majority of food transfers in both species came about as sharing in which group members were allowed to cofeed or remove food from the stock of the food possessor, and the introduction of high-value food resulted in more sharing, not less. Food sharing behavior differed between species in that chimpanzees displayed significantly more begging behavior than bonobos. Bonobos, instead, engaged in sexual invitations, which the chimpanzees never did. (PsycINFO Database Record (c) 2015 APA, all rights reserved).
Dutton, Diane M
2008-10-01
A 46-item rating scale was used to obtain personality ratings from 75 captive chimpanzees (Pan troglodytes) from 7 zoological parks. Factor analysis revealed five personality dimensions similar to those found in previous research on primate personality: Agreeableness, Dominance, Neuroticism, Extraversion and Intellect. There were significant sex and age differences in ratings on these dimensions, with males rated more highly on Dominance and older chimpanzees rated as more agreeable but less extraverted than younger chimpanzees. Interobserver agreement for most individual trait items was high, but tended to be less reliable for trait terms expressing more subtle social or cognitive abilities. Personality ratings for one zoo were found to be largely stable across a 3-year period, but highlighted the effects of environmental factors on the expression of personality in captive chimpanzees.
Chimpanzees (Pan troglodytes) use markers to monitor the movement of a hidden item.
Beran, Michael J; Beran, Mary M; Menzel, Charles R
2005-10-01
Four chimpanzees (Pan troglodytes) monitored the movement of hidden items in arrays of opaque cups. A chocolate candy was hidden in an array of four cups and temporarily presented paper markers indicated the location of the candy (which otherwise was not visible). These markers were either non-symbolic or symbolic (lexigram) stimuli that in other contexts acted as a label for the hidden candy, and the array was either rotated 180 degrees after the marker was removed or the array remained in the same location. For three of four chimpanzees, performance was better than chance in all conditions and there was no effect of the type of marker. These experiments indicate that chimpanzees can track the movement of a hidden item in an array of identical cups even when they never see the item itself, but only see a temporarily presented marker for the location of that item. However, there was no benefit to the use of symbolic as opposed to non-symbolic stimuli in this performance.
Call, J
2001-06-01
Juvenile and adult orangutans (n = 5; Pongo pygmaeus), chimpanzees (n = 7; Pan troglodytes), and 19- and 26-month-old children (n = 24; Homo sapiens) received visible and invisible displacements. Three containers were presented forming a straight line, and a small box was used to displace a reward under them. Subjects received 3 types of displacement: single (the box visited 1 container), double adjacent (the box visited 2 contiguous containers), and double nonadjacent (the box visited 2 noncontiguous containers). All species performed at comparable levels, solving all problems except the invisible nonadjacent displacements. Visible displacements were easier than invisible, and single were easier than double displacements. In a 2nd experiment, subjects saw the baiting of either 2 adjacent or 2 nonadjacent containers with no displacements. All species selected the empty container more often when the baited containers were nonadjacent than when they were adjacent. It is hypothesized that a response bias and inhibition problem were responsible for the poor performance in nonadjacent displacements.
Schmittbuhl, M; Le Minor, J M; Allenbach, B; Schaaf, A
1999-05-01
The description of the human orbital shape is principally qualitative in the classical literature, and characterised by adjectives such as circular, rectangular or quadrangular. In order to provide a precise quantification and interpretation of this shape, a study based on automatic image analysis and Fourier analysis was carried out on 45 human skulls (30 males, 15 females), and for comparison on 61 skulls of Gorilla gorilla (40 males, 21 females), and 34 skulls of Pan troglodytes (20 males, 14 females). Sexual dimorphism in the shape of the orbital opening was not demonstrated. Its dominant morphological features could be characterized by Fourier analysis; elliptical elongation and quadrangularity were dominant morphological features of the shape of the orbital opening in the three species. Elliptical elongation was more marked in humans and Pan, whereas quadrangularity was particularly emphasized in Gorilla. An intraspecific variability of the shape of the orbital opening existed in humans, Gorilla and Pan, and seemed close in the three species. Interspecific partition between humans, Gorilla and Pan was demonstrated despite the variability observed in the three species studied. Interspecific differences between Gorilla and the Pan-humans group were principally explained by the differences in quadrangularity, and by differences in orientation of triangularity and pentagonality. Differences in the shape of the orbital opening between humans and Pan were principally explained by differences in hexagonality, and by differences in orientation of quadrangularity. A closeness of shape between some humans and some individuals in Pan and, to a lesser degree, with some individuals in Gorilla was observed, demonstrating the existence of a morphological continuum of the shape of the orbital opening in hominoids.
Lycett, Stephen J; Collard, Mark; McGrew, William C
2009-10-01
Long-term field studies have revealed considerable behavioural differences among groups of wild Pan troglodytes. Here, we report three sets of cladistic analyses that were designed to shed light on issues relating to this interpopulation variation that are of particular relevance to palaeoanthropology. In the first set of analyses, we focused on the proximate cause of the variation. Some researchers have argued that it is cultural, while others have suggested that it is the result of genetic differences. Because the eastern and western subspecies of P. troglodytes are well differentiated genetically while groups within the subspecies are not, we reasoned that if the genetic hypothesis is correct, the phylogenetic signal should be stronger when data from the eastern and western subspecies are analysed together compared to when data from only the eastern subspecies are analysed. Using randomisation procedures, we found that the phylogenetic signal was substantially stronger with in a single subspecies rather than with two. The results of the first sets of analyses, therefore, were inconsistent with the predictions of the genetic hypothesis. The other two sets of analyses built on the results of the first and assumed that the intergroup behavioural variation is cultural in nature. Recent work has shown that, contrary to what anthropologists and archaeologists have long believed, vertical intergroup transmission is often more important than horizontal intergroup transmission in human cultural evolution. In the second set of analyses, we sought to determine how important vertical transmission has been in the evolution of chimpanzee cultural diversity. The first analysis we carried out indicated that the intergroup similarities and differences in behaviour are consistent with the divergence of the western and eastern subspecies, which is what would be expected if vertical intergroup transmission has been the dominant process. In the second analysis, we found that the
McGrew, William C
2017-01-01
Field studies done over decades of wild chimpanzees in East, Central and West Africa have yielded impressive, cumulative findings in cultural primatology. Japanese primatologists have been involved in this advance from the outset, over a wide variety of topics. Here I review the origins and development of field studies of Pan troglodytes, then assess their progress based on analogy between cultural primatology and cultural anthropology, through four stages: natural history, ethnography, ethnology, and intuition. Then, I focus on six topics that continue to yield informative debate: technology, universals, nuanced variation, archaeology, applied primatology, and ecology. Finally, I offer a map of sites of field study of wild chimpanzees. It is clear that Japanese primatologists have made a significant contribution to East-West scientific exchange, especially at the field sites of Bossou and Mahale.
Fahy, Geraldine E; Richards, Michael P; Fuller, Benjamin T; Deschner, Tobias; Hublin, Jean-Jacques; Boesch, Christophe
2014-04-01
Offspring provisioning is one of the most energetically demanding aspects of reproduction for female mammals. Variation in lactation length and weaning strategies between chimpanzees (Pan troglodytes), our closest living relative, and modern human societies have been reported. When and why these changes occurred is frequently debated. Our study used stable nitrogen isotope data of tooth root dentine from wild Western chimpanzees (Pan troglodytes verus) in Taï National Park, Côte d'Ivoire, to quantify weaning in these chimpanzees and explore if infant sex plays a role in maternal investment. We analyzed serial sections of deciduous lateral incisor root dentine from four Taï chimpanzees to establish the δ(15) N signal of nursing infants; we then analyzed serial sections of first permanent mandibular molar root dentine from 12 Taï chimpanzees to provide quantitative δ(15) N data on weaning in this population. Up to 2 years of age both sexes exhibited dentine δ(15) N values ≈2-3‰ higher than adult female Taï chimpanzees, consistent with a nursing signal. Thereafter a steady decrease in δ(15) N values consistent with the onset, and progression, of weaning, was visible. Sex differences were also evident, where male δ(15) N values decreased at a significantly slower rate compared to females. Confirmation of sex differences in maternal investment among Taï chimpanzees, demonstrates the viability of using isotope analysis to investigate weaning in non-human primates. Additionally, assuming that behaviors observed in the Taï chimpanzees are illustrative of the ancestral pattern, our results provide a platform to enable the trajectory of weaning in human evolution to be further explored. Copyright © 2013 Wiley Periodicals, Inc.
Stanton, Margaret A; Heintz, Matthew R; Lonsdorf, Elizabeth V; Santymire, Rachel M; Lipende, Iddi; Murray, Carson M
2015-06-01
Individual differences in maternal behavior toward, and investment in, offspring can have lasting consequences, particularly among primate taxa characterized by prolonged periods of development over which mothers can exert substantial influence. Given the role of the neuroendocrine system in the expression of behavior, researchers are increasingly interested in understanding the hormonal correlates of maternal behavior. Here, we examined the relationship between maternal behavior and physiological stress levels, as quantified by fecal glucocorticoid metabolite (FGM) concentrations, in lactating chimpanzees, Pan troglodytes schweinfurthii , at Gombe National Park, Tanzania. After accounting for temporal variation in FGM concentrations, we found that mothers interacted socially (groomed and played) with and nursed their infants more on days when FGM concentrations were elevated compared to days when FGM concentrations were within the range expected given the time of year. However, the proportion of time mothers and infants spent in contact did not differ based on FGM concentrations. These results generally agree with the suggestion that elevated GC concentrations are related to maternal motivation and responsivity to infant cues and are the first evidence of a hormonal correlate of maternal behavior in a wild great ape.
Sommanustweechai, Angkana; Kasantikul, Tanit; Somsa, Wachirawit; Wongratanacheewin, Surasakdi; Sermswan, Rasana W; Kongmakee, Piyaporn; Thomas, Warissara; Kamolnorranath, Sumate; Siriaroonrat, Boripat; Bush, Mitchell; Banlunara, Wijit
2013-06-01
A 40-yr-old male captive chimpanzee (Pan troglodytes) presented with depression and anorexia for 7 days. The tentative diagnosis, following a physical examination under anesthesia, was pneumonia with sepsis. Despite antibiotic treatment and supportive care the chimpanzee died a week following presentation. Gross pathology confirmed severe purulent pneumonia and diffuse hepatosplenic abscesses. Detected in serum at the time of the initial examination, the melioidosis serum antibody titer was elevated (> 1:512). Soil samples were collected from three sites in the exhibit at three depths of 5, 15, and 30 cm. By direct and enrichment culture, positive cultures for Burkholderia pseudomallei were found at 5 and 15 cm in one site. The other two sites were positive by enrichment culture at the depth of 5 cm. To prevent disease in the remaining seven troop members, they were relocated to permit a soil treatment with calcium oxide. The exhibit remained empty for approximately 1 yr before the chimpanzees were returned. During that period, the soil in the exhibit area was again cultured as before and all samples were negative for B. pseudomallei. Following the soil treatment in the exhibit, all chimpanzees have remained free of clinical signs consistent with melioidosis.
DEFF Research Database (Denmark)
Bogart, Stephanie L; Bennett, Allyson J; Schapiro, Steve
2014-01-01
-reared chimpanzees have greater global white-to-grey matter volume, more cortical folding and thinner grey matter within the cortical folds than nursery-reared animals. The findings reported here are the first to demonstrate that differences in early rearing conditions have significant consequences on brain......Consequences of rearing history in chimpanzees (Pan troglodytes) have been explored in relation to behavioral abnormalities and cognition; however, little is known about the effects of rearing conditions on anatomical brain development. Human studies have revealed that experiences of maltreatment...... and neglect during infancy and childhood can have detrimental effects on brain development and cognition. In this study, we evaluated the effects of early rearing experience on brain morphology in 92 captive chimpanzees (ages 11-43) who were either reared by their mothers (n = 46) or in a nursery (n = 46...
Hasegawa, Hideo; Ikeda, Yatsukaho; Fujisaki, Akiko; Moscovice, Liza R; Petrzelkova, Klara J; Kaur, Taranjit; Huffman, Michael A
2005-12-01
The chimpanzee pinworm, Enterobius (Enterobius) anthropopitheci (Gedoelst, 1916) (Nematoda: Oxyuridae), is redescribed based on light and scanning electron microscopy of both sexes collected from the feces of chimpanzees, Pan troglodytes, of an introduced population on Rubondo Island, Tanzania. Enterobius (E.) anthropopitheci is characterized by having a small body (males 1.13-1.83 mm long, females 3.33-4.73 mm long), a rather straight spicule with a ventral membranous formation in males, double-crested lateral alae in females, small eggs (53-58 by 24-28 microm), and a smooth eggshell with 3 longitudinal thickenings. Morphological comparison is made between the present and previous descriptions.
Karg, Katja; Schmelz, Martin; Call, Josep; Tomasello, Michael
2014-11-01
Nonhuman great apes and human children were tested for an understanding that appearance does not always correspond to reality. Subjects were 29 great apes (bonobos [Pan paniscus], chimpanzees [Pan troglodytes], gorillas [Gorilla gorilla], and orangutans [Pongo abelii]) and 24 2½-year-old children. In our task, we occluded portions of 1 large and 1 small food stick such that the size relations seemed reversed. Subjects could then choose which one they wanted. There was 1 control condition and 2 experimental conditions (administered within subjects). In the control condition subjects saw only the apparent stick sizes, whereas in the 2 experimental conditions they saw the true stick sizes as well (the difference between them being what the subjects saw first: the apparent or the real stick sizes). All great ape species and children successfully identified the bigger stick, despite its smaller appearance, in the experimental conditions, but not in the control. We discuss these results in relation to the understanding of object permanence and conservation, and exclude reversed reward contingency learning as an explanation. (PsycINFO Database Record (c) 2014 APA, all rights reserved).
Male yawning is more contagious than female yawning among chimpanzees (Pan troglodytes.
Directory of Open Access Journals (Sweden)
Jorg J M Massen
Full Text Available Yawn contagion is not restricted to humans and has also been reported for several non-human animal species, including chimpanzees (Pan troglodytes. Contagious yawning may lead to synchronisation of behaviour. However, the function of contagious yawning is relatively understudied. In this study, we investigated the function of contagious yawning by focusing on two types of signal providers: close social associates and leaders. We provided a captive chimpanzee colony with videos of all individuals of their own group that were either yawning, or at rest. Consistent with other studies, we demonstrated that yawning is contagious for chimpanzees, yet we did not find any effect of relationship quality on yawn contagion. However, we show that yawn contagion is significantly higher when the video model is a yawning male than when the video model was a yawning female, and that this effect is most apparent among males. As males are dominant in chimpanzee societies, male signals may be more relevant to the rest of the group than female signals. Moreover, since chimpanzees form male-bonded societies, male signals are especially relevant for other males. Therefore, we suggest that the sex-differences of yawning contagion among chimpanzees reflect the function of yawning in the synchronisation of behaviour.
Cues to Personality and Health in the Facial Appearance of Chimpanzees (Pan Troglodytes
Directory of Open Access Journals (Sweden)
Robin S. S. Kramer
2012-04-01
Full Text Available Humans (Homo sapiens and chimpanzees (Pan troglodytes can extract socially-relevant information from the static, non-expressive faces of conspecifics. In humans, the face is a valid signal of both personality and health. Recent evidence shows that, like humans, chimpanzee faces also contain personality information, and that humans can accurately judge aspects of chimpanzee personality relating to extraversion from the face alone (Kramer, King, and Ward, 2011. These findings suggest the hypothesis that humans and chimpanzees share a system of personality and facial morphology for signaling socially-relevant traits from the face. We sought to test this hypothesis using a new group of chimpanzees. In two studies, we found that chimpanzee faces contained health information, as well as information of characteristics relating to extraversion, emotional stability, and agreeableness, using average judgments from pairs of individual photographs. In a third study, information relating to extraversion and health was also present in composite images of individual chimpanzees. We therefore replicate and extend previous findings using a new group of chimpanzees and demonstrate two methods for minimizing the variability associated with individual photographs. Our findings support the hypothesis that chimpanzees and humans share a personality signaling system.
Chimpanzee (Pan troglodytes) relational matching: playing by their own (analogical) rules.
Flemming, Timothy M; Kennedy, Erica Hoy
2011-05-01
Chimpanzees (Pan troglodytes) have been known to exhibit rudimentary abilities in analogical reasoning (Flemming, Beran, Thompson, Kleider, & Washburn, 2008; Gillian, Premack, & Woodruff, 1981; Haun & Call, 2009; Thompson & Oden, 2000; Thompson, Oden, & Boysen, 1997). With a wide array of individual differences, little can be concluded about the species' capacity for analogies, much less their strategies employed for solving such problems. In this study, we examined analogical strategies in 3 chimpanzees using a 3-dimensional search task (e.g., Kennedy & Fragaszy, 2008). Food items were hidden under 1 of 2 or 3 plastic cups of varying sizes. Subsequently, chimpanzees searched for food under the cup of the same relative size in their own set of cups--reasoning by analogy. Two chimpanzees initially appeared to fail the first relational phase of the task. Meta-analyses revealed, however, that they were instead using a secondary strategy not rewarded by the contingencies of the task--choosing on the basis of the same relative position in the sample. Although this was not the intended strategy of the task, it was nonetheless analogical. In subsequent phases of the task, chimpanzees eventually learned to shift their analogical reasoning strategy to match the reward contingencies of the task and successfully choose on the basis of relative size. This evidence not only provides support for the analogical ape hypothesis (Thompson & Oden, 2000), but also exemplifies how foundational conceptually mediated analogical behavior may be for the chimpanzee. 2011 APA, all rights reserved
Is music enriching for group-housed captive chimpanzees (Pan troglodytes)?
Wallace, Emma K.; Altschul, Drew; Körfer, Karoline; Benti, Benjamin; Kaeser, Amanda; Lambeth, Susan; Waller, Bridget M.; Slocombe, Katie E.
2017-01-01
Many facilities that house captive primates play music for animal enrichment or for caregiver enjoyment. However, the impact on primates is unknown as previous studies have been inconclusive. We conducted three studies with zoo-housed chimpanzees (Pan troglodytes) and one with group-housed chimpanzees at the National Centre for Chimpanzee Care to investigate the effects of classical and pop/rock music on various variables that may be indicative of increased welfare. Study one compared the behaviour and use of space of 18 animals when silence, classical or pop/rock music was played into one of several indoor areas. Overall, chimpanzees did not actively avoid the area when music was playing but were more likely to exit the area when songs with higher beats per minute were broadcast. Chimpanzees showed significantly fewer active social behaviours when music, rather than silence, was playing. They also tended to be more active and engage in less abnormal behaviour during the music but there was no change to either self-grooming or aggression between music and silent conditions. The genre of music had no differential effects on the chimpanzees’ use of space and behaviour. In the second study, continuous focal observations were carried out on three individuals with relatively high levels of abnormal behaviour. No differences in behaviour between music and silence periods were found in any of the individuals. The final two studies used devices that allowed chimpanzees to choose if they wanted to listen to music of various types or silence. Both studies showed that there were no persistent preferences for any type of music or silence. When taken together, our results do not suggest music is enriching for group-housed captive chimpanzees, but they also do not suggest that music has a negative effect on welfare. PMID:28355212
Is music enriching for group-housed captive chimpanzees (Pan troglodytes?
Directory of Open Access Journals (Sweden)
Emma K Wallace
Full Text Available Many facilities that house captive primates play music for animal enrichment or for caregiver enjoyment. However, the impact on primates is unknown as previous studies have been inconclusive. We conducted three studies with zoo-housed chimpanzees (Pan troglodytes and one with group-housed chimpanzees at the National Centre for Chimpanzee Care to investigate the effects of classical and pop/rock music on various variables that may be indicative of increased welfare. Study one compared the behaviour and use of space of 18 animals when silence, classical or pop/rock music was played into one of several indoor areas. Overall, chimpanzees did not actively avoid the area when music was playing but were more likely to exit the area when songs with higher beats per minute were broadcast. Chimpanzees showed significantly fewer active social behaviours when music, rather than silence, was playing. They also tended to be more active and engage in less abnormal behaviour during the music but there was no change to either self-grooming or aggression between music and silent conditions. The genre of music had no differential effects on the chimpanzees' use of space and behaviour. In the second study, continuous focal observations were carried out on three individuals with relatively high levels of abnormal behaviour. No differences in behaviour between music and silence periods were found in any of the individuals. The final two studies used devices that allowed chimpanzees to choose if they wanted to listen to music of various types or silence. Both studies showed that there were no persistent preferences for any type of music or silence. When taken together, our results do not suggest music is enriching for group-housed captive chimpanzees, but they also do not suggest that music has a negative effect on welfare.
Is music enriching for group-housed captive chimpanzees (Pan troglodytes)?
Wallace, Emma K; Altschul, Drew; Körfer, Karoline; Benti, Benjamin; Kaeser, Amanda; Lambeth, Susan; Waller, Bridget M; Slocombe, Katie E
2017-01-01
Many facilities that house captive primates play music for animal enrichment or for caregiver enjoyment. However, the impact on primates is unknown as previous studies have been inconclusive. We conducted three studies with zoo-housed chimpanzees (Pan troglodytes) and one with group-housed chimpanzees at the National Centre for Chimpanzee Care to investigate the effects of classical and pop/rock music on various variables that may be indicative of increased welfare. Study one compared the behaviour and use of space of 18 animals when silence, classical or pop/rock music was played into one of several indoor areas. Overall, chimpanzees did not actively avoid the area when music was playing but were more likely to exit the area when songs with higher beats per minute were broadcast. Chimpanzees showed significantly fewer active social behaviours when music, rather than silence, was playing. They also tended to be more active and engage in less abnormal behaviour during the music but there was no change to either self-grooming or aggression between music and silent conditions. The genre of music had no differential effects on the chimpanzees' use of space and behaviour. In the second study, continuous focal observations were carried out on three individuals with relatively high levels of abnormal behaviour. No differences in behaviour between music and silence periods were found in any of the individuals. The final two studies used devices that allowed chimpanzees to choose if they wanted to listen to music of various types or silence. Both studies showed that there were no persistent preferences for any type of music or silence. When taken together, our results do not suggest music is enriching for group-housed captive chimpanzees, but they also do not suggest that music has a negative effect on welfare.
Waller, Bridget M; Bard, Kim A; Vick, Sarah-Jane; Smith Pasqualini, Marcia C
2007-11-01
Human face perception is a finely tuned, specialized process. When comparing faces between species, therefore, it is essential to consider how people make these observational judgments. Comparing facial expressions may be particularly problematic, given that people tend to consider them categorically as emotional signals, which may affect how accurately specific details are processed. The bared-teeth display (BT), observed in most primates, has been proposed as a homologue of the human smile (J. A. R. A. M. van Hooff, 1972). In this study, judgments of similarity between BT displays of chimpanzees (Pan troglodytes) and human smiles varied in relation to perceived emotional valence. When a chimpanzee BT was interpreted as fearful, observers tended to underestimate the magnitude of the relationship between certain features (the extent of lip corner raise) and human smiles. These judgments may reflect the combined effects of categorical emotional perception, configural face processing, and perceptual organization in mental imagery and may demonstrate the advantages of using standardized observational methods in comparative facial expression research. Copyright 2007 APA.
Stanton, Margaret A; Lonsdorf, Elizabeth V; Pusey, Anne E; Goodall, Jane; Murray, Carson M
2014-08-01
Parental investment theory predicts that maternal resources are finite and allocated among offspring based on factors including maternal age and condition, and offspring sex and parity. Among humans, firstborn children are often considered to have an advantage and receive greater investment than their younger siblings. However, conflicting evidence for this "firstborn advantage" between modern and hunter-gatherer societies raises questions about the evolutionary history of differential parental investment and birth order. In contrast to humans, most non-human primate firstborns belong to young, inexperienced mothers and exhibit higher mortality than laterborns. In this study, we investigated differences in maternal investment and offspring outcomes based on birth order (firstborn vs. later-born) among wild chimpanzees ( Pan troglodyte schweinfurthii ). During the critical first year of life, primiparous mothers nursed, groomed, and played with their infants more than did multiparous mothers. Furthermore, this pattern of increased investment in firstborns appeared to be compensatory, as probability of survival did not differ by birth order. Our study did not find evidence for a firstborn advantage as observed in modern humans but does suggest that unlike many other primates, differences in maternal behavior help afford chimpanzee first-borns an equal chance of survival.
Ludwig, Vera U.; Adachi, Ikuma; Matsuzawa, Tetsuro
2011-01-01
Humans share implicit preferences for certain cross-sensory combinations; for example, they consistently associate higher-pitched sounds with lighter colors, smaller size, and spikier shapes. In the condition of synesthesia, people may experience such cross-modal correspondences to a perceptual degree (e.g., literally seeing sounds). So far, no study has addressed the question whether nonhuman animals share cross-modal correspondences as well. To establish the evolutionary origins of cross-modal mappings, we tested whether chimpanzees (Pan troglodytes) also associate higher pitch with higher luminance. Thirty-three humans and six chimpanzees were required to classify black and white squares according to their color while hearing irrelevant background sounds that were either high-pitched or low-pitched. Both species performed better when the background sound was congruent (high-pitched for white, low-pitched for black) than when it was incongruent (low-pitched for white, high-pitched for black). An inherent tendency to pair high pitch with high luminance hence evolved before the human lineage split from that of chimpanzees. Rather than being a culturally learned or a linguistic phenomenon, this mapping constitutes a basic feature of the primate sensory system. PMID:22143791
Latzman, Robert D.; Freeman, Hani D.; Schapiro, Steven J.; Hopkins, William D.
2015-01-01
A reliable literature finds that traits are related to each other in an organized hierarchy encompassing various conceptualizations of personality (e.g., Big Three, Five Factor Model). Recent work suggests the potential of a similar organization among our closest nonhuman relative, chimpanzees (Pan troglodytes), with significant links to neurobiology suggesting an evolutionarily- and neurobiologically-based hierarchical structure of personality. The current study investigated this hierarchical structure, the heritability of the various personality dimensions across levels of the hierarchy, and associations with early social rearing experience in a large sample (N = 238) of socially-housed, captive chimpanzees residing in two independent colonies of apes. Results provide support for a hierarchical structure of personality in chimpanzees with significant associations with early rearing experiences. Further, heritabilities of the various dimensions varied by early rearing, with affective dimensions found to be significantly heritable among mother-reared apes, while personality dimensions were largely independent of relatedness among the nursery-reared apes. Taken together, these findings provide evidence for the influence of both genetic and environmental factors on personality profiles across levels of the hierarchy, supporting the importance of considering environmental variation in models of quantitative trait evolution. PMID:25915132
Miller, Jordan A; Stanton, Margaret A; Lonsdorf, Elizabeth V; Wellens, Kaitlin R; Markham, A Catherine; Murray, Carson M
2017-09-01
Examining the ontogeny of conflict-mitigating behaviours in our closest living relatives is an important component of understanding the evolutionary origins of cooperation in our species. In this study, we used 26 years of data to investigate the emergence of third-party affiliation (TPA), defined as affiliative contact given to recipients of aggression by uninvolved bystanders (regardless of initiation), in wild immature eastern chimpanzees ( Pan troglodytes schweinfurthii ) of Gombe National Park, Tanzania. We also characterized TPA by mothers in the same dataset as an adult benchmark for interpreting immature TPA patterns. In summary, we found that immatures did not express TPA as measured by grooming between the ages of 1.5 and 12.0 years, and that there was limited evidence that immatures expressed TPA via play. We also found that mothers did express TPA to offspring, although mothers did not show TPA towards non-offspring. Cases of TPA by mothers to other adults were too few to analyse separately. These results contrast with findings from captive studies which found that chimpanzees as young as 6 years of age demonstrated TPA. We argue that within-species variation in the expression of TPA, both in immatures and adulthood, provides evidence that the conflict management behaviours of young chimpanzees may be heavily influenced by social, ecological and demographic factors.
Pope, Sarah M; Taglialatela, Jared P; Skiba, Sara A; Hopkins, William D
2018-03-01
Human imitation is supported by an underlying "mirror system" principally composed of inferior frontal, inferior parietal, and superior temporal cortical regions. Across primate species, differences in frontoparietotemporal connectivity have been hypothesized to explain phylogenetic variation in imitative abilities. However, if and to what extent these regions are involved in imitation in nonhuman primates is unknown. We hypothesized that "Do As I Do" (DAID) imitation training would enhance white matter integrity within and between frontoparietotemporal regions. To this end, four captive chimpanzees ( Pan troglodytes) were trained to reproduce 23 demonstrated actions, and four age-/sex-matched controls were trained to produce basic husbandry behaviors in response to manual cues. Diffusion tensor images were acquired before and after 600 min of training over an average of 112 days. Bilateral and asymmetrical changes in frontoparietotemporal white matter integrity were compared between DAID trained subjects and controls. We found that imitation trained subjects exhibited leftward shifts in both mean fractional anisotropy and tract strength asymmetry measures in brain regions within the mirror system. This is the first report of training-induced changes in white matter integrity in chimpanzees and suggests that frontoparietotemporal connectivity, particularly in the left hemisphere, may have facilitated the emergence of increasingly complex imitation learning abilities.
A longitudinal assessment of vocabulary retention in symbol-competent chimpanzees (Pan troglodytes).
Beran, Michael J; Heimbauer, Lisa A
2015-01-01
A number of studies from the 1960s to 1990s assessed the symbolic competence of great apes and other animals. These studies provided varying forms of evidence that some species were capable of symbolically representing their worlds, both through productive symbol use and comprehension of symbolic stimuli. One such project at the Language Research Center involved training chimpanzees (Pan troglodytes) to use lexigram symbols (geometric visual stimuli that represented objects, actions, locations, and individuals). Those studies now are more than 40 years old, and only a few of the apes involved in those studies are still alive. Three of these chimpanzees (and a fourth, control chimpanzee) were assessed across a 10-year period from 1999 to 2008 for their continued knowledge of lexigram symbols and, in the case of one chimpanzee, the continued ability to comprehend human speech. This article describes that longitudinal assessment and outlines the degree to which symbol competence was retained by these chimpanzees across that decade-long period. All chimpanzees showed retention of lexigram vocabularies, although there were differences in the number of words that were retained across the individuals. One chimpanzee also showed continual retention of human speech perception. These retained vocabularies largely consisted of food item names, but also names of inedible objects, locations, individuals, and some actions. Many of these retained words were for things that are not common in the daily lives of the chimpanzees and for things that are rarely requested by the chimpanzees. Thus, the early experiences of these chimpanzees in symbol-rich environments have produced long-lasting memories for symbol meaning, and those competencies have benefited research in a variety of topics in comparative cognition.
Videan, Elaine N; Fritz, Jo; Howell, Sue; Murphy, James
2007-01-01
Is music just noise, and thus potentially harmful to laboratory animals, or can it have a beneficial effect? Research addressing this question has generated mixed results, perhaps because of the different types and styles of music used across various studies. The purpose of this study was to test the effects of 2 different types (vocal versus instrumental) and 2 genres (classical vocal versus 'easy-listening' vocal) of music on social behavior in 31 female and 26 male chimpanzees (Pan troglodytes). Results indicated that instrumental music was more effective at increasing affiliative behavior in both male and female chimpanzees, whereas vocal music was more effective at decreasing agonistic behavior. A comparison of 2 genre of vocal music indicated that easy-listening (slower tempo) vocal music was more effective at decreasing agonistic behavior in male chimpanzees than classical (faster tempo) vocal music. Agonistic behavior in females remained low (music. These results indicate that, like humans, captive chimpanzees react differently to various types and genres of music. The reactions varied depending on both the sex of the subject and the type of social behavior examined. Management programs should consider both type and genre when implementing a musical enrichment program for nonhuman primates.
Harrison, Rachel A; Whiten, Andrew
2018-01-01
Behavioural flexibility, the ability to alter behaviour in response to environmental feedback, and to relinquish previously successful solutions to problems, is a crucial ability in allowing organisms to adapt to novel environments and environmental change; it is essential to cumulative cultural change. To explore this ability in chimpanzees, 18 individuals ( Pan troglodytes ) were presented with an artificial foraging task consisting of a tube partially filled with juice that could be reached by hand or retrieved using tool materials to hand. Effective solutions were then restricted in the second phase of the study by narrowing the diameter of the tube, necessitating the abandonment of previously successful solutions. Chimpanzees showed limited behavioural flexibility in comparison to some previous studies, increasing their use of effective techniques, but also continuing to attempt solutions that had been rendered ineffective. This adds to a literature reporting divergent evidence for flexibility (the ability to alter behaviour in response to environmental feedback, and to relinquish previously successful solutions to problems) versus conservatism (a reluctance or inability to explore or adopt novel solutions to problems when a solution is already known) in apes.
Koops, Kathelijne; McGrew, William C; Matsuzawa, Tetsuro; Knapp, Leslie A
2012-07-01
Nest-building is a great ape universal and arboreal nesting in chimpanzees and bonobos suggests that the common ancestor of Pan and Homo also nested in trees. It has been proposed that arboreal nest-building remained the prevailing pattern until Homo erectus, a fully terrestrial biped, emerged. We investigated the unusual occurrence of ground-nesting in chimpanzees (Pan troglodytes), which may inform on factors influencing the tree-to-ground sleep transition in the hominin lineage. We used a novel genetic approach to examine ground-nesting in unhabituated chimpanzees at Seringbara in the Nimba Mountains, Guinea. Previous research showed that ground-nesting at Seringbara was not ecologically determined. Here, we tested a possible mate-guarding function of ground-nesting by analyzing DNA from shed hairs collected from ground nests and tree nests found in close proximity. We examined whether or not ground-nesting was a group-level behavioral pattern and whether or not it occurred in more than one community. We used multiple genetic markers to identify sex and to examine variation in mitochondrial DNA control region (HV1, HV2) sequences. Ground-nesting was a male-biased behavior and males constructed more elaborate ("night") nests than simple ("day") nests on the ground. The mate-guarding hypothesis was not supported, as ground and associated tree nests were built either by maternally-related males or possibly by the same individuals. Ground-nesting was widespread and likely habitual in two communities. We suggest that terrestrial nest-building may have already occurred in arboreally-adapted early hominins before the emergence of H. erectus. Copyright © 2012 Wiley Periodicals, Inc.
Flemming, Timothy M; Beran, Michael J; Thompson, Roger K R; Kleider, Heather M; Washburn, David A
2008-05-01
Thus far, language- and token-trained apes (e.g., D. Premack, 1976; R. K. R. Thompson, D. L. Oden, & S. T. Boysen, 1997) have provided the best evidence that nonhuman animals can solve, complete, and construct analogies, thus implicating symbolic representation as the mechanism enabling the phenomenon. In this study, the authors examined the role of stimulus meaning in the analogical reasoning abilities of three different primate species. Humans (Homo sapiens), chimpanzees (Pan troglodytes), and rhesus monkeys (Macaca mulatta) completed the same relational matching-to-sample (RMTS) tasks with both meaningful and nonmeaningful stimuli. This discrimination of relations-between-relations serves as the basis for analogical reasoning. Meaningfulness facilitated the acquisition of analogical matching for human participants, whereas individual differences among the chimpanzees suggest that meaning can either enable or hinder their ability to complete analogies. Rhesus monkeys did not succeed in the RMTS task regardless of stimulus meaning, suggesting that their ability to reason analogically, if present at all, may be dependent on a dimension other than the representational value of stimuli. PsycINFO Database Record (c) 2008 APA, all rights reserved.
Vacher, C; Ben Hadj Yahia, S; Braun, M; Journeau, P
2014-03-01
Comparing to other primates, one of the most important specificities of the human anatomy are consequences of bipedalism. Although bone consequences are well known (lumbar lordosis, horizontal position of the foramen magnum, lengthening of the lower limbs, reduction of the pelvis, specialization of the foot), consequences of our locomotion on the Latissimus dorsi are still unclear. One dissection of a chimpanzee Latissimus dorsi (Pan troglodytes) has been performed and compared to 30 human Latissimus dorsi dissections (10 fresh cadavers and 20 formoled cadavers). In each dissection, the existence of direct muscular insertions on the iliac crest has been investigated and the constitution of the thoracolumbar fascia has been described. In chimpanzee dissection, a muscular direct insertion of the Latissimus dorsi was present on the iliac crest of 9 cm long. The TLF was made of the superficial and the deep fascias of the Latissimus dorsi and the superficial fascia of the erector spinae muscles which was deeper. In man, there was no direct muscular insertion of the Latissimus dorsi in 90 % of cases, the TLF was constituted the same way. This study suggests that the Latissimus dorsi has been separated from the iliac crest in man during the evolution because of the permanent bipedalism and that it stayed inserted on the iliac crest in chimpanzee because of the brachiation. Copyright © 2013 Elsevier Masson SAS. All rights reserved.
Thunström, Maria; Persson, Tomas; Björklund, Mats
2013-01-01
Rejections of infants among non-human primates occasionally occur in the wild as well as in captive settings. Controlled adoptions of orphans and introductions of individuals into new groups are therefore sometimes necessary in captivity. Consequently, behavioral research on integration procedures and on the acceptance of infants by adoptive mothers is much needed. In this study, the introduction and subsequent adoption were examined in an 18-month-old hand-reared chimpanzee (Pan troglodytes). The infant was introduced into an age/sex-diversified social group of conspecifics at Furuvik Zoo, Gävle, Sweden, and continuous focal data was collected during the final stage of integration, including infant care exhibited by the group members and the infant's secure base behavior. The infant was successfully integrated into the group and engaged in positive social interactions with all group members. An adult primiparous female chimpanzee formed a bond resembling a mother-infant relationship with the infant, which continues to be maintained at publication. However, the female initially showed very limited interest in the infant. It was, in fact, two other younger female group members that exhibited most infant care. The infant's secure base behavior patterns indicate that she adapted well to the new circumstances in the chimpanzee group as the integration progressed. This provides evidence that a final adopter does not necessarily initially show maternal interest and that there can be flexibility in maternal behavior in adult chimpanzee females. Moreover, the methods applied employing gradual familiarization with all the group members and the use of an integration enclosure, may have contributed to a successful result. These findings extend our knowledge of introduction procedures in captivity as well as provide information on foster mother-infant attachment in chimpanzees.
Cronin, Katherine A.; Pieper, Bridget A.; van Leeuwen, Edwin J. C.; Mundry, Roger; Haun, Daniel B. M.
2014-01-01
In the wild, chimpanzees (Pan troglodytes) are often faced with clumped food resources that they may know how to access but abstain from doing so due to social pressures. To better understand how social settings influence resource acquisition, we tested fifteen semi-wild chimpanzees from two social groups alone and in the presence of others. We investigated how resource acquisition was affected by relative social dominance, whether collaborative problem solving or (active or passive) sharing occurred amongst any of the dyads, and whether these outcomes were related to relationship quality as determined from six months of observational data. Results indicated that chimpanzees obtained fewer rewards when tested in the presence of others compared to when they were tested alone, and this loss tended to be greater when paired with a higher ranked individual. Individuals demonstrated behavioral inhibition; chimpanzees who showed proficient skill when alone often abstained from solving the task when in the presence of others. Finally, individuals with close social relationships spent more time together in the problem solving space, but collaboration and sharing were infrequent and sessions in which collaboration or sharing did occur contained more instances of aggression. Group living provides benefits and imposes costs, and these findings highlight that one cost of group living may be diminishing productive individual behaviors. PMID:24695486
Directory of Open Access Journals (Sweden)
Katherine A Cronin
Full Text Available In the wild, chimpanzees (Pan troglodytes are often faced with clumped food resources that they may know how to access but abstain from doing so due to social pressures. To better understand how social settings influence resource acquisition, we tested fifteen semi-wild chimpanzees from two social groups alone and in the presence of others. We investigated how resource acquisition was affected by relative social dominance, whether collaborative problem solving or (active or passive sharing occurred amongst any of the dyads, and whether these outcomes were related to relationship quality as determined from six months of observational data. Results indicated that chimpanzees obtained fewer rewards when tested in the presence of others compared to when they were tested alone, and this loss tended to be greater when paired with a higher ranked individual. Individuals demonstrated behavioral inhibition; chimpanzees who showed proficient skill when alone often abstained from solving the task when in the presence of others. Finally, individuals with close social relationships spent more time together in the problem solving space, but collaboration and sharing were infrequent and sessions in which collaboration or sharing did occur contained more instances of aggression. Group living provides benefits and imposes costs, and these findings highlight that one cost of group living may be diminishing productive individual behaviors.
Carvalho, Susana; Cunha, Eugénia; Sousa, Cláudia; Matsuzawa, Tetsuro
2008-07-01
We apply archaeological methods to extend our knowledge of chimpanzee material culture. The chaîne opératoire conceptual framework, as introduced by ethnography, established technology as a phased process. Prehistoric archaeology adopted this concept to elucidate technological variability in tool-making procedures, based on knowledge of tool functions or subsistence patterns. We focused on the detection of operational sequences by wild chimpanzees (Pan troglodytes verus) when nut cracking with lithic implements at the sites of Bossou and Diecké, Guinea, West Africa. Thus, while it has recently been claimed that chimpanzees leave behind recognizable assemblages of stone hammers that can be morphologically distinguished from Oldowan hammers, this is the first study to focus specifically on the existence of operational sequences during the utilization of stone tools by wild chimpanzees. By combining primatological and archaeological methods and examining ecological areas inhabited by different chimpanzee groups, we sought technological variability and identified variables influencing regional diversity in tool typology and technology. We compared three case studies: (1) Bossou-direct recording of experimental nut-cracking sessions; (2) Bossou- direct and indirect monitoring of nut-cracking sites in the wild; (3) Diecké-indirect monitoring of nut-cracking sites in the wild. Results suggest that chimpanzees perform sequences of repeated tool transport and nut cracking. Data show discrimination of tool functions based on tool features. We identified the most technologically complex tool for nut cracking, which was composed of four stones. We found regional diversity in chimpanzee stone assemblages. Raw-material type and tool mobility constrain technological development in human and nonhuman primates. Spatial analysis of tool distribution indicates a pattern of resource-exploitation strategy, revealing affinities with Oldowan.
Directory of Open Access Journals (Sweden)
Cristiane S. Pizzutto
2015-01-01
Full Text Available The influence of stress in an environment, according with the behavioral and endocrine variables of primates, are increasingly being studied by a diversity of authors, and have shown that abnormal behaviors associated with increased glucocorticoids may be directly related with the impairment of their well-being. In this work were used 22 adult chimpanzees (Pan troglodytes, 11 males and 11 females, kept in captivity in three different institutions. All animals had their behavior registered by focal session using a 30 seconds sample interval, during six months, totaling 4,800 registries per each animal. During this period, fecal samples were collected 3 times a week for the extraction and measurement of the concentration of fecal metabolites of glucocorticoid by radioimmunoassay. Of the total observed, stereotypical behaviors represented 13,45±2.76%, and among them, self-mutilation represented 38.28±3.98 %. The animals were classified into three different scores, according with the percentage of body surface with alopecia due to self-mutilation. It was found a positive correlation of high intensity between the scores of alopecia due to the observed mutilation and the average concentrations of fecal metabolites of glucocorticoids. This result strongly suggests that this measurement of self-mutilation in a chimpanzee can be used as an important auxiliary tool to evaluate de conditions of adaptation of an animal in captivity, functioning as a direct indicator of the presence of chronic stress.
Covariación ontogénica en el endocráneo de Pan troglodytes
Directory of Open Access Journals (Sweden)
Sardi, Marina Laura
2014-06-01
Full Text Available Diversos estudios proponen que el neurocráneo en Homo sapiens es una estructura integrada y que la morfología de la bóveda y la base se asocia con modificaciones del cerebro. En este estudio se evaluó la covariación ontogénica en el endocráneo de Pan troglodytes, otro primate altamente encefalizado. Se analizaron 52 reconstrucciones 3D derivadas de tomografías computadas de individuos adultos y subadultos. Una vez segmentadas las cavidades endocraneanas, se relevaron 27 landmarks. A partir de su configuración, se obtuvieron el tamaño del centroide y las coordenadas de Procrustes y se realizó Análisis de Componentes Principales, regresión, correlación, ANOVA y análisis F de Goodall a fin de evaluar los cambios de tamaño y forma respecto de la edad y las alometrías. Los cambios en forma están fuertemente integrados y se producen hasta etapas tardías de la ontogenia: elongación de la bóveda y la base, distanciamiento entre el foramen magnun y la placa cribiforme, retroflexión del ángulo basicraneano y descenso de los polos temporales. A partir del análisis PLS se observó que los cambios en la base y la bóveda covarían, pero cuando se ajustó el efecto alométrico, dicha covariación se hizo no significativa, tal como ocurre en Homo sapiens. Esto sugiere que el aumento ontogénico del volumen endocraneano -en relación con el crecimiento cerebral- constituye un factor común de integración entre la bóveda y la base en ambas especies. Sin embargo, es probable que en el chimpancé se sume la influencia de distintas estructuras faciales que promuevan variación y covariación en el endocráneo.
Kaur, Taranjit; Singh, Jatinder; Huffman, Michael A; Petrzelková, Klára J; Taylor, Nancy S; Xu, Shilu; Dewhirst, Floyd E; Paster, Bruce J; Debruyne, Lies; Vandamme, Peter; Fox, James G
2011-04-01
The transmission of simian immunodeficiency and Ebola viruses to humans in recent years has heightened awareness of the public health significance of zoonotic diseases of primate origin, particularly from chimpanzees. In this study, we analyzed 71 fecal samples collected from 2 different wild chimpanzee (Pan troglodytes) populations with different histories in relation to their proximity to humans. Campylobacter spp. were detected by culture in 19/56 (34%) group 1 (human habituated for research and tourism purposes at Mahale Mountains National Park) and 0/15 (0%) group 2 (not human habituated but propagated from an introduced population released from captivity over 30 years ago at Rubondo Island National Park) chimpanzees, respectively. Using 16S rRNA gene sequencing, all isolates were virtually identical (at most a single base difference), and the chimpanzee isolates were most closely related to Campylobacter helveticus and Campylobacter upsaliensis (94.7% and 95.9% similarity, respectively). Whole-cell protein profiling, amplified fragment length polymorphism analysis of genomic DNA, hsp60 sequence analysis, and determination of the mol% G+C content revealed two subgroups among the chimpanzee isolates. DNA-DNA hybridization experiments confirmed that both subgroups represented distinct genomic species. In the absence of differential biochemical characteristics and morphology and identical 16S rRNA gene sequences, we propose to classify all isolates into a single novel nomenspecies, Campylobacter troglodytis, with strain MIT 05-9149 as the type strain; strain MIT 05-9157 is suggested as the reference strain for the second C. troglodytis genomovar. Further studies are required to determine whether the organism is pathogenic to chimpanzees and whether this novel Campylobacter colonizes humans and causes enteric disease.
Directory of Open Access Journals (Sweden)
Kristi L. Lewton
2017-08-01
Full Text Available The physical environments of captive and wild animals frequently differ in substrate types and compliance. As a result, there is an assumption that differences in rearing environments between captive and wild individuals produce differences in skeletal morphology. Here, this hypothesis is tested using a sample of 42 captive and wild common chimpanzees (Pan troglodytes. Articular surface areas of the humerus, radius, ulna, femur, and tibia were calculated from linear breadth measurements, adjusted for size differences using Mosimann shape variables, and compared across sex and environmental groups using two-way ANOVA. Results indicate that the articular surfaces of the wrist and knee differ between captive and wild chimpanzees; captive individuals have significantly larger distal ulna and tibial plateau articular surfaces. In both captive and wild chimpanzees, males have significantly larger femoral condyles and distal radius surfaces than females. Finally, there is an interaction effect between sex and rearing in the articular surfaces of the femoral condyles and distal radius in which captive males have significantly larger surface areas than all other sex-rearing groups. These data suggest that long bone articular surfaces may be sensitive to differences experienced by captive and wild individuals, such as differences in diet, body mass, positional behaviors, and presumed loading environments. Importantly, these results only find differences due to rearing environment in some long bone articular surfaces. Thus, future work on skeletal morphology could cautiously incorporate data from captive individuals, but should first investigate potential intraspecific differences between captive and wild individuals.
Kaur, Taranjit; Singh, Jatinder; Huffman, Michael A.; Petrželková, Klára J.; Taylor, Nancy S.; Xu, Shilu; Dewhirst, Floyd E.; Paster, Bruce J.; Debruyne, Lies; Vandamme, Peter; Fox, James G.
2011-01-01
The transmission of simian immunodeficiency and Ebola viruses to humans in recent years has heightened awareness of the public health significance of zoonotic diseases of primate origin, particularly from chimpanzees. In this study, we analyzed 71 fecal samples collected from 2 different wild chimpanzee (Pan troglodytes) populations with different histories in relation to their proximity to humans. Campylobacter spp. were detected by culture in 19/56 (34%) group 1 (human habituated for research and tourism purposes at Mahale Mountains National Park) and 0/15 (0%) group 2 (not human habituated but propagated from an introduced population released from captivity over 30 years ago at Rubondo Island National Park) chimpanzees, respectively. Using 16S rRNA gene sequencing, all isolates were virtually identical (at most a single base difference), and the chimpanzee isolates were most closely related to Campylobacter helveticus and Campylobacter upsaliensis (94.7% and 95.9% similarity, respectively). Whole-cell protein profiling, amplified fragment length polymorphism analysis of genomic DNA, hsp60 sequence analysis, and determination of the mol% G+C content revealed two subgroups among the chimpanzee isolates. DNA-DNA hybridization experiments confirmed that both subgroups represented distinct genomic species. In the absence of differential biochemical characteristics and morphology and identical 16S rRNA gene sequences, we propose to classify all isolates into a single novel nomenspecies, Campylobacter troglodytis, with strain MIT 05-9149 as the type strain; strain MIT 05-9157 is suggested as the reference strain for the second C. troglodytis genomovar. Further studies are required to determine whether the organism is pathogenic to chimpanzees and whether this novel Campylobacter colonizes humans and causes enteric disease. PMID:21278267
NCBI nr-aa BLAST: CBRC-MDOM-06-0050 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-06-0050 ref|XP_510783.2| PREDICTED: cell death inducing protein isoform 4... [Pan troglodytes] ref|XP_001168950.1| PREDICTED: cell death inducing protein isoform 2 [Pan troglodytes] re...f|XP_001168974.1| PREDICTED: cell death inducing protein isoform 3 [Pan troglodytes] XP_510783.2 1e-66 69% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-1044 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MLUC-01-1044 ref|XP_510783.2| PREDICTED: cell death inducing protein isoform 4... [Pan troglodytes] ref|XP_001168950.1| PREDICTED: cell death inducing protein isoform 2 [Pan troglodytes] re...f|XP_001168974.1| PREDICTED: cell death inducing protein isoform 3 [Pan troglodytes] XP_510783.2 3e-73 73% ...
Public information use in chimpanzees (Pan troglodytes) and children (Homo sapiens)
DEFF Research Database (Denmark)
Vale, Gill L; Flynn, Emma G; Lambeth, Susan P
2014-01-01
The discernment of resource quality is pertinent to many daily decisions faced by animals. Public information is a critical information source that promotes quality assessments, attained by monitoring others' performance. Here we provide the first evidence, to our knowledge, that chimpanzees (Pan...
NCBI nr-aa BLAST: CBRC-RNOR-05-0198 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-05-0198 ref|XP_001163354.1| PREDICTED: T-cell acute lymphocytic leukemia ...1 isoform 1 [Pan troglodytes] ref|XP_001163426.1| PREDICTED: T-cell acute lymphocytic leukemia 1 isoform 2 [...Pan troglodytes] ref|XP_513389.2| PREDICTED: T-cell acute lymphocytic leukemia 1 isoform 3 [Pan troglodytes] XP_001163354.1 1e-174 91% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-0714 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OPRI-01-0714 ref|XP_001165432.1| PREDICTED: caspase recruitment domain family,... member 4 isoform 1 [Pan troglodytes] ref|XP_001165528.1| PREDICTED: caspase recruitment domain family, memb...er 4 isoform 2 [Pan troglodytes] ref|XP_001165565.1| PREDICTED: caspase recruitment domain family, member 4 isoform 3 [Pan troglodytes] XP_001165432.1 0.0 79% ...
Pruetz, J. D.; Bertolani, P.; Ontl, K. Boyer; Lindshield, S.; Shelley, M.; Wessling, E. G.
2015-01-01
For anthropologists, meat eating by primates like chimpanzees (Pan troglodytes) warrants examination given the emphasis on hunting in human evolutionary history. As referential models, apes provide insight into the evolution of hominin hunting, given their phylogenetic relatedness and challenges reconstructing extinct hominin behaviour from palaeoanthropological evidence. Among chimpanzees, adult males are usually the main hunters, capturing vertebrate prey by hand. Savannah chimpanzees (P. t. verus) at Fongoli, Sénégal are the only known non-human population that systematically hunts vertebrate prey with tools, making them an important source for hypotheses of early hominin behaviour based on analogy. Here, we test the hypothesis that sex and age patterns in tool-assisted hunting (n=308 cases) at Fongoli occur and differ from chimpanzees elsewhere, and we compare tool-assisted hunting to the overall hunting pattern. Males accounted for 70% of all captures but hunted with tools less than expected based on their representation on hunting days. Females accounted for most tool-assisted hunting. We propose that social tolerance at Fongoli, along with the tool-assisted hunting method, permits individuals other than adult males to capture and retain control of prey, which is uncommon for chimpanzees. We assert that tool-assisted hunting could have similarly been important for early hominins. PMID:26064638
Watts, David P
2016-01-01
Chimpanzees (Pan troglodytes) use some communicative signals flexibly and voluntarily, with use influenced by learning. These signals include some vocalizations and also sounds made using the lips, oral cavity, and/or teeth, but not the vocal tract, such as "attention-getting" sounds directed at humans by captive chimpanzees and lip smacking during social grooming. Chimpanzees at Ngogo, in Kibale National Park, Uganda, make four distinct sounds while grooming others. Here, I present data on two of these ("splutters" and "teeth chomps") and consider whether social learning contributes to variation in their production and whether they serve social functions. Higher congruence in the use of these two sounds between dyads of maternal relatives than dyads of non-relatives implies that social learning occurs and mostly involves vertical transmission, but the results are not conclusive and it is unclear which learning mechanisms may be involved. In grooming between adult males, tooth chomps and splutters were more likely in long than in short bouts; in bouts that were bidirectional rather than unidirectional; in grooming directed toward high-ranking males than toward low-ranking males; and in bouts between allies than in those between non-allies. Males were also more likely to make these sounds while they were grooming other males than while they were grooming females. These results are expected if the sounds promote social bonds and induce tolerance of proximity and of grooming by high-ranking males. However, the alternative hypothesis that the sounds are merely associated with motivation to groom, with no additional social function, cannot be ruled out. Limited data showing that bouts accompanied by teeth chomping or spluttering at their initiation were longer than bouts for which this was not the case point toward a social function, but more data are needed for a definitive test. Comparison to other research sites shows that the possible existence of grooming
Davila-Ross, Marina; Jesus, Goncalo; Osborne, Jade; Bard, Kim A
2015-01-01
The ability to flexibly produce facial expressions and vocalizations has a strong impact on the way humans communicate, as it promotes more explicit and versatile forms of communication. Whereas facial expressions and vocalizations are unarguably closely linked in primates, the extent to which these expressions can be produced independently in nonhuman primates is unknown. The present work, thus, examined if chimpanzees produce the same types of facial expressions with and without accompanying vocalizations, as do humans. Forty-six chimpanzees (Pan troglodytes) were video-recorded during spontaneous play with conspecifics at the Chimfunshi Wildlife Orphanage. ChimpFACS was applied, a standardized coding system to measure chimpanzee facial movements, based on FACS developed for humans. Data showed that the chimpanzees produced the same 14 configurations of open-mouth faces when laugh sounds were present and when they were absent. Chimpanzees, thus, produce these facial expressions flexibly without being morphologically constrained by the accompanying vocalizations. Furthermore, the data indicated that the facial expression plus vocalization and the facial expression alone were used differently in social play, i.e., when in physical contact with the playmates and when matching the playmates' open-mouth faces. These findings provide empirical evidence that chimpanzees produce distinctive facial expressions independently from a vocalization, and that their multimodal use affects communicative meaning, important traits for a more explicit and versatile way of communication. As it is still uncertain how human laugh faces evolved, the ChimpFACS data were also used to empirically examine the evolutionary relation between open-mouth faces with laugh sounds of chimpanzees and laugh faces of humans. The ChimpFACS results revealed that laugh faces of humans must have gradually emerged from laughing open-mouth faces of ancestral apes. This work examines the main evolutionary
McKenney, Erin A; Ashwell, Melissa; Lambert, Joanna E; Fellner, Vivek
2014-11-01
Microbial populations in the gastrointestinal tract contribute to host health and nutrition. Although gut microbial ecology is well studied in livestock and domestic animals, little is known of the endogenous populations inhabiting primates or carnivora. We characterized microbial populations in fecal cultures from gorillas (Gorilla gorilla gorilla), common chimpanzees (Pan troglodytes), Hamadryas baboons (Papio hamadryas) and binturongs (Arctictis binturong) to compare the microbiomes associated with different gastrointestinal morphologies and different omnivorous feeding strategies. Each species was fed a distinct standardized diet for 2 weeks prior to fecal collection. All diets were formulated to reflect the species' feeding strategies in situ. Fresh fecal samples were pooled within species and used to inoculate in vitro batch cultures. Acetate, propionate, butyrate and valerate were measured after 24 h of incubation. Eubacterial DNA was extracted from individual fecal samples, pooled, and the cpn60 gene region was amplified and then sequenced to identify the major eubacterial constituents associated with each host species. Short chain fatty acids (P < 0.001) and methane (P < 0.001) were significantly different across species. Eubacterial profiles were consistent with fermentation data and suggest an increase in diversity with dietary fiber. © 2014 International Society of Zoological Sciences, Institute of Zoology/Chinese Academy of Sciences and Wiley Publishing Asia Pty Ltd.
Davila-Ross, Marina; Jesus, Goncalo; Osborne, Jade; Bard, Kim A.
2015-01-01
The ability to flexibly produce facial expressions and vocalizations has a strong impact on the way humans communicate, as it promotes more explicit and versatile forms of communication. Whereas facial expressions and vocalizations are unarguably closely linked in primates, the extent to which these expressions can be produced independently in nonhuman primates is unknown. The present work, thus, examined if chimpanzees produce the same types of facial expressions with and without accompanying vocalizations, as do humans. Forty-six chimpanzees (Pan troglodytes) were video-recorded during spontaneous play with conspecifics at the Chimfunshi Wildlife Orphanage. ChimpFACS was applied, a standardized coding system to measure chimpanzee facial movements, based on FACS developed for humans. Data showed that the chimpanzees produced the same 14 configurations of open-mouth faces when laugh sounds were present and when they were absent. Chimpanzees, thus, produce these facial expressions flexibly without being morphologically constrained by the accompanying vocalizations. Furthermore, the data indicated that the facial expression plus vocalization and the facial expression alone were used differently in social play, i.e., when in physical contact with the playmates and when matching the playmates’ open-mouth faces. These findings provide empirical evidence that chimpanzees produce distinctive facial expressions independently from a vocalization, and that their multimodal use affects communicative meaning, important traits for a more explicit and versatile way of communication. As it is still uncertain how human laugh faces evolved, the ChimpFACS data were also used to empirically examine the evolutionary relation between open-mouth faces with laugh sounds of chimpanzees and laugh faces of humans. The ChimpFACS results revealed that laugh faces of humans must have gradually emerged from laughing open-mouth faces of ancestral apes. This work examines the main evolutionary
Huffman, Michael A; Spiezio, Caterina; Sgaravatti, Andrea; Leca, Jean-Baptiste
2010-11-01
Demonstrating the ability to 'copy' the behavior of others is an important aspect in determining whether social learning occurs and whether group level differences in a given behavior represent cultural differences or not. Understanding the occurrence of this process in its natural context is essential, but can be a daunting task in the wild. In order to test the social learning hypothesis for the acquisition of leaf swallowing (LS), a self-medicative behavior associated with the expulsion of parasites, we conducted semi-naturalistic experiments on two captive groups of parasite-free, naïve chimpanzees (Pan troglodytes). Individuals in the group were systematically provided appropriate stimuli (rough hispid leaves) identical to those used by chimpanzees in the wild. Individuals initially responded in a variety of ways, ranging from total aversion to normal chewing and swallowing. Over time, however, the two groups adopted different variants for inserting and folding the leaves in the mouth prior to swallowing them (complete and partial LS), following the specific method spontaneously displayed by the first and primary LS models in their respective groups. These variants were similar to LS displayed by chimpanzees in the wild. Using the option-bias method, we found evidence for social learning leading to group-level biased transmission and group-level stabilization of these two variants. This is the first report on two distinct cultural variants innovated in response to the introduction of natural stimuli that emerged and spread spontaneously and concurrently within two adjacent groups of socially housed primates. These observations support the assertion that LS may reflect a generalized propensity for ingesting rough hispid leaves, which can be socially induced and transmitted within a group. Ingesting an adequate number of these leaves induces increased gut motility, which is responsible for the subsequent expulsion of particular parasite species in the wild
NCBI nr-aa BLAST: CBRC-TNIG-22-0071 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TNIG-22-0071 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 8e-77 50% ...
NCBI nr-aa BLAST: CBRC-PCAP-01-1273 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PCAP-01-1273 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-106 76% ...
NCBI nr-aa BLAST: CBRC-VPAC-01-1343 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-VPAC-01-1343 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 7e-78 83% ...
NCBI nr-aa BLAST: CBRC-RMAC-01-0015 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RMAC-01-0015 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 0.0 96% ...
NCBI nr-aa BLAST: CBRC-TBEL-01-2154 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TBEL-01-2154 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-114 83% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-0324 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0324 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-157 85% ...
NCBI nr-aa BLAST: CBRC-RNOR-05-0237 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-05-0237 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-166 83% ...
NCBI nr-aa BLAST: CBRC-PHAM-01-1406 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PHAM-01-1406 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 0.0 96% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-0626 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OPRI-01-0626 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-167 84% ...
NCBI nr-aa BLAST: CBRC-FRUB-02-0177 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0177 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 3e-76 49% ...
NCBI nr-aa BLAST: CBRC-MDOM-04-0425 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-04-0425 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-136 68% ...
NCBI nr-aa BLAST: CBRC-FCAT-01-0282 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FCAT-01-0282 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-174 83% ...
NCBI nr-aa BLAST: CBRC-HSAP-01-0032 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-01-0032 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 0.0 99% ...
NCBI nr-aa BLAST: CBRC-PTRO-01-0019 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PTRO-01-0019 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 0.0 100% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-1490 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1490 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 0.0 94% ...
NCBI nr-aa BLAST: CBRC-CFAM-02-0024 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CFAM-02-0024 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-171 82% ...
NCBI nr-aa BLAST: CBRC-BTAU-01-3054 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-BTAU-01-3054 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-168 83% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0569 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0569 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 2e-89 53% ...
NCBI nr-aa BLAST: CBRC-PVAM-01-1503 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PVAM-01-1503 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-179 88% ...
NCBI nr-aa BLAST: CBRC-OLAT-16-0022 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OLAT-16-0022 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 4e-75 47% ...
NCBI nr-aa BLAST: CBRC-PABE-01-0133 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PABE-01-0133 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 0.0 98% ...
NCBI nr-aa BLAST: CBRC-ETEL-01-0353 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ETEL-01-0353 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-154 76% ...
NCBI nr-aa BLAST: CBRC-MMUS-04-0074 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-04-0074 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-166 82% ...
NCBI nr-aa BLAST: CBRC-DNOV-01-3215 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-3215 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-175 85% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-1147 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OPRI-01-1147 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 5e-73 83% ...
NCBI nr-aa BLAST: CBRC-GGAL-23-0008 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-23-0008 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 4e-85 50% ...
NCBI nr-aa BLAST: CBRC-TGUT-26-0004 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TGUT-26-0004 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 6e-87 50% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-2431 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-2431 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-89 50% ...
NCBI nr-aa BLAST: CBRC-EEUR-01-1511 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-EEUR-01-1511 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 0.0 88% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1608 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-155 77% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-1024 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MEUG-01-1024 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-130 65% ...
NCBI nr-aa BLAST: CBRC-STRI-01-2756 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-STRI-01-2756 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-145 72% ...
NCBI nr-aa BLAST: CBRC-OANA-01-1293 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OANA-01-1293 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-103 56% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-1349 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OPRI-01-1349 ref|XP_515116.2| PREDICTED: caspase recruitment domain protein 10... isoform 3 [Pan troglodytes] ref|XP_001160660.1| PREDICTED: caspase recruitment domain protein 10 isoform 2 [Pan troglodytes] XP_515116.2 7.0 29% ...
Geometric morphometrics in primatology: craniofacial variation in Homo sapiens and Pan troglodytes.
Lynch, J M; Wood, C G; Luboga, S A
1996-01-01
Traditionally, morphometric studies have relied on statistical analysis of distances, angles or ratios to investigate morphometric variation among taxa. Recently, geometric techniques have been developed for the direct analysis of landmark data. In this paper, we offer a summary (with examples) of three of these newer techniques, namely shape coordinate, thin-plate spline and relative warp analyses. Shape coordinate analysis detected significant craniofacial variation between 4 modern human populations, with African and Australian Aboriginal specimens being relatively prognathous compared with their Eurasian counterparts. In addition, the Australian specimens exhibited greater basicranial flexion than all other samples. The observed relationships between size and craniofacial shape were weak. The decomposition of shape variation into affine and non-affine components is illustrated via a thin-plate spline analysis of Homo and Pan cranial landmarks. We note differences between Homo and Pan in the degree of prognathism and basicranial flexion and the position and orientation of the foramen magnum. We compare these results with previous studies of these features in higher primates and discuss the utility of geometric morphometrics as a tool in primatology and physical anthropology. We conclude that many studies of morphological variation, both within and between taxa, would benefit from the graphical nature of these techniques.
2011-11-01
... To List All Chimpanzees (Pan troglodytes) as Endangered AGENCY: Fish and Wildlife Service, Interior... chimpanzees (Pan troglodytes) as endangered under the Endangered Species Act of 1973, as amended. We are now... details. FOR FURTHER INFORMATION CONTACT: Janine Van Norman, Chief, Branch of Foreign Species, Endangered...
NCBI nr-aa BLAST: CBRC-ETEL-01-0405 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ETEL-01-0405 ref|XP_001164748.1| PREDICTED: solute carrier family 23 (nucleobase transporters...), member 2 isoform 2 [Pan troglodytes] ref|XP_001164789.1| PREDICTED: solute carrier family 23 (nucleobase transporte...rs), member 2 isoform 3 [Pan troglodytes] XP_001164748.1 1e-176 90% ...
Lethal aggression in Pan is better explained by adaptive strategies than human impacts.
Wilson, Michael L; Boesch, Christophe; Fruth, Barbara; Furuichi, Takeshi; Gilby, Ian C; Hashimoto, Chie; Hobaiter, Catherine L; Hohmann, Gottfried; Itoh, Noriko; Koops, Kathelijne; Lloyd, Julia N; Matsuzawa, Tetsuro; Mitani, John C; Mjungu, Deus C; Morgan, David; Muller, Martin N; Mundry, Roger; Nakamura, Michio; Pruetz, Jill; Pusey, Anne E; Riedel, Julia; Sanz, Crickette; Schel, Anne M; Simmons, Nicole; Waller, Michel; Watts, David P; White, Frances; Wittig, Roman M; Zuberbühler, Klaus; Wrangham, Richard W
2014-09-18
Observations of chimpanzees (Pan troglodytes) and bonobos (Pan paniscus) provide valuable comparative data for understanding the significance of conspecific killing. Two kinds of hypothesis have been proposed. Lethal violence is sometimes concluded to be the result of adaptive strategies, such that killers ultimately gain fitness benefits by increasing their access to resources such as food or mates. Alternatively, it could be a non-adaptive result of human impacts, such as habitat change or food provisioning. To discriminate between these hypotheses we compiled information from 18 chimpanzee communities and 4 bonobo communities studied over five decades. Our data include 152 killings (n = 58 observed, 41 inferred, and 53 suspected killings) by chimpanzees in 15 communities and one suspected killing by bonobos. We found that males were the most frequent attackers (92% of participants) and victims (73%); most killings (66%) involved intercommunity attacks; and attackers greatly outnumbered their victims (median 8:1 ratio). Variation in killing rates was unrelated to measures of human impacts. Our results are compatible with previously proposed adaptive explanations for killing by chimpanzees, whereas the human impact hypothesis is not supported.
Dicty_cDB: Contig-U15405-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available tugueseWaterDog Canis familiar... 44 0.80 1 ( BV312740 )...s troglodyt... 44 0.80 1 ( BV495481 ) S217P61918FE2.T0 Noemie Pan troglodytes troglodyt... 44 0.80 1 ( BV436248 ) S237P6495RF5.T0 Por
Schmittbuhl, M; Le Minor, J M; Schaaf, A
1996-01-01
In order to quantify the relative position and extent of the nasal and orbital openings in hominoid primates, a new methodology based on image analysis was developed and applied to a series of 134 hominoid skulls (52 Gorilla gorilla; 30 Pan troglodytes; 44 Homo sapiens, and, as comparison material, 8 Pongo pygmaeus). The areas and the centres of area of the orbital and nasal openings were determined automatically. The orbitonasal triangle connecting these three centres of area was then constructed. This triangle was used to quantify the elongation of the face. It was most elongated in gorilla, shortest in the human species and intermediate in Pan; the elongation in Pongo was close to that in Gorilla. The proportions of the areas of the orbital and nasal openings in the face were related to the extent of the bony structures of the midface and were thus used to quantify the facial robustness. A robust face was demonstrated in Gorilla, but a gracile face in the human species. Robusticity in Pan was intermediate.
Socially transmitted diffusion of a novel behavior from subordinate chimpanzees
DEFF Research Database (Denmark)
Watson, Stuart K; Reamer, Lisa A; Mareno, Mary Catherine
2017-01-01
Chimpanzees (Pan troglodytes) demonstrate much cultural diversity in the wild, yet a majority of novel behaviors do not become group-wide traditions. Since many such novel behaviors are introduced by low-ranking individuals, a bias toward copying dominant individuals ("rank-bias") has been proposed...... as an explanation for their limited diffusion. Previous experimental work showed that chimpanzees (Pan troglodytes) preferentially copy dominant over low-rank models. We investigated whether low ranking individuals may nevertheless successfully seed a beneficial behavior as a tradition if there are no "competing...
The spermatozoon of a 'living fossil': Tubiluchus troglodytes (Priapulida).
Ferraguti, Marco; Garbelli, Claudio
2006-02-01
The spermatozoon of Tubiluchus troglodytes, the first priapulid formally described from the Mediterranean Sea has a head composed of an acrosome and a nucleus. The acrosome is divided in two branches coiled around the nucleus. The nucleus is basally columnar, but apically generates two rods helically coiled one around the other. The midpiece is formed by an axoneme with 27 accessory microtubules, surrounded by three mitochondria. An annulus separates the midpiece from the tail that contains a 9 + 2 axoneme surrounded by nine accessory microtubules. The spermatozoon of T. troglodytes is similar to that of the other two species known from the genus, and completely different from the 'primitive' one of the other priapulids. Since Tubiluchus is considered the most basal of the extant priapulids, and the only genus with an internal fertilization, it may be that in priapulids the external fertilization is a derived character.
Uterine leiomyoma in chimpanzee (Pan troglodytes Leiomioma uterino em chimpanzé (Pan troglodytes
Directory of Open Access Journals (Sweden)
A.E. Silva
2006-02-01
Full Text Available Uma chimpanzé de 22 anos de idade foi necropsiada com histórico clínico de anorexia, vômitos freqüentes e desidratação conseqüentes à gastrite iatrogênica. Macroscopicamente, o útero apresentava-se aumentado de volume, com o lúmen totalmente ocluído por nódulos firmes, esbranquiçados e coalescentes que se estendiam para o miométrio. Histologicamente, os nódulos eram constituídos por leiomiócitos bem diferenciados dispostos em várias direções e com coloração característica pelo tricrômio de Gomori e Masson. Pela imunoistoquímica, as células neoplásicas apresentavam marcação forte e difusa de receptores para progesterona e estrógeno, assim como de actina alfa de músculo liso. Algumas células neoplásicas e o estroma apresentavam marcação para vimentina e poucas células neoplásicas foram positivas para MIB-1. Com base nas características mosrfológicas e imunoistoquímicas foi firmado o diagnóstico de leiomioma uterino.
NCBI nr-aa BLAST: CBRC-PVAM-01-1589 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PVAM-01-1589 ref|NP_057307.2| protein kinase C and casein kinase substrate in neurons... 3 [Homo sapiens] ref|XP_001110379.1| PREDICTED: similar to protein kinase C and casein kinase substrate in neurons...asein kinase substrate in neurons 3 isoform 2 [Macaca mulatta] ref|XP_001166571.1...| PREDICTED: protein kinase C and casein kinase substrate in neurons 3 isoform 1 [Pan troglodytes] ref|XP_00...1166605.1| PREDICTED: protein kinase C and casein kinase substrate in neurons 3 isoform 2 [Pan troglodytes
NCBI nr-aa BLAST: CBRC-MDOM-05-0155 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-05-0155 ref|NP_057307.2| protein kinase C and casein kinase substrate in neurons... 3 [Homo sapiens] ref|XP_001110379.1| PREDICTED: similar to protein kinase C and casein kinase substrate in neurons...asein kinase substrate in neurons 3 isoform 2 [Macaca mulatta] ref|XP_001166571.1...| PREDICTED: protein kinase C and casein kinase substrate in neurons 3 isoform 1 [Pan troglodytes] ref|XP_00...1166605.1| PREDICTED: protein kinase C and casein kinase substrate in neurons 3 isoform 2 [Pan troglodytes
NCBI nr-aa BLAST: CBRC-MEUG-01-0587 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MEUG-01-0587 ref|NP_057307.2| protein kinase C and casein kinase substrate in neurons... 3 [Homo sapiens] ref|XP_001110379.1| PREDICTED: similar to protein kinase C and casein kinase substrate in neurons...asein kinase substrate in neurons 3 isoform 2 [Macaca mulatta] ref|XP_001166571.1...| PREDICTED: protein kinase C and casein kinase substrate in neurons 3 isoform 1 [Pan troglodytes] ref|XP_00...1166605.1| PREDICTED: protein kinase C and casein kinase substrate in neurons 3 isoform 2 [Pan troglodytes
NCBI nr-aa BLAST: CBRC-PCAP-01-1696 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PCAP-01-1696 ref|NP_057307.2| protein kinase C and casein kinase substrate in neurons... 3 [Homo sapiens] ref|XP_001110379.1| PREDICTED: similar to protein kinase C and casein kinase substrate in neurons...asein kinase substrate in neurons 3 isoform 2 [Macaca mulatta] ref|XP_001166571.1...| PREDICTED: protein kinase C and casein kinase substrate in neurons 3 isoform 1 [Pan troglodytes] ref|XP_00...1166605.1| PREDICTED: protein kinase C and casein kinase substrate in neurons 3 isoform 2 [Pan troglodytes
The Cook, the Thief, his Wife and her Lovert : on the evolution of the human reproductive strategy
Schuiling, GA
2003-01-01
Human reproductive strategy differs from that of most other mammals, including Apes such as the closely related chimpanzee (Pan troglodytes) and the bonobo (Pan paniscus). For example, humans, although basically polygamic, exhibit a strong tendency to (serial) monogamy and-very rare for a
Pan-pan Girls: Humiliating Liberation in Postwar Japanese Literature
Directory of Open Access Journals (Sweden)
Rumi Sakamoto
2010-09-01
Full Text Available This paper looks at some literary representations of the ‘pan-pan girls’ in postwar Japan. ‘Pan-pan’ is a derogatory term for street prostitutes who (mostly served the soldiers of the occupying forces. Immediately after World War II, the Japanese government established the RAA (Recreation Amusement Association and employed several thousand women to provide sexual services for foreign soldiers, ostensibly to protect Japanese women of middle and upper classes from rape and other violence. When the RAA was closed down in 1946 due to the US concern over widespread VD, many of the women who lost their jobs went out on the street and became private and illegal prostitutes – the pan-pan girls. With their red lipstick, cigarettes, nylon stockings and high-heel shoes, often holding onto the arms of tall, uniformed American GIs, the ‘pan-pan girls’ became a symbol of the occupation, and have been textually reproduced throughout the postwar period. This paper analyses the images and representations of the ‘pan-pan girls’ in postwar Japanese literature, to consider how the ‘pan-pan girls’ have functioned as a metaphor for the occupation and contributed to the public memory construction of the occupation. I identify some major codes of representations (victimisation, humiliation, and national trauma; eroticism and decadence; sexual freedom and materialism and argue that the highly gendered and sexualised bodies of the ‘pan-pan girls’ have continued to allow simplistic and selective remembering of the occupation at the expense of recalling the pivotal role of Japanese patriarchy in the postwar period.
Chimpanzee subspecies and ‘robust’ australopithecine holotypes, in the context of comments by Darwin
Directory of Open Access Journals (Sweden)
S. Prat
2010-02-01
Full Text Available On the basis of comparative anatomy (including chimpanzees, gorillas and other primates, Darwin1 suggested that Africa was the continent from which ‘progenitors’ of humankind evolved. Hominin fossils from this continent proved him correct. We present the results of morphometric analyses based on cranial data obtained from chimpanzee taxa currently recognised as distinct subspecies, namely Pan troglodytes troglodytes and Pan troglodytes schweinfurthii, as well as Pan paniscus (bonobo. Our objective was to use a morphometric technique2 to quantify the degree of similarity between pairs of specimens, in the context of a statistical (probabilistic definition of a species.3–5 Results obtained from great apes, including two subspecies of chimpanzee, were assessed in relation to same-scale comparisons between the holotypes of ‘robust’ australopithecine (Plio-Pleistocene hominin taxa which have traditionally been distinguished at a species level, notably Paranthropus robustus from South Africa, and Paranthropus (Australopithecus/ Zinjanthropus boisei from East Africa. The question arises as to whether the holotypes of these two taxa, TM 1517 from Kromdraai6 and OH 5 from Olduvai,7 respectively, are different at the subspecies rather than at the species level.
Gene : CBRC-GGOR-01-1244 [SEVENS
Lifescience Database Archive (English)
Full Text Available 97% ref|XP_521992.2| PREDICTED: similar to seven transmembrane helix receptor [Pan troglodytes] 3e-70 98% MV...ECFLLAVMAYDRYVAIRNPLLYTVAERNGTERNGTERNSMEWNGMEWNSMEWNGIQWNGMEWNGTVRNGTERNGMEFHGMEWNGMEFHGMEFNAMQRXXXXXXALLAQARTIELEIFLIT ...
Howells, Michaela E; Pruetz, Jill; Gillespie, Thomas R
2011-02-01
The exponential decline of great apes over the past 50 years has resulted in an urgent need for data to inform population viability assessment and conservation strategies. Health monitoring of remaining ape populations is an important component of this process. In support of this effort, we examined endoparasitic and commensal prevalence and richness as proxies of population health for western chimpanzees (Pan troglodytes verus) and sympatric guinea baboons (Papio hamadryas papio) at Fongoli, Senegal, a site dominated by woodland-savanna at the northwestern extent of chimpanzees' geographic range. The small population size and extreme environmental pressures experienced by Fongoli chimpanzees make them particularly sensitive to the potential impact of pathogens. One hundred thirty-two chimpanzee and seventeen baboon fecal samples were processed using sodium nitrate floatation and fecal sedimentation to isolate helminth eggs, larvae, and protozoal cysts. Six nematodes (Physaloptera sp., Ascaris sp., Stronglyloides fuelleborni, Trichuris sp., an unidentified hookworm, and an unidentified larvated nematode), one cestode (Bertiella sp.), and five protozoans (Iodamoeba buetschlii, Entamoeba coli, Troglodytella abrassarti, Troglocorys cava, and an unidentified ciliate) were detected in chimpanzee fecal samples. Four nematodes (Necator sp., S. fuelleborni, Trichuris sp., and an unidentified hookworm sp.), two trematodes (Shistosoma mansoni and an unidentified fluke), and six protozoans (Entamoeba histolytica/dispar, E. coli, Chilomastix mesnili, Balantidium coli, T. abrassarti, and T. cava) were detected in baboon fecal samples. The low prevalence of pathogenic parasite species and high prevalence of symbiotic protozoa in Fongoli chimpanzees are indicative of good overall population health. However, the high prevalence of pathogenic parasites in baboons, who may serve as transport hosts, highlight the need for ongoing pathogen surveillance of the Fongoli chimpanzee
Gene : CBRC-OPRI-01-0327 [SEVENS
Lifescience Database Archive (English)
Full Text Available 4e-59 85% ref|XP_521803.2| PREDICTED: similar to seven transmembrane helix receptor [Pan troglodytes] 2e-60 ...87% MMSLSNSSWRLPQPTFFLVGIPGLEESQHWIALLLAVLYFLALSGNVTILFIVWVDSSLHQPMYLFLAMLAAIDLVLASSTAPKALAVLLIHAHEIGYICCLVQMFFIHAFSSMESGVLVAMALDRYVAYCTLCTTXXXXXXXX ...
A Competitive Nonverbal False Belief Task for Children and Apes
Krachun, Carla; Carpenter, Malinda; Call, Josep; Tomasello, Michael
2009-01-01
A nonverbal false belief task was administered to children (mean age 5 years) and two great ape species: chimpanzees ("Pan troglodytes") and bonobos ("Pan paniscus"). Because apes typically perform poorly in cooperative contexts, our task was competitive. Two versions were run: in both, a human competitor witnessed an experimenter hide a reward in…
Skinner, Mark F; Hopwood, David
2004-03-01
Repetitive linear enamel hypoplasia (rLEH) is often observed in recent large-bodied apes from Africa and Asia as well as Mid- to Late Miocene sites from Spain to China. The ubiquity and periodicity of rLEH are not understood. Its potential as an ontogenetic marker of developmental stress in threatened species (as well as their ancient relatives) makes rLEH an important if enigmatic problem. We report research designed to show the periodicity of rLEH among West African Pan troglodytes (12 male, 32 female), Gorilla gorilla (10 male, 10 female), and Bornean and Sumatran Pongo pygmaeus (11 male, 9 female, 9 unknown) from collections in Europe. Two methods were employed. In the common chimpanzees and gorillas, the space between adjacent, macroscopically visible LEH grooves on teeth with two or more episodes was expressed as an absolute measure and as a ratio of complete unworn crown height. In the orangutans, the number of perikymata between episode onsets, as well as duration of rLEH, was determined from scanning electron micrographs of casts of incisors and canines. We conclude that stress in the form of LEH commences as early as 2.5 years of age in all taxa and lasts for several years, and even longer in orangutans; the stress is not chronic but episodic; the stressor has a strong tendency to occur in pulses of two occurrences each; and large apes from both land masses exhibit rLEH with an average periodicity of 6 months (or multiples thereof; Sumatran orangutans seem to show only annual stress), but this needs further research. This is supported by evidence of spacing between rLEH as well as perikymata counts. Duration of stress in orangutans averages about 6 weeks. Finally, the semiannual stressor transcends geographic and temporal boundaries, and is attributed to regular moisture cycles associated with the intertropical convergence zone modified by the monsoon. While seasonal cycles can influence both disease and nutritional stress, it is likely the combination of
Nest building in House Wrens (Troglodytes aedon) : A reexamination of male and female roles
Alworth, T; Scheiber, IBR
2000-01-01
Nest building by House Wrens (Troglodytes aedon) has been described as occurring in two stages. Males arrive on territories before females and begin the first stage by building a stick foundation in a suitable cavity. In the second stage, females build a soft cup-like structure into the stick base.
Czech Academy of Sciences Publication Activity Database
Vallo, Peter; Petrželková, Klára Judita; Profousová, Ilona; Petrášová, J.; Pomajbíková, K.; Leendertz, F.; Hashimoto, C.; Simmons, N.; Babweteera, F.; Machanda, Z.; Piel, A.; Robbins, M. M.; Boesch, C.; Sanz, C.; Morgan, D.; Sommer, V.; Furuichi, T.; Fujita, S.; Matsuzawa, T.; Kaur, T.; Huffman, M. A.; Modrý, David
2012-01-01
Roč. 148, č. 4 (2012), s. 525-533 ISSN 0002-9483 Institutional support: RVO:68081766 ; RVO:60077344 Keywords : SSU rDNA * ITS * entodiniomorphida * Troglodytellidae * Pan troglodytes Subject RIV: EG - Zoology Impact factor: 2.481, year: 2012
Genetic and phylogenetic characterization of novel bocaparvovirus infecting chimpanzee
Czech Academy of Sciences Publication Activity Database
Brožová, K.; Hrazdilová, K.; Slaninková, E.; Modrý, David; Černý, Jiří; Celer, V.
2016-01-01
Roč. 37, JAN (2016), s. 231-236 ISSN 1567-1348 Institutional support: RVO:60077344 Keywords : Bocavirus * phylogeny * primate * recombination * Bocaparvovirus * chimpanzee * Pan troglodytes Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 2.885, year: 2016
Superficial Velocity Effects on HZ-PAN and AgZ-PAN for Kr/Xe Capture
Energy Technology Data Exchange (ETDEWEB)
Welty, Amy Keil [Idaho National Lab. (INL), Idaho Falls, ID (United States); Garn, Troy Gerry [Idaho National Lab. (INL), Idaho Falls, ID (United States); Greenhalgh, Mitchell Randy [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2016-04-01
Nearly all previous testing of HZ-PAN and AgZ-PAN was conducted at the same flow rate in order to maintain consistency among tests. This testing was sufficient for sorbent capacity determinations, but did not ensure that sorbents were capable of functioning under a range of flow regimes. Tests were conducted on both HZ-PAN and AgZ-PAN at superficial velocities between 20 and 700 cm/min. For HZ-PAN, Kr capacity increased from 60 mmol/kg to 110 mmol/kg as superficial velocity increased from 21 to 679 cm/min. Results for AgZ-PAN were similar, with capacity ranging from 72 to 124 mmol/kg over the same range of superficial. These results are promising for scaling up to process flows, demonstrating flexibility to operate in a broad range of superficial velocities while maintaining sorbent capacity. While preparing for superficial velocity testing it was also discovered that AgZ-PAN Xe capacity, previously observed to diminish over time, could be recovered with increased desorption temperature. Further, a substantial Xe capacity increase was observed. Previous room temperature capacities in the range of 22-25 mmol Xe/kg AgZ-PAN were increased to over 60 mmol Xe/kg AgZ-PAN. While this finding has not yet been fully explored to optimize activation and desorption temperatures, it is encouraging.
Effects of peroxyacetyl nitrate (PAN) on vegetation. I. Herbaceous plants PAN injury symptoms
Energy Technology Data Exchange (ETDEWEB)
Nouchi, I.; Iijima, T.; Oodaira, T.
1975-01-01
A series of exposure experiments were conducted in a controlled-atmosphere exposure chamber equipped with artificial light apparatus, using PAN synthesized from ultraviolet irradiation of ethyl nitrite vapor in oxygen. Exposures of 6 approx. 16 hours and 10 pphm PAN caused serious damage like caving with glazing or bronzing in caved lesions to the lower surface of younger leaves. Leaves of white-flowered petunia were found to be most sensitive to PAN and were damaged even by a 3 pphm exposure. Microscopic examinations showed that the PAN characteristically caused injuries of spongy cells and that these cells collapsed and turned brown. Leaf injury symptoms on herbaceous plants caused by synthesized PAN in the exposure experiments were found to be quite similar to those seen in the field under high oxidant emergence. Therefore, it seems that the said type of injuries to leaf beet, kidney bean, and head lettuce observed in the field were caused by PAN. 21 references. 4 figures, 3 tables.
Analysis list: pan [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available pan Embryo,Larvae,Pupae + dm3 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/target.../pan.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/target/pan.5.tsv http://dbarchive.biosciencedbc.jp.../kyushu-u/dm3/target/pan.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/pan.Embryo.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/dm3/colo/pan.Larvae.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/dm3/colo/pan.Pupae.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/Embryo.gml,http://dbarchive.bioscience
Bipedal tool use strengthens chimpanzee hand preferences
DEFF Research Database (Denmark)
Braccini, Stephanie; Lambeth, Susan; Schapiro, Steve
2010-01-01
The degree to which non-human primate behavior is lateralized, at either individual or population levels, remains controversial. We investigated the relationship between hand preference and posture during tool use in chimpanzees (Pan troglodytes) during bipedal tool use. We experimentally induced...
Czech Academy of Sciences Publication Activity Database
Sá, R. M.; Petrášová, J.; Pomajbíková, K.; Profousová, I.; Petrželková, Klára Judita; Sousa, C.; Cable, J.; Bruford, M. W.; Modrý, David
2013-01-01
Roč. 75, č. 10 (2013), s. 1032-1041 ISSN 0275-2565 Institutional support: RVO:68081766 ; RVO:60077344 Keywords : Cantanhez National Park * fragmentation * Pan troglodytes verus * parasites * symbionts * Trichuris sp Subject RIV: EG - Zoology Impact factor: 2.136, year: 2013
Czech Academy of Sciences Publication Activity Database
Mapua, M. I.; Petrželková, Klára Judita; Burgunder, J.; Dadáková, E.; Brožová, K.; Hrazdilová, K.; Stewart, F. A.; Piel, A. K.; Vallo, Peter; Fuehrer, H.-P.; Hashimoto, C.; Modrý, D.; Qablan, M. A.
2016-01-01
Roč. 15, č. 423 (2016), s. 423 ISSN 1475-2875 Institutional support: RVO:68081766 Keywords : Cyt-b gene * Laverania * Malaria * Pan troglodytes schweinfurthii * Plasmodium spp Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.715, year: 2016
Complexity in behavioural organization and strongylid infection among wild chimpanzees
Czech Academy of Sciences Publication Activity Database
Burgunder, J.; Pafčo, B.; Petrželková, Klára Judita; Modrý, David; Hashimoto, C.; MacIntosh, A. J. J.
2017-01-01
Roč. 129, July (2017), s. 257-268 ISSN 0003-3472 Institutional support: RVO:60077344 Keywords : behavioural complexity * chimpanzees * fractal analysis * health monitoring * Pan troglodytes schweinfurthii * strongylid infection Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 2.869, year: 2016
Complexity in behavioural organization and strongylid infection among wild chimpanzees
Czech Academy of Sciences Publication Activity Database
Burgunder, J.; Pafčo, B.; Petrželková, Klára Judita; Modrý, D.; Hashimoto, C.; MacIntosh, A. J. J.
2017-01-01
Roč. 129, July (2017), s. 257-268 ISSN 0003-3472 Institutional support: RVO:68081766 Keywords : behavioural complexity * chimpanzees * fractal analysis * health monitoring * Pan troglodytes schweinfurthii * strongylid infection Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 2.869, year: 2016
Martin, Allison L.; Bloomsmith, Mollie A.; Kelley, Michael E.; Marr, M. Jackson; Maple, Terry L.
2011-01-01
A functional analysis identified the reinforcer maintaining feces throwing and spitting exhibited by a captive adult chimpanzee ("Pan troglodytes"). The implementation of a function-based treatment combining extinction with differential reinforcement of an alternate behavior decreased levels of inappropriate behavior. These findings further…
HOW TO PAN-SHARPEN IMAGES USING THE GRAM-SCHMIDT PAN-SHARPEN METHOD – A RECIPE
Directory of Open Access Journals (Sweden)
T. Maurer
2013-05-01
Full Text Available Since its publication in 1998 (Laben and Brower, 2000, the Gram-Schmidt pan-sharpen method has become one of the most popular algorithms to pan-sharpen multispectral (MS imagery. It outperforms most other pan-sharpen methods in both maximizing image sharpness and minimizing color distortion. It is, on the other hand, also more complex and computationally expensive than most other methods, as it requires forward and backward transforming the entire image. Another complication is the lack of a clear recipe of how to compute the sensor dependent MS to Pan weights that are needed to compute the simulated low resolution pan band. Estimating them from the sensor’s spectral sensitivity curves (in different ways, or using linear regression or least square methods are typical candidates which can include other degrees of freedom such as adding a constant offset or not. As a result, most companies and data providers do it somewhat differently. Here we present a solution to both problems. The transform coefficients can be computed directly and in advance from the MS covariance matrix and the MS to Pan weights. Once the MS covariance matrix is computed and stored with the image statistics, any small section of the image can be pan-sharpened on the fly, without having to compute anything else over the entire image. Similarly, optimal MS to Pan weights can be computed directly from the full MS-Pan covariance matrix, guaranteeing optimal image quality and consistency.
Antón, Fina; Mandianes Castro, Manuel
1996-01-01
O pan, ademais de cumprir una función alimenticia de primeira orde, está revestido dunha significación simbólica importante. O pan durante a vida axuda a pasa-los límites, a da-lo paso, a integrarse entre os cristiáns por cousa do bautismo e a integrarse no grupo dos homes e mulleres co adaxo da boda, pero o pan axuda, sobre todo, a pasa-lo río Xordán, que é, sen dúbida o límite que separa este mundo do outro; a serpe e as ánimas constitúen un límite e o pan facilita o seu paso. O pan está in...
Chimpanzee malaria parasites related to Plasmodium ovale in Africa.
Directory of Open Access Journals (Sweden)
Linda Duval
Full Text Available Since the 1970's, the diversity of Plasmodium parasites in African great apes has been neglected. Surprisingly, P. reichenowi, a chimpanzee parasite, is the only such parasite to have been molecularly characterized. This parasite is closely phylogenetically related to P. falciparum, the principal cause of the greatest malaria burden in humans. Studies of malaria parasites from anthropoid primates may provide relevant phylogenetic information, improving our understanding of the origin and evolutionary history of human malaria species. In this study, we screened 130 DNA samples from chimpanzees (Pan troglodytes and gorillas (Gorilla gorilla from Cameroon for Plasmodium infection, using cytochrome b molecular tools. Two chimpanzees from the subspecies Pan t. troglodytes presented single infections with Plasmodium strains molecularly related to the human malaria parasite P. ovale. These chimpanzee parasites and 13 human strains of P. ovale originated from a various sites in Africa and Asia were characterized using cytochrome b and cytochrome c oxidase 1 mitochondrial partial genes and nuclear ldh partial gene. Consistent with previous findings, two genetically distinct types of P. ovale, classical and variant, were observed in the human population from a variety of geographical locations. One chimpanzee Plasmodium strain was genetically identical, on all three markers tested, to variant P. ovale type. The other chimpanzee Plasmodium strain was different from P. ovale strains isolated from humans. This study provides the first evidence of possibility of natural cross-species exchange of P. ovale between humans and chimpanzees of the subspecies Pan t. troglodytes.
Czech Academy of Sciences Publication Activity Database
Mapua, M. I.; Petrželková, Klára Judita; Burgunder, J.; Dadáková, E.; Brožová, K.; Hrazdilová, K.; Stewart, F. A.; Piel, A. K.; Vallo, P.; Fuehrer, H.-P.; Hashimoto, C.; Modrý, David; Qablan, M. A.
2016-01-01
Roč. 15, AUG 19 (2016), č. článku 423. ISSN 1475-2875 Institutional support: RVO:60077344 Keywords : Malaria * Pan troglodytes schweinfurthii * Plasmodium spp. * Laverania * Cyt-b gene Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.715, year: 2016
Ibrahim Hamad; Eric Delaporte; Didier Raoult; Fadi Bittar
2014-01-01
The consumption of insects by apes has previously been reported based on direct observations and/or trail signs in feces. However, DNA-based diet analyses may have the potential to reveal trophic links for these wild species. Herein, we analyzed the insect-diet diversity of 9 feces obtained from three species of African great apes, gorilla (Gorilla gorilla gorilla), chimpanzee (Pan troglodytes) and bonobo (Pan paniscus), using two mitochondrial amplifications for arthropods. A total of 1056 c...
Object-based attention in chimpanzees (Pan troglodytes).
Ushitani, Tomokazu; Imura, Tomoko; Tomonaga, Masaki
2010-03-17
We conducted three experiments to investigate how object-based components contribute to the attentional processes of chimpanzees and to examine how such processes operate with regard to perceptually structured objects. In Experiment 1, chimpanzees responded to a spatial cueing task that required them to touch a target appearing at either end of two parallel rectangles. We compared the time involved in shifting attention (cost of attentional shift) when the locations of targets were cued and non cued. Results showed that the cost of the attentional shift within one rectangle was smaller than that beyond the object's boundary, demonstrating object-based attention in chimpanzees. The results of Experiment 2, conducted with different stimulus configurations, replicated the results of Experiment 1, supporting that object-based attention operates in chimpanzees. In Experiment 3, the cost of attentional shift within a cued but partly occluded rectangle was shorter than that within a rectangle that was cued but divided in the middle. The results suggest that the attention of chimpanzees is activated not only by an explicit object but also by fragmented patches represented as an object at a higher-order perceptual level. Chimpanzees' object-based attention may be similar to that of humans. Copyright 2010 Elsevier Ltd. All rights reserved.
Sexual exchange relationships in captive chimpanzees
Hemelrijk, C.K.; Van Laere, G.J.; Van Hooff, J.A.R.A.M.
1992-01-01
In a group of captive chimpanzees (Pan troglodytes), we studied whether females received more social benefits from males when they were in oestrus than at other times and whether males distributed their beneficial acts especially to females with whom they mated more frequently. When in oestrus,
Gestural acquisition in great apes: the Social Negotiation Hypothesis.
Pika, Simone; Fröhlich, Marlen
2018-01-24
Scientific interest in the acquisition of gestural signalling dates back to the heroic figure of Charles Darwin. More than a hundred years later, we still know relatively little about the underlying evolutionary and developmental pathways involved. Here, we shed new light on this topic by providing the first systematic, quantitative comparison of gestural development in two different chimpanzee (Pan troglodytes verus and Pan troglodytes schweinfurthii) subspecies and communities living in their natural environments. We conclude that the three most predominant perspectives on gestural acquisition-Phylogenetic Ritualization, Social Transmission via Imitation, and Ontogenetic Ritualization-do not satisfactorily explain our current findings on gestural interactions in chimpanzees in the wild. In contrast, we argue that the role of interactional experience and social exposure on gestural acquisition and communicative development has been strongly underestimated. We introduce the revised Social Negotiation Hypothesis and conclude with a brief set of empirical desiderata for instigating more research into this intriguing research domain.
Dicty_cDB: Contig-U05654-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 59 ) 1108770679965 New World Screwworm Egg 9261 ESTs C... 38 0.29 2 ( FG301193 ) 1108799272607 New World Scr...31-01-01-1... 38 0.21 2 ( AC159651 ) Pan troglodytes BAC clone CH251-495E21 from chrom... 40 0.28 5 ( FG2846
Padolski, Siarhei; The ATLAS collaboration; Klimentov, Alexei; Korchuganova, Tatiana
2017-01-01
BigPanDA monitoring is a web based application which provides various processing and representation of the Production and Distributed Analysis (PanDA) system objects states. Analyzing hundreds of millions of computation entities such as an event or a job BigPanDA monitoring builds different scale and levels of abstraction reports in real time mode. Provided information allows users to drill down into the reason of a concrete event failure or observe system bigger picture such as tracking the computation nucleus and satellites performance or the progress of whole production campaign. PanDA system was originally developed for the Atlas experiment and today effectively managing more than 2 million jobs per day distributed over 170 computing centers worldwide. BigPanDA is its core component commissioned in the middle of 2014 and now is the primary source of information for ATLAS users about state of their computations and the source of decision support information for shifters, operators and managers. In this wor...
Padolski, Siarhei; The ATLAS collaboration
2017-01-01
BigPanDA monitoring is a web-based application that provides various processing and representation of the Production and Distributed Analysis (PanDA) system objects states. Analysing hundreds of millions of computation entities such as an event or a job BigPanDA monitoring builds different scale and levels of abstraction reports in real time mode. Provided information allows users to drill down into the reason of a concrete event failure or observe system bigger picture such as tracking the computation nucleus and satellites performance or the progress of whole production campaign. PanDA system was originally developed for the Atlas experiment and today effectively managing more than 2 million jobs per day distributed over 170 computing centers worldwide. BigPanDA is its core component commissioned in the middle of 2014 and now is the primary source of information for ATLAS users about state of their computations and the source of decision support information for shifters, operators and managers. In this work...
Chimpanzee (Pan troglodytes troglodytes) tool use in the Ngotto Forest, Central African Republic.
Hicks, Thurston C; Fouts, Roger S; Fouts, Deborah H
2005-03-01
Over a 7-month period, stick tools constructed by chimpanzees were collected and measured at the Ngotto Forest site in Central African Republic. The chimpanzees were found to use tools to dip for ants and to probe for honey. The basic descriptions of these tools and the contexts in which they were found are presented. The lengths of two of the tool types were compared with the use of a t-test for independent groups. It was found that the lengths of the tools differed significantly depending upon their function. The location and habitat type of each tool site were plotted on a map. The tool types were distributed throughout the southern part of the study area, and with one exception all tool sites were found in the same type of habitat. Two tool sites with two other types of tools (honey hammer/club and ant club) were found. The tool types at Ngotto are compared with those found at other chimpanzee field sites, and the implications for diversity in chimpanzee material culture are discussed. Copyright (c) 2005 Wiley-Liss, Inc.
Precision Photometry and Astrometry from Pan-STARRS
Magnier, Eugene A.; Pan-STARRS Team
2018-01-01
The Pan-STARRS 3pi Survey has been calibrated with excellent precision for both astrometry and photometry. The Pan-STARRS Data Release 1, opened to the public on 2016 Dec 16, provides photometry in 5 well-calibrated, well-defined bandpasses (grizy) astrometrically registered to the Gaia frame. Comparisons with other surveys illustrate the high quality of the calibration and provide tests of remaining systematic errors in both Pan-STARRS and those external surveys. With photometry and astrometry of roughly 3 billion astronomical objects, the Pan-STARRS DR1 has substantial overlap with Gaia, SDSS, 2MASS and other surveys. I will discuss the astrometric tie between Pan-STARRS DR1 and Gaia and show comparisons between Pan-STARRS and other large-scale surveys.
International Nuclear Information System (INIS)
Anwar, S.I.
2010-01-01
In this paper the concept of fins has been used for heating purpose for improving efficiency of open pan jaggery making furnace. Pan is the integral part of these furnaces where boiling/concentration of sugarcane juice take place. Parallel fins were provided to the bottom of main pan and gutter pan of IISR Lucknow 2-pan furnace. Choice for type of fins was based on movement of flames and hot flue gases generated due to combustion of bagasse. Fins helped in more heat transfer to the sugarcane juice being concentrated. Considerable improvement in heat utilization efficiency (9.44%) was observed which resulted in saving of fuel and energy (31.34%).
Dicty_cDB: Contig-U05087-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 0-436E16, WORKING DRAFT SEQU... 36 8.0 3 ( CO437185 ) GDBE43 Glycyphagus domesticus cDNA library...272 ) 1095460027623 Global-Ocean-Sampling_GS-31-01-01-1... 40 1.7 2 ( EU795122 ) Uncultured Rickettsiales ba...cterium HF4000_[384]00... 36 1.8 2 ( EU016573 ) Uncultured marine microorganism HF4000_009A22 fos... 36 1.8 ... BV673557 ) S215P60960FF4.T0 Clara Pan troglodytes troglodyte... 32 2.1 2 ( AM055412 ) Polyplastron multivesiculatu...9 ) SIR-67J15JR Sisymbrium irio BAC library SIR Sisym... 50 0.050 1 ( FH536934 )
Pan-tropical monitoring of deforestation
International Nuclear Information System (INIS)
Achard, F; DeFries, R; Eva, H; Hansen, M; Mayaux, P; Stibig, H-J
2007-01-01
This paper reviews the technical capabilities for monitoring deforestation from a pan-tropical perspective in response to the United Nations Framework Convention on Climate Change (UNFCCC) process, which is studying the technical issues surrounding the ability to reduce greenhouse gas emissions from deforestation in developing countries. The successful implementation of such policies requires effective forest monitoring systems that are reproducible, provide consistent results, meet standards for mapping accuracy, and can be implemented from national to pan-tropical levels. Remotely sensed data, supported by ground observations, are crucial to such efforts. Recent developments in global to regional monitoring of forests can contribute to reducing the uncertainties in estimates of emissions from deforestation. Monitoring systems at national levels in developing countries can also benefit from pan-tropical and regional observations, mainly by identifying hot spots of change and prioritizing areas for monitoring at finer spatial scales. A pan-tropical perspective is also required to ensure consistency between different national monitoring systems. Data sources already exist to determine baseline periods in the 1990s as historical reference points. Key requirements for implementing such monitoring programs, both at pan-tropical and at national scales, are international commitment of resources to increase capacity, coordination of observations to ensure pan-tropical coverage, access to free or low-cost data, and standardized, consensus protocols for data interpretation and analysis
1843-IJBCS-Article-Bitty Anderson
African Journals Online (AJOL)
hp
Le Parc National du Banco, forêt sempervirente à l'intérieure de la capitale ... Le chimpanzé d'Afrique de l'Ouest (Pan troglodytes verus), espèce en danger selon ... d'insectivores et de chiroptères ont été inventoriées lors de notre étude.
Investigation of needleless electrospun PAN nanofiber mats
Sabantina, Lilia; Mirasol, José Rodríguez; Cordero, Tomás; Finsterbusch, Karin; Ehrmann, Andrea
2018-04-01
Polyacrylonitrile (PAN) can be spun from a nontoxic solvent (DMSO, dimethyl sulfoxide) and is nevertheless waterproof, opposite to the biopolymers which are spinnable from aqueous solutions. This makes PAN an interesting material for electrospinning nanofiber mats which can be used for diverse biotechnological or medical applications, such as filters, cell growth, wound healing or tissue engineering. On the other hand, PAN is a typical base material for producing carbon nanofibers. Nevertheless, electrospinning PAN necessitates convenient spinning parameters to create nanofibers without too many membranes or agglomerations. Thus we have studied the influence of spinning parameters on the needleless electrospinning process of PAN dissolved in DMSO and the resulting nanofiber mats.
DEFF Research Database (Denmark)
Holm, Claus
2009-01-01
Ungdommelig opførsel er moderne. I gamle dage skulle vi blive voksne. I dag skal selv gamle mænd og kvinder holde sig unge. Peter Pan-panikken er i os, og en af vores væsentligste sociale lidelser er umodenhed.......Ungdommelig opførsel er moderne. I gamle dage skulle vi blive voksne. I dag skal selv gamle mænd og kvinder holde sig unge. Peter Pan-panikken er i os, og en af vores væsentligste sociale lidelser er umodenhed....
Damage of plants due to peroxyacyl nitrates (PAN)
Energy Technology Data Exchange (ETDEWEB)
Fukuda, H.; Terakado, K.
1974-02-01
In Japan plant damages began to resemble those due to PAN about 1972. Exposure experiments with artifically synthesized PAN in an environment simulation room determined the concentration of PAN and its duration to examine the relationship between these data in the field and crop damage. Synthesized PAN created by irradiating a mixture of ethyl nitrate and oxygen with ultraviolet light gave results similar to those seen in fields. From the end of April to the end of November, damages to petunias seemingly due to PAN appeared 15 times. The symptoms differed with the variety of petunia. After 14 experiments in fields from September 20 to November 30 with a continuous determination of the environmental concentration of PAN, damages to petunia were confirmed on 6 days when the maximum PAN concentration range was 3.0-6.7 ppb. The duration of concentrations higher than 3 ppb was 2-13 hr. The most serious damage appeared on September 20 when a concentration of more than 5 ppb continued for 7 hours. No damage appeared with a long continuation (6-12 hr) of a lower concentration of PAN of 2 ppb. Inter-varietal grafting showed that the symptoms and the degree of damage due to PAN were influenced only by the physiological specificity of the aerial portion of the plant. Leaves which are most affected by PAN differed with the variety of petunia.
Concentration of uranium on TiO-PAN and NaTiO-PAN composite absorbers
International Nuclear Information System (INIS)
Motl, Alois; Sebesta, Ferdinand; John, Jan; Spendlikova, Irena; Nemec, Mojmir
2013-01-01
Inorganic ion exchangers have been extensively tested for use in separation and concentration of uranium from Surface water. Except for separation of uranium from uranium -Contaminated waste water (e.g. waste water from mining and milling of uranium, Waste from nuclear fuel reprocessing) their main area of application has been foreseen to be their use for extraction of uranium from sea water which could partially cover future needs of uranium. Another perspective area of application is pre-concentration of uranium from natural waters followed by uranium determination via various specialized techniques such as TRLFS or AMS. Possibilities of uranium extraction from sea water have been subject of several international conferences (e.g. Topical meetings on the Recovery of Uranium from Seawater in 1980's, ACS National Meetings 2012 etc.) and are critically evaluated in a review by Bitte or recently by Kim. In the Czech Republic uranium-selective inorganic ion exchangers might be applied for treatment of various wastes from uranium industry, namely underground Water, uranium milling over-balance water, or acid waste water from underground uranium leaching and also like in other countries for determination of uranium isotopic composition focusing on anthropogenic and natural 236 U content. Among the best performing inorganic ion exchangers for the above listed purposes hydrated titanium dioxide (abbreviated as TiO) and sodium titanate (abbreviated as NaTiO) can be listed. Properties of TiO and NaTiO were reviewed by Lehto. From the point of view of ion-exchange, properties of hydrated titanium oxide and sodium titanate are very similar. The main disadvantage of these ion exchangers for industrial-scale application is their insufficient mechanical stability. To improve this property, the sorption materials can be embedded into a binding matrix. Modified polyacrylonitrile (PAN) has been proposed at the Czech Technical University in Prague as a universal binding matrix for
ATLAS BigPanDA Monitoring and Its Evolution
Wenaus, Torre; The ATLAS collaboration; Korchuganova, Tatiana
2016-01-01
BigPanDA is the latest generation of the monitoring system for the Production and Distributed Analysis (PanDA) system. The BigPanDA monitor is a core component of PanDA and also serves the monitoring needs of the new ATLAS Production System Prodsys-2. BigPanDA has been developed to serve the growing computation needs of the ATLAS Experiment and the wider applications of PanDA beyond ATLAS. Through a system-wide job database, the BigPanDA monitor provides a comprehensive and coherent view of the tasks and jobs executed by the system, from high level summaries to detailed drill-down job diagnostics. The system has been in production and has remained in continuous development since mid 2014, today effectively managing more than 2 million jobs per day distributed over 150 computing centers worldwide. BigPanDA also delivers web-based analytics and system state views to groups of users including distributed computing systems operators, shifters, physicist end-users, computing managers and accounting services. Provi...
Panning artifacts in digital pathology images
Avanaki, Ali R. N.; Lanciault, Christian; Espig, Kathryn S.; Xthona, Albert; Kimpe, Tom R. L.
2017-03-01
In making a pathologic diagnosis, a pathologist uses cognitive processes: perception, attention, memory, and search (Pena and Andrade-Filho, 2009). Typically, this involves focus while panning from one region of a slide to another, using either a microscope in a traditional workflow or software program and display in a digital pathology workflow (DICOM Standard Committee, 2010). We theorize that during panning operation, the pathologist receives information important to diagnosis efficiency and/or correctness. As compared to an optical microscope, panning in a digital pathology image involves some visual artifacts due to the following: (i) the frame rate is finite; (ii) time varying visual signals are reconstructed using imperfect zero-order hold. Specifically, after pixel's digital drive is changed, it takes time for a pixel to emit the expected amount of light. Previous work suggests that 49% of navigation is conducted in low-power/overview with digital pathology (Molin et al., 2015), but the influence of display factors has not been measured. We conducted a reader study to establish a relationship between display frame rate, panel response time, and threshold panning speed (above which the artifacts become noticeable). Our results suggest visual tasks that involve tissue structure are more impacted by the simulated panning artifacts than those that only involve color (e.g., staining intensity estimation), and that the panning artifacts versus normalized panning speed has a peak behavior which is surprising and may change for a diagnostic task. This is work in progress and our final findings should be considered in designing future digital pathology systems.
Prevalence of oral lesions in pan vendor
Directory of Open Access Journals (Sweden)
Prakash Gadodia
2011-01-01
Full Text Available Background: Being a portal of entry to various smoking and smokeless tobacco products, oral cavity is prone to deleterious effects. Present study consist of epidemiological survey to elucidate oral lesions in pan vendors. Aims and objectives: To detect oral lesions in pan vendors and compare it with controls. To detect habit pattern and prevalence of OSMF and other lesions in pan vendors as compared to controls- To identify, recognize and evaluate the possible etiology for OSMF, encompassing various chewing and smoking habits. Materials and methods: Study population consist of 170 pan vendors with age ranging from 15 to 55 years and equal number of sex matched controls selected randomly. Results: Prevalence of oral lesions in pan vendors is statistically significantly higher as compared to controls. The habit of arecanut chewing in various forms was present in all cases. The habit of smoking and smokeless tobacco products was present in all cases. Conclusion: Pan vendors are at higher risk for oral lesions than controls. There is increase in relative risk with increase in duration and frequency of habit.
Archives: Pan African Medical Journal
African Journals Online (AJOL)
Items 1 - 28 of 28 ... Archives: Pan African Medical Journal. Journal Home > Archives: Pan African Medical Journal. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives. 1 - 28 of 28 Items ...
Overview of ATLAS PanDA Workload Management
Maeno, T.; De, K.; Wenaus, T.; Nilsson, P.; Stewart, G. A.; Walker, R.; Stradling, A.; Caballero, J.; Potekhin, M.; Smith, D.; ATLAS Collaboration
2011-12-01
The Production and Distributed Analysis System (PanDA) plays a key role in the ATLAS distributed computing infrastructure. All ATLAS Monte-Carlo simulation and data reprocessing jobs pass through the PanDA system. We will describe how PanDA manages job execution on the grid using dynamic resource estimation and data replication together with intelligent brokerage in order to meet the scaling and automation requirements of ATLAS distributed computing. PanDA is also the primary ATLAS system for processing user and group analysis jobs, bringing further requirements for quick, flexible adaptation to the rapidly evolving analysis use cases of the early datataking phase, in addition to the high reliability, robustness and usability needed to provide efficient and transparent utilization of the grid for analysis users. We will describe how PanDA meets ATLAS requirements, the evolution of the system in light of operational experience, how the system has performed during the first LHC data-taking phase and plans for the future.
Overview of ATLAS PanDA Workload Management
International Nuclear Information System (INIS)
Maeno, T.; De, K.; Wenaus, T.; Nilsson, P.; Stewart, G.A.; Walker, R.; Stradling, A.; Caballero, J.; Potekhin, M.; Smith, D.
2011-01-01
The Production and Distributed Analysis System (PanDA) plays a key role in the ATLAS distributed computing infrastructure. All ATLAS Monte-Carlo simulation and data reprocessing jobs pass through the PanDA system. We will describe how PanDA manages job execution on the grid using dynamic resource estimation and data replication together with intelligent brokerage in order to meet the scaling and automation requirements of ATLAS distributed computing. PanDA is also the primary ATLAS system for processing user and group analysis jobs, bringing further requirements for quick, flexible adaptation to the rapidly evolving analysis use cases of the early datataking phase, in addition to the high reliability, robustness and usability needed to provide efficient and transparent utilization of the grid for analysis users. We will describe how PanDA meets ATLAS requirements, the evolution of the system in light of operational experience, how the system has performed during the first LHC data-taking phase and plans for the future.
Student-Centered Designs of Pan-African Literature Courses
M'Baye, Babacar
2010-01-01
A student-centered teaching methodology is an essential ingredient of a successful Pan-African literary course. In this article, the author defines Pan-Africanism and how to go about designing a Pan-African literature course. The author combines reading assignments with journals, film presentations, and lectures in a productive learning…
Is Pan-Asian Economic Integration Moving Forward?: Evidence from Pan-Asian Trade Statistics
Sapkota, Jeet Bahadur; Shuto, Motoko
2016-01-01
Asia is growing economically faster than any other region in the world; this led to the shift of the center of gravity of the global economy from the West to the East. However, it is not clear whether the Asian economy is integrating regionally or globally. In the context of the growing efforts of regional or sub-regional pan-Asian integration, it is worthwhile to explore the pan-Asian trade flows regionally as well as globally. Thus, this paper examines the trend and determinants of economic...
Electrically controllable artificial PAN muscles
Salehpoor, Karim; Shahinpoor, Mohsen; Mojarrad, Mehran
1996-02-01
Artificial muscles made with polyacrylonitrile (PAN) fibers are traditionally activated in electrolytic solution by changing the pH of the solution by the addition of acids and/or bases. This usually consumes a considerable amount of weak acids or bases. Furthermore, the synthetic muscle (PAN) itself has to be impregnated with an acid or a base and must have an appropriate enclosure or provision for waste collection after actuation. This work introduces a method by which the PAN muscle may be elongated or contracted in an electric field. We believe this is the first time that this has been achieved with PAN fibers as artificial muscles. In this new development the PAN muscle is first put in close contact with one of the two platinum wires (electrodes) immersed in an aqueous solution of sodium chloride. Applying an electric voltage between the two wires changes the local acidity of the solution in the regions close to the platinum wires. This is because of the ionization of sodium chloride molecules and the accumulation of Na+ and Cl- ions at the negative and positive electrode sites, respectively. This ion accumulation, in turn, is accompanied by a sharp increase and decrease of the local acidity in regions close to either of the platinum wires, respectively. An artificial muscle, in close contact with the platinum wire, because of the change in the local acidity will contract or expand depending on the polarity of the electric field. This scheme allows the experimenter to use a fixed flexible container of an electrolytic solution whose local pH can be modulated by an imposed electric field while the produced ions are basically trapped to stay in the neighborhood of a given electrode. This method of artificial muscle activation has several advantages. First, the need to use a large quantity of acidic or alkaline solutions is eliminated. Second, the use of a compact PAN muscular system is facilitated for applications in active musculoskeletal structures. Third, the
A PanDA backend for the ganga analysis interface
International Nuclear Information System (INIS)
Vanderster, D C; Elmsheuser, J; Walker, R; Liko, D; Maeno, T; Wenaus, T; Nilsson, P
2010-01-01
Ganga provides a uniform interface for running ATLAS user analyses on a number of local, batch, and grid backends. PanDA is a pilot-based production and distributed analysis system developed and used extensively by ATLAS. This work presents the implementation and usage experiences of a PanDA backend for Ganga. Built upon reusable application libraries from GangaAtlas and PanDA, the Ganga PanDA backend allows users to run their analyses on the worldwide PanDA resources, while providing the ability for users to develop simple or complex analysis workflows in Ganga. Further, the backend allows users to submit and manage 'personal' PanDA pilots: these pilots run under the user's grid certificate and provide a secure alternative to shared pilot certificates while enabling the usage of local resource allocations.
Holtsberg, Frederick W; Shulenin, Sergey; Vu, Hong; Howell, Katie A; Patel, Sonal J; Gunn, Bronwyn; Karim, Marcus; Lai, Jonathan R; Frei, Julia C; Nyakatura, Elisabeth K; Zeitlin, Larry; Douglas, Robin; Fusco, Marnie L; Froude, Jeffrey W; Saphire, Erica Ollmann; Herbert, Andrew S; Wirchnianski, Ariel S; Lear-Rooney, Calli M; Alter, Galit; Dye, John M; Glass, Pamela J; Warfield, Kelly L; Aman, M Javad
2016-01-01
The unprecedented 2014-2015 Ebola virus disease (EVD) outbreak in West Africa has highlighted the need for effective therapeutics against filoviruses. Monoclonal antibody (MAb) cocktails have shown great potential as EVD therapeutics; however, the existing protective MAbs are virus species specific. Here we report the development of pan-ebolavirus and pan-filovirus antibodies generated by repeated immunization of mice with filovirus glycoproteins engineered to drive the B cell responses toward conserved epitopes. Multiple pan-ebolavirus antibodies were identified that react to the Ebola, Sudan, Bundibugyo, and Reston viruses. A pan-filovirus antibody that was reactive to the receptor binding regions of all filovirus glycoproteins was also identified. Significant postexposure efficacy of several MAbs, including a novel antibody cocktail, was demonstrated. For the first time, we report cross-neutralization and in vivo protection against two highly divergent filovirus species, i.e., Ebola virus and Sudan virus, with a single antibody. Competition studies indicate that this antibody targets a previously unrecognized conserved neutralizing epitope that involves the glycan cap. Mechanistic studies indicated that, besides neutralization, innate immune cell effector functions may play a role in the antiviral activity of the antibodies. Our findings further suggest critical novel epitopes that can be utilized to design effective cocktails for broad protection against multiple filovirus species. Filoviruses represent a major public health threat in Africa and an emerging global concern. Largely driven by the U.S. biodefense funding programs and reinforced by the 2014 outbreaks, current immunotherapeutics are primarily focused on a single filovirus species called Ebola virus (EBOV) (formerly Zaire Ebola virus). However, other filoviruses including Sudan, Bundibugyo, and Marburg viruses have caused human outbreaks with mortality rates as high as 90%. Thus, cross
Tooth cusp sharpness as a dietary correlate in great apes.
Berthaume, Michael A
2014-02-01
Mammalian molars have undergone heavy scrutiny to determine correlates between morphology and diet. Here, the relationship between one aspect of occlusal morphology, tooth cusp radius of curvature (RoC), and two broad dietary categories, folivory and frugivory, is analyzed in apes. The author hypothesizes that there is a relationship between tooth cusp RoC and diet, and that folivores have sharper teeth than frugivores, and further test the correlation between tooth cusp RoC and tooth cusp size. Eight measures of tooth cusp RoC (two RoCs per cusp) were taken from 53 M(2) s from four species and subspecies of frugivorous apes (Pongo pygmaeus, Pan troglodytes troglodytes, Pan troglodytes schweinfurthii, and Gorilla gorilla gorilla) and two subspecies of folivorous apes (Gorilla beringei beringei, and Gorilla beringei graueri). Phylogenetically corrected ANOVAs were run on the full dataset and several subsets of the full dataset, revealing that, when buccolingual RoCs are taken into account, tooth cusp RoCs can successfully differentiate folivores and frugivores. PCAs revealed that folivores consistently had duller teeth than frugivores. In addition, a weak, statistically significant positive correlation exists between tooth cusp size and tooth cusp RoC. The author hypothesizes differences in tooth cusp RoC are correlated with wear rates, where, per vertical unit of wear, duller cusps will have a longer length of exposed enamel ridge than sharper cusps. More data need to be gathered to determine if the correlation between tooth cusp RoC and tooth cusp size holds true when small primates are considered. Copyright © 2013 Wiley Periodicals, Inc.
Development and characterization of highly oriented PAN nanofiber
Directory of Open Access Journals (Sweden)
M. Sadrjahani
2010-12-01
Full Text Available A simple and non-conventional electrospinning technique was employed for producing highly oriented Polyacrylonitrile (PAN nanofibers. The PAN nanofibers were electrospun from 14 wt% solution of PAN in dimethylformamid (DMF at 11 kv on a rotating drum with various linear speeds from 22.5 m/min to 67.7 m/min. The influence of take up velocity was investigated on the degree of alignment, internal structure and mechanical properties of collected PAN nanofibers. Using an image processing technique, the best degree of alignment was obtained for those nanofibers collected at a take up velocity of 59.5 m/min. Moreover, Raman spectroscopy was used for measuring molecular orientation of PAN nanofibers. Similarly, a maximum chain orientation parameter of 0.25 was determined for nanofibers collected at a take up velocity of 59.5 m/min.
Migration of ATLAS PanDA to CERN
International Nuclear Information System (INIS)
Stewart, Graeme Andrew; Klimentov, Alexei; Maeno, Tadashi; Nevski, Pavel; Nowak, Marcin; De Castro Faria Salgado, Pedro Emanuel; Wenaus, Torre; Koblitz, Birger; Lamanna, Massimo
2010-01-01
The ATLAS Production and Distributed Analysis System (PanDA) is a key component of the ATLAS distributed computing infrastructure. All ATLAS production jobs, and a substantial amount of user and group analysis jobs, pass through the PanDA system, which manages their execution on the grid. PanDA also plays a key role in production task definition and the data set replication request system. PanDA has recently been migrated from Brookhaven National Laboratory (BNL) to the European Organization for Nuclear Research (CERN), a process we describe here. We discuss how the new infrastructure for PanDA, which relies heavily on services provided by CERN IT, was introduced in order to make the service as reliable as possible and to allow it to be scaled to ATLAS's increasing need for distributed computing. The migration involved changing the backend database for PanDA from MySQL to Oracle, which impacted upon the database schemas. The process by which the client code was optimised for the new database backend is discussed. We describe the procedure by which the new database infrastructure was tested and commissioned for production use. Operations during the migration had to be planned carefully to minimise disruption to ongoing ATLAS offline computing. All parts of the migration were fully tested before commissioning the new infrastructure and the gradual migration of computing resources to the new system allowed any problems of scaling to be addressed.
Multi-Column Xe/Kr Separation with AgZ-PAN and HZ-PAN
International Nuclear Information System (INIS)
Greenhalgh, Mitchell Randy; Garn, Troy Gerry; Welty, Amy Keil; Watson, Tony Leroy
2016-01-01
Previous multi-column xenon/krypton separation tests have demonstrated the capability of separating xenon from krypton in a mixed gas feed stream. The results of this initial testing with AgZ-PAN and HZ-PAN indicated that an excellent separation of xenon from krypton could be achieved. Building upon these initial results, a series of additional multi-column testing were performed in FY-16. The purpose of this testing was to scale up the sorbent beds, test a different composition of feed gas and attempt to improve the accuracy of the analysis of the individual capture columns' compositions. Two Stirling coolers were installed in series to perform this testing. The use of the coolers instead of the cryostat provided two desired improvements, 1) removal of the large dilution due to the internal volume of the cryostat adsorption chamber, and 2) ability to increase the sorbent bed size for scale-up. The AgZ-PAN sorbent, due to its xenon selectivity, was loaded in the first column to capture the xenon while allowing the krypton to flow through and be routed to a second column containing the HZ-PAN for capture and analysis. The gases captured on both columns were sampled with evacuated sample bombs and subsequently analyzed via GC-MS for both krypton and xenon. The results of these tests can be used to develop the scope of future testing and analysis using this test bed for demonstrating the capture and separation of xenon and krypton using sorbents, for demonstrating desorption and regeneration of the sorbents, and for determining compositions of the desorbed gases. They indicate a need for future desorption studies in order to better quantify co-adsorbed species and final krypton purity.
Multi-Column Xe/Kr Separation with AgZ-PAN and HZ-PAN
Energy Technology Data Exchange (ETDEWEB)
Greenhalgh, Mitchell Randy [Idaho National Lab. (INL), Idaho Falls, ID (United States); Garn, Troy Gerry [Idaho National Lab. (INL), Idaho Falls, ID (United States); Welty, Amy Keil [Idaho National Lab. (INL), Idaho Falls, ID (United States); Watson, Tony Leroy [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2016-08-01
Previous multi-column xenon/krypton separation tests have demonstrated the capability of separating xenon from krypton in a mixed gas feed stream. The results of this initial testing with AgZ-PAN and HZ-PAN indicated that an excellent separation of xenon from krypton could be achieved. Building upon these initial results, a series of additional multi-column testing were performed in FY-16. The purpose of this testing was to scale up the sorbent beds, test a different composition of feed gas and attempt to improve the accuracy of the analysis of the individual capture columns’ compositions. Two Stirling coolers were installed in series to perform this testing. The use of the coolers instead of the cryostat provided two desired improvements, 1) removal of the large dilution due to the internal volume of the cryostat adsorption chamber, and 2) ability to increase the sorbent bed size for scale-up. The AgZ-PAN sorbent, due to its xenon selectivity, was loaded in the first column to capture the xenon while allowing the krypton to flow through and be routed to a second column containing the HZ-PAN for capture and analysis. The gases captured on both columns were sampled with evacuated sample bombs and subsequently analyzed via GC-MS for both krypton and xenon. The results of these tests can be used to develop the scope of future testing and analysis using this test bed for demonstrating the capture and separation of xenon and krypton using sorbents, for demonstrating desorption and regeneration of the sorbents, and for determining compositions of the desorbed gases. They indicate a need for future desorption studies in order to better quantify co-adsorbed species and final krypton purity.
The occurrence of large branchiopod crustaceans in perennial pans ...
African Journals Online (AJOL)
Pans are isolated, shallow depressions that are endorheic in nature. Because of the natural hydrological functioning of pans, these systems are usually restricted to arid regions and complete desiccation occurs seasonally. In the eastern provinces of South Africa many pans are perennial in nature often remaining inundated ...
Directory of Open Access Journals (Sweden)
Silvia Porres Caballero
2012-09-01
Full Text Available Pan is a god peculiar in many respects. In contrast to the other gods of the Greek pantheon, he is not anthropomorphic, but he has the legs, tail and horns of a goat. These features show his age. A god like Pan can only survive in Arcadia, a region that preserves many religious archaisms. However, from 490 BC, when his cult is established in Athens, this god begins to change. In his evolution, Pan becomes increasingly assimilated the god Dionysus. The rapprochement between the two gods left his mark on the mythology, but especially in the cult of Pan. Thus, a god who was worshiped in Arcadia in sanctuaries built by men, in the rest of Greece is worshiped in wild shrines, mainly caves. Out of Arcadia, the grotto also is the place reserved for the mystery cults, including the Dionysian ones. Does not seem a coincidence
DEFF Research Database (Denmark)
Jensen, Cathrine Ulla; Panduro, Toke Emil
functional transformations, driven by an a priori and theory-based hypothesis. The plots and model fit metrics enable users to make an informed choice of how to specify the functional form the regression. We show that the PanJen ranking outperforms the Box-Tidwell transformation, especially in the presence...... of inefficiency, heteroscedasticity or endogeneity....
Sakamaki, Tetsuya
2013-10-01
Chimpanzees (Pan troglodytes) groom in gatherings in which many individuals may be connected via multiple chains of grooming and they often exchange partners with each other. They sometimes groom another while receiving grooming; that is, one animal can play two roles (i.e., groomer and groomee) simultaneously. Although this feature of chimpanzees is notable from the viewpoint of the evolution of human sociality, information on our other closest living relative, the bonobo (Pan paniscus), is still lacking. In this study, I describe grooming interactions of bonobos at Wamba in the Luo Scientific Reserve, Democratic Republic of the Congo (DR Congo), with a particular focus on the formation of grooming gatherings. Like chimpanzees, the bonobos also performed mutual grooming (two individuals grooming each other simultaneously) and polyadic grooming (three or more individuals). However, unlike chimpanzees, these sessions lasted for only a short time. Bonobos rarely groomed another while receiving grooming. Because social grooming occurred not only in trees but also in open spaces, including treefall gaps, the conditions did not necessarily limit the opportunity to make multiple chains of grooming. However, bonobos also engaged in social grooming in different ways from chimpanzees; That is, many individuals were involved simultaneously at a site, in which they separated for dyadic grooming. Some cases clearly showed that bonobos preferred a third party not to join while grooming in a dyad, suggesting that bonobos have a preference for grooming in dyads and that immature individuals formed the preference that was shared among adults while growing up. Most members of the study group ranged together during the majority of the study period. Although bonobos show a fission-fusion grouping pattern, when group members frequently encounter one another on a daily basis, they may not be motivated to form multiple grooming chains at this site, as do chimpanzees.
75 FR 47262 - Federal Consistency Appeal by Pan American Grain Co.
2010-08-05
... by Pan American Grain Co. AGENCY: National Oceanic and Atmospheric Administration (NOAA), Department..., closure of the decision record in an administrative appeal filed by Pan American Grain Co. (Pan American..., 2010, Pan American Grain Co. filed notice of an appeal with the Secretary of Commerce (Secretary...
Sakamaki, Tetsuya; Maloueki, Ulrich; Bakaa, Batuafe; Bongoli, Lingomo; Kasalevo, Phila; Terada, Saeko; Furuichi, Takeshi
2016-07-01
Findings of regional variations in the behavioral patterns of non-human primates have led to the vigorous study of animal traditions (or culture), which contribute to a biological understanding of diversity in human cultures. Although our knowledge of behavioral variations of the bonobo (Pan paniscus) is limited compared with its sister species, the chimpanzee (P. troglodytes), variations in the prey of this species have been reported across study sites. This study describes evidence of mammals consumed by bonobos in the Iyondji site, which was established in 2010. We found evidence that Iyondji bonobos consumed duikers (Cephalophus dorsalis, C. monticola) and diurnal monkeys (Cercopithecus ascanius), which is notable because only anomalures (Anomalurus spp.) are consumed by bonobos in Wamba, a long-term study site established in 1973, located in an area adjacent to Iyondji. Moreover, bonobos do not transfer between the two populations due to the river between the sites. According to our census of duikers and diurnal monkeys, Iyondji bonobos appeared to encounter diurnal monkeys more frequently than did Wamba bonobos. Although humans have apparently had a more pronounced impact on the habitats in Wamba than on those in Iyondji, it remains unclear how such environmental conditions may have contributed to the differences in the prey consumed by bonobos in different sites. Our findings suggest that additional research at various sites could reveal the nature of the variations in the behavior of bonobos.
Status and Evolution of ATLAS Workload Management System PanDA
AUTHOR|(CDS)2067365; The ATLAS collaboration
2012-01-01
The ATLAS experiment at the LHC uses a sophisticated workload management system, PanDA, to provide access for thousands of physicists to distributed computing resources of unprecedented scale. This system has proved to be robust and scalable during three years of LHC operations. We describe the design and performance of PanDA in ATLAS. The features which make PanDA successful in ATLAS could be applicable to other exabyte scale scientific projects. We describe plans to evolve PanDA towards a general workload management system for the new BigData initiative announced by the US government. Other planned future improvements to PanDA will also be described
Prospective Memory in a Language-Trained Chimpanzee ("Pan Troglodytes")
Beran, Michael J.; Perdue, Bonnie M.; Bramlett, Jessica L.; Menzel, Charles R.; Evans, Theodore A.
2012-01-01
Prospective memory involves the encoding, retention, and implementation of an intended future action. Although humans show many forms of prospective memory, less is known about the future oriented processes of nonhuman animals, or their ability to use prospective memory. In this experiment, a chimpanzee named Panzee, who had learned to associate…
Comprehension of functional support by enculturated chimpanzees Pan troglodytes
Directory of Open Access Journals (Sweden)
Anna M. YOCOM, Sarah T. BOYSEN
2011-08-01
Full Text Available Studies of causal understanding of tool relationships in captive chimpanzees have yielded disparate findings, particularly those reported by Povinelli & colleagues (2000 for tool tasks by laboratory chimpanzees. The present set of experiments tested nine enculturated chimpanzees on three versions of a support task, as described by Povinelli (2000, during which food rewards were presented in different experimental configurations. In Experiment 1, stimulus pairs included a choice between a cloth with a reward on the upper right corner or with a second reward off the cloth, adjacent to a corner, with the second pair comprised of a cloth with food on the upper right corner, and a second cloth with the reward on the substrate, partially covered. All subjects were successful with both test conditions in Experiment 1. In a second study, the experimental choices included one of two possible correct options, paired with one of three incorrect options, with the three incorrect choices all involving varying degrees of perceptual containment. All nine chimpanzees scored significantly above chance across all six conditions. In Experiment 3, four unique conditions were presented, combining one of two possible correct choices with one of two incorrect choices. Six of the subjects scored significantly above chance across the four conditions, and group performance on individual conditions was also significant. Superior performance was demonstrated by female subjects in Experiment 3, similar to sex differences in tool use previously reported for wild chimpanzees and some tool tasks in captive chimpanzees. The present results for Experiments 2 & 3 were significantly differed from those reported by Povinelli et al. (2000 for laboratory-born, peer-reared chimpanzees. One contribution towards the dramatic differences between the two study populations may be the significant rearing and housing differences of the chimpanzee groups. One explanation is that under conditions of enculturation, rich social interactions with humans and conspecifics, as well as active exploration of artifacts, materials, and other aspects of their physical environment had a significant impact on the animals’ ability to recognize the support relationships among the stimulus choices. Overall, the present findings provide strong support for the hypothesis that our chimpanzee subjects based their responses on an understanding of functional support which represented one facet of their folk physics repertoire [Current Zoology 57 (4: 429–440, 2011].
Task design influences prosociality in captive chimpanzees (Pan troglodytes.
Directory of Open Access Journals (Sweden)
Bailey R House
Full Text Available Chimpanzees confer benefits on group members, both in the wild and in captive populations. Experimental studies of how animals allocate resources can provide useful insights about the motivations underlying prosocial behavior, and understanding the relationship between task design and prosocial behavior provides an important foundation for future research exploring these animals' social preferences. A number of studies have been designed to assess chimpanzees' preferences for outcomes that benefit others (prosocial preferences, but these studies vary greatly in both the results obtained and the methods used, and in most cases employ procedures that reduce critical features of naturalistic social interactions, such as partner choice. The focus of the current study is on understanding the link between experimental methodology and prosocial behavior in captive chimpanzees, rather than on describing these animals' social motivations themselves. We introduce a task design that avoids isolating subjects and allows them to freely decide whether to participate in the experiment. We explore key elements of the methods utilized in previous experiments in an effort to evaluate two possibilities that have been offered to explain why different experimental designs produce different results: (a chimpanzees are less likely to deliver food to others when they obtain food for themselves, and (b evidence of prosociality may be obscured by more "complex" experimental apparatuses (e.g., those including more components or alternative choices. Our results suggest that the complexity of laboratory tasks may generate observed variation in prosocial behavior in laboratory experiments, and highlights the need for more naturalistic research designs while also providing one example of such a paradigm.
Conservatism and "copy-if-better" in chimpanzees (Pan troglodytes).
van Leeuwen, Edwin J C; Call, Josep
2017-05-01
Social learning is predicted to evolve in socially living animals provided the learning process is not random but biased by certain socio-ecological factors. One bias of particular interest for the emergence of (cumulative) culture is the tendency to forgo personal behaviour in favour of relatively better variants observed in others, also known as the "copy-if-better" strategy. We investigated whether chimpanzees employ copy-if-better in a simple token-exchange paradigm controlling for individual and random social learning. After being trained on one token-type, subjects were confronted with a conspecific demonstrator who either received the same food reward as the subject (control condition) or a higher value food reward than the subject (test condition) for exchanging another token-type. In general, the chimpanzees persisted in exchanging the token-type they were trained on individually, indicating a form of conservatism consistent with previous studies. However, the chimpanzees were more inclined to copy the demonstrator in the test compared to the control condition, indicating a tendency to employ a copy-if-better strategy. We discuss the validity of our results by considering alternative explanations and relate our findings to the emergence of cumulative culture.
Efficient search for a face by chimpanzees (Pan troglodytes)
Tomonaga, Masaki; Imura, Tomoko
2015-01-01
The face is quite an important stimulus category for human and nonhuman primates in their social lives. Recent advances in comparative-cognitive research clearly indicate that chimpanzees and humans process faces in a special manner; that is, using holistic or configural processing. Both species exhibit the face-inversion effect in which the inverted presentation of a face deteriorates their perception and recognition. Furthermore, recent studies have shown that humans detect human faces amon...
Efficient search for a face by chimpanzees (Pan troglodytes).
Tomonaga, Masaki; Imura, Tomoko
2015-07-16
The face is quite an important stimulus category for human and nonhuman primates in their social lives. Recent advances in comparative-cognitive research clearly indicate that chimpanzees and humans process faces in a special manner; that is, using holistic or configural processing. Both species exhibit the face-inversion effect in which the inverted presentation of a face deteriorates their perception and recognition. Furthermore, recent studies have shown that humans detect human faces among non-facial objects rapidly. We report that chimpanzees detected chimpanzee faces among non-facial objects quite efficiently. This efficient search was not limited to own-species faces. They also found human adult and baby faces--but not monkey faces--efficiently. Additional testing showed that a front-view face was more readily detected than a profile, suggesting the important role of eye-to-eye contact. Chimpanzees also detected a photograph of a banana as efficiently as a face, but a further examination clearly indicated that the banana was detected mainly due to a low-level feature (i.e., color). Efficient face detection was hampered by an inverted presentation, suggesting that configural processing of faces is a critical element of efficient face detection in both species. This conclusion was supported by a simple simulation experiment using the saliency model.
International Nuclear Information System (INIS)
Lee, H.J.; Joo, N.M.
2012-01-01
This study was conducted to develop an optimal composite recipe for pan bread with ramie powder that has high sensory approval with all age groups and to estimate the DPPH radical scavenging activity and the pan bread shelf life after gamma irradiation. The sensory evaluation results showed significant differences in flavor (p less than 0.05), appearance (p less than 0.01), color (p less than 0.01), moistness (p less than 0.01), and overall quality (p less than 0.05) based on the amount of ramie powder added. As a result, the optimum formulations by numerical and graphical methods were calculated to be as follows: ramie powder 2.76 g (0.92%) and water 184.7 mL. Optimized pan bread with ramie powder and white pan bread were irradiated with gamma-rays at doses of 0, 10, 15, and 20 kGy. The total bacterial growth increased with the longer storage time and the least amount of ramie powder added. Consequently, these results suggest that the addition of ramie powder to pan bread provides added value to the bread in terms of increased shelf life
Radioimmunodetection of human pancreatic tumor xenografts using DU-PAN II monoclonal antibody
International Nuclear Information System (INIS)
Nakamura, Kayoko; Kubo, Atsushi; Hashimoto, Shozo; Furuuchi, Takayuki; Abe, Osahiko; Takami, Hiroshi.
1988-01-01
The potential of DU-PAN II, monoclonal antibody (IgM), which was raised against the human tumor cell line, was evaluated for radioimmunodetection of human pancreatic tumors (PAN-5-JCK and EXP-58) grown in nude mice. 125 I-labeled DU-PAN II was accumulated into PAN-5-JCK producing DU-PAN II antigen with a tumor-to-blood ratio of 2.72 ± 3.00, but it did not localize in EXP-58 because of insufficient DU-PAN II. There was no significant uptake of 125 I-nonimmunized IgM in PAN-5-JCK. These facts indicated the specific tumor uptake of DU-PAN II. Excellent images of the tumor PAN-5-JCK were obtained 3 days after the injection of 125 I-DU-PAN II. Gel chromatography was also investigated with respect to the plasma taken from mice injected with antibody, or incubated with antibody in vitro. The results indicate that circulating antigen affected the tumor uptake of DU-PAN II: The more the tumor grew, the higher the amount of antigen excreted into the blood, leading to the degradation of DU-PAN II before it reached the tumor sites. Consequently, the immunoscintigram of the small tumor was remarkably clear. The catabolism and the radiolysis of the labeled IgM injected are critical points in applying immunoscintigraphy. (author)
PanViz: interactive visualization of the structure of functionally annotated pangenomes
DEFF Research Database (Denmark)
Pedersen, Thomas Lin; Nookaew, Intawat; Wayne Ussery, David
2017-01-01
with gene ontology based navigation of gene groups. Furthermore it allows for rich and complex visual querying of gene groups in the pangenome. PanViz visualizations require no external programs and are easily sharable, allowing for rapid pangenome analyses. PanViz is written entirely in Java......PanViz is a novel, interactive, visualization tool for pangenome analysis. PanViz allows visualization of changes in gene group (groups of similar genes across genomes) classification as different subsets of pangenomes are selected, as well as comparisons of individual genomes to pangenomes......Script and is available on https://github.com/thomasp85/PanViz A companion R package that facilitates the creation of PanViz visualizations from a range of data formats is released through Bioconductor and is available at https://bioconductor.org/packages/PanVizGenerator CONTACT: thomasp85@gmail...
Cognitive capacities for cooking in chimpanzees
Warneken, Felix; Rosati, Alexandra G.
2015-01-01
The transition to a cooked diet represents an important shift in human ecology and evolution. Cooking requires a set of sophisticated cognitive abilities, including causal reasoning, self-control and anticipatory planning. Do humans uniquely possess the cognitive capacities needed to cook food? We address whether one of humans' closest relatives, chimpanzees (Pan troglodytes), possess the domain-general cognitive skills needed to cook. Across nine studies, we show that chimpanzees: (i) prefer...
Czech Academy of Sciences Publication Activity Database
Pafčo, B.; Tehlárová, Z.; Jirků-Pomajbíková, K.; Todd, A.; Hasegawa, H.; Petrželková, Klára Judita; Modrý, D.
2018-01-01
Roč. 80, č. 2 (2018), č. článku e22736. ISSN 0275-2565 R&D Projects: GA ČR GA15-05180S Institutional support: RVO:68081766 Keywords : Pan-troglodytes-schweinfurthii * western lowland gorillas * colobus procolobus-rufomitratus * Ndoki national-park * great apes * nonhuman-primates * parasite prevalence * Tana river * chimpanzees * wild * Balantioides * habituation * mangabey * parasite Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 2.005, year: 2016
Thermal and radiochemical degradation of some PAN copolymers
Energy Technology Data Exchange (ETDEWEB)
Jipa, S. [INCDIE, ICPE CA, 313 Splaiul Unirii, P.O. Box 149, Bucharest 030138 (Romania); ' Valachia' University of Targoviste, 18-22 Unirii Av., Targoviste 130082 (Romania); Zaharescu, T. [' Valachia' University of Targoviste, 18-22 Unirii Av., Targoviste 130082 (Romania)], E-mail: traian_zaharescu@yahoo.com; Setnescu, R. [INCDIE, ICPE CA, 313 Splaiul Unirii, P.O. Box 149, Bucharest 030138 (Romania); ' Valachia' University of Targoviste, 18-22 Unirii Av., Targoviste 130082 (Romania); Dragan, E.S.; Dinu, M.V. [' Petru Poni' Institute of Macromolecular Chemistry, Iasi 700487 (Romania)
2008-12-01
Polyacrylonitrile (PAN) and some copolymers of acrylonitrile with divinylbenzene (AN-DVB) were investigated by the characterization of their thermal and radiation stabilities. The contribution of DVB to the thermal stability of PAN by the modification in the amount of unsaturated hydrocarbon between 6 and 20% was revealed by the evaluation of oxidation induction periods and required activation energies. The exposure of these materials to the action of {gamma}-radiation points out the higher stability of copolymers (AN-DVB) in comparison to the relative stability of PAN.
Efficient oligonucleotide probe selection for pan-genomic tiling arrays
Directory of Open Access Journals (Sweden)
Zhang Wei
2009-09-01
Full Text Available Abstract Background Array comparative genomic hybridization is a fast and cost-effective method for detecting, genotyping, and comparing the genomic sequence of unknown bacterial isolates. This method, as with all microarray applications, requires adequate coverage of probes targeting the regions of interest. An unbiased tiling of probes across the entire length of the genome is the most flexible design approach. However, such a whole-genome tiling requires that the genome sequence is known in advance. For the accurate analysis of uncharacterized bacteria, an array must query a fully representative set of sequences from the species' pan-genome. Prior microarrays have included only a single strain per array or the conserved sequences of gene families. These arrays omit potentially important genes and sequence variants from the pan-genome. Results This paper presents a new probe selection algorithm (PanArray that can tile multiple whole genomes using a minimal number of probes. Unlike arrays built on clustered gene families, PanArray uses an unbiased, probe-centric approach that does not rely on annotations, gene clustering, or multi-alignments. Instead, probes are evenly tiled across all sequences of the pan-genome at a consistent level of coverage. To minimize the required number of probes, probes conserved across multiple strains in the pan-genome are selected first, and additional probes are used only where necessary to span polymorphic regions of the genome. The viability of the algorithm is demonstrated by array designs for seven different bacterial pan-genomes and, in particular, the design of a 385,000 probe array that fully tiles the genomes of 20 different Listeria monocytogenes strains with overlapping probes at greater than twofold coverage. Conclusion PanArray is an oligonucleotide probe selection algorithm for tiling multiple genome sequences using a minimal number of probes. It is capable of fully tiling all genomes of a species on
On linearity of pan-integral and pan-integrable functions space
Czech Academy of Sciences Publication Activity Database
Ouyang, Y.; Li, J.; Mesiar, Radko
2017-01-01
Roč. 90, č. 1 (2017), s. 307-318 ISSN 0888-613X Institutional support: RVO:67985556 Keywords : linearity * monotone measure * Pan-integrable space Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 2.845, year: 2016 http://library.utia.cas.cz/separaty/2017/E/mesiar-0477549.pdf
Preparation and performance of biofouling resistant PAN/chitosan hollow fiber membranes.
Shanthana Lakshmi, D; Jaiswar, Santlal; Saxena, Mayank; Tasselli, Franco; Raval, Hiren D
2017-07-01
The preparation of polyacrylonitrile (PAN) hollow fiber (HF) membranes has been carried out by dry-jet wet spinning. PAN HF membranes were coated with chitosan biopolymers 2 wt% by dip coating and further crosslinked by chemical reagents (Tri sodium polyphosphate). PAN HF (Virgin) and PAN/chitosan coated membrane were characterized by SEM and tested for water flux. Proteins Pepsin, Albumin, and Clay of 1000 ppm concentration were tested for separation efficiency. In addition, bacterial species Escherichia coli and Bacillus subtilis were tested for fouling control efficiency and found out that PAN/chitosan membranes were quite superior to virgin PAN fibers. The adhesion of bacterial cells on the surface of the hollow fiber membranes assessed through alcian blue staining and SEM analysis. It was observed that PAN/chitosan membranes (310A and 310C) possessed best antibacterial activities (based on SEM results), qualifying them as a very promising candidates for anti-biofouling coatings.
Microstructural characterization of PAN based carbon fiber reinforced nylon 6 polymer composites
Munirathnamma, L. M.; Ningaraju, S.; Kumar, K. V. Aneesh; Ravikumar, H. B.
2018-04-01
Microstructural characterization of nylon 6/polyacrolonitrile based carbon fibers (PAN-CFs) of 10 to 40 wt% has been performed by positron lifetime technique (PLT). The positron lifetime parameters viz., o-Ps lifetime (τ3), o-Ps intensity (I3) and fractional free volume (Fv) of nylon 6/PAN-CF composites are correlated with the mechanical properties viz., Tensile strength and Young's modulus. The Fv show negative deviation with the reinforcement of 10 to 40 wt% of PAN-CF from the linear additivity relation. The negative deviation in nylon 6/PAN-CF composite suggests the induced molecular packing due to the chemical interaction between the polymeric chains of nylon 6 and PAN-CF. This is evident from Fourier Transform Infrared Spectrometry (FTIR) studies. The FTIR results suggests that observed negative deviation in PALS results of nylon 6/PAN-CF reinforced polymer composites is due to the induced chemical interaction at N-H-O sites. The improved tensile strength (TS) and Young's modulus (YM) in nylon 6/PAN-CF reinforced polymer composites is due to AS4C (surface treated and epoxy coated) PAN-CF has shown highest adhesion level due to better stress transfer between nylon 6 and PAN-CF.
International Nuclear Information System (INIS)
Mello, Luiz A. de; Monteiro Filho, Joselio S.; Belem, Lilia M.J.; Torres, Luiz F.B.
2009-01-01
The organization of a major public event involving large numbers of spectators and participants, presents important security challenges. Taking this into consideration, the Brazilian Nuclear Energy Commission (CNEN) has been requested, by the National Secretary of Public Security/ Ministry of Justice (SENASP/MJ), by the end of 2006, to participate on the security actions to be implemented in both the XV Pan American Games and III Para Pan American Games. The XV Pan American Games 2007 and the III Para Pan American Games were held in Rio de Janeiro, Brazil from 13 to 29 July 2007 and from 12 to 19 August 2007, respectively. Those events had 8700 participants between athletes, coaches and referees from 42 countries. More than 300 competition events were held at 17 different venues and were covered by 4910 professionals from TV, radio and written press. Around 2 million tickets have been sold or distributed and 18,000 volunteers participated on the organization. The participation of CNEN was concentrated on the implementation of specific nuclear and radiological security measures to be applied at those events. This was part of a multi-institutional plan for the security of the Games, coordinated by the National Secretary of Public Security of the Ministry of Justice (SENASP/MJ). The support provided by IAEA under a Cooperation Arrangement with the Brazilian authorities was a key factor for the success of the whole operation. The actions taken and the lessons identified by the Brazilian Nuclear Energy Commission related to nuclear and radiological security for the Pan American Games and for the Para Pan American Games are presented. (author)
75 FR 61698 - Federal Consistency Appeal by Pan American Grain Co.
2010-10-06
... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration Federal Consistency Appeal by Pan American Grain Co. AGENCY: National Oceanic and Atmospheric Administration (NOAA), Department... Commerce (Secretary) by Pan American Grain Co. (Pan American) has closed. No additional information, briefs...
Evaluation of water balance parameters from isotopic measurements in evaporation pans
International Nuclear Information System (INIS)
Allison, G.B.
1979-01-01
The evaluation of the parameters governing the isotopic composition of evaporating water bodies was attempted by means of evaporation pans. The instability of the meteorological conditions, however, makes it virtually impossible to evaluate the atmospheric relative humidity and its isotopic composition with pans. Pans are only suitable to obtain seasonal trends of the isotopic composition of the net evaporated water. For this, a technique based on two pans is also proposed. (author)
Williams, Frank L'Engle; Cunningham, Deborah L; Amaral, Lia Q
2015-12-01
When hominin bipedality evolved, the forearms were free to adopt nonlocomotor tasks which may have resulted in changes to the articular surfaces of the ulna and the relative lengths of the forearm bones. Similarly, sex differences in forearm proportions may be more likely to emerge in bipeds than in the great apes given the locomotor constraints in Gorilla, Pan and Pongo. To test these assumptions, ulnar articular proportions and the antebrachial index (radius length/ulna length) in Homo sapiens (n=51), Gorilla gorilla (n=88), Pan troglodytes (n=49), Pongo pygmaeus (n=36) and Australopithecus afarensis A.L. 288-1 and A.L. 438-1 are compared. Intercept-adjusted ratios are used to control for size and minimize the effects of allometry. Canonical scores axes show that the proximally broad and elongated trochlear notch with respect to size in H. sapiens and A. afarensis is largely distinct from G. gorilla, P. troglodytes and P. pygmaeus. A cluster analysis of scaled ulnar articular dimensions groups H. sapiens males with A.L. 438-1 ulna length estimates, while one A.L. 288-1 ulna length estimate groups with Pan and another clusters most closely with H. sapiens, G. gorilla and A.L. 438-1. The relatively low antebrachial index characterizing H. sapiens and non-outlier estimates of A.L. 288-1 and A.L. 438-1 differs from those of the great apes. Unique sex differences in H. sapiens suggest a link between bipedality and forearm functional morphology. Copyright © 2015 Elsevier GmbH. All rights reserved.
Using TES retrievals to investigate PAN in North American biomass burning plumes
Fischer, Emily V.; Zhu, Liye; Payne, Vivienne H.; Worden, John R.; Jiang, Zhe; Kulawik, Susan S.; Brey, Steven; Hecobian, Arsineh; Gombos, Daniel; Cady-Pereira, Karen; Flocke, Frank
2018-04-01
Peroxyacyl nitrate (PAN) is a critical atmospheric reservoir for nitrogen oxide radicals, and plays a lead role in their redistribution in the troposphere. We analyze new Tropospheric Emission Spectrometer (TES) PAN observations over North America from July 2006 to July 2009. Using aircraft observations from the Colorado Front Range, we demonstrate that TES can be sensitive to elevated PAN in the boundary layer (˜ 750 hPa) even in the presence of clouds. In situ observations have shown that wildfire emissions can rapidly produce PAN, and PAN decomposition is an important component of ozone production in smoke plumes. We identify smoke-impacted TES PAN retrievals by co-location with NOAA Hazard Mapping System (HMS) smoke plumes. Depending on the year, 15-32 % of cases where elevated PAN is identified in TES observations (retrievals with degrees of freedom (DOF) > 0.6) overlap smoke plumes during July. Of all the retrievals attempted in the July 2006 to July 2009 study period, 18 % is associated with smoke . A case study of smoke transport in July 2007 illustrates that PAN enhancements associated with HMS smoke plumes can be connected to fire complexes, providing evidence that TES is sufficiently sensitive to measure elevated PAN several days downwind of major fires. Using a subset of retrievals with TES 510 hPa carbon monoxide (CO) > 150 ppbv, and multiple estimates of background PAN, we calculate enhancement ratios for tropospheric average PAN relative to CO in smoke-impacted retrievals. Most of the TES-based enhancement ratios fall within the range calculated from in situ measurements.
Marangi, M.; Koehler, A.V.; Zanzani, S.A.; Manfredi, M.T.; Brianti, E.; Giangaspero, A.; Gasser, R.B.
2015-01-01
Background Cyclospora is a protistan parasite that causes enteritis in several species of animals including humans. The aim of this study was to investigate the presence of Cyclospora in captive non-human primates. Methods A total of 119 faecal samples from Pan troglodytes, Macaca sylvanus, Cercopithecus cephus, Erythrocebus patas, Chlorocebus aethiops and Macaca fascicularis from a wildlife animal rescue center as well as from Macaca fascicularis from an experimental primate research center ...
Lind, Johan; Lindenfors, Patrik
2010-01-01
What determines the number of cultural traits present in chimpanzee (Pan troglodytes) communities is poorly understood. In humans, theoretical models suggest that the frequency of cultural traits can be predicted by population size. In chimpanzees, however, females seem to have a particularly important role as cultural carriers. Female chimpanzees use tools more frequently than males. They also spend more time with their young, skewing the infants’ potential for social learning towards their ...
Sagittal crest formation in great apes and gibbons
Balolia, K. L.; Soligo, C.; Wood, B.
2017-01-01
The frequency of sagittal crest expression and patterns of sagittal crest growth and development have been documented in hominoids, including some extinct hominin taxa, and the more frequent expression of the sagittal crest in males has been traditionally linked with the need for larger-bodied individuals to have enough attachment area for the temporalis muscle. In the present study, we investigate sagittal cresting in a dentally mature sample of four hominoid taxa (Pan troglodytes schweinfur...
Chambers, Kenneth; Pan-STARRS Team
2018-01-01
The Pan-STARRS1 Surveys are complete and the first data release, DR1, is available from the Mikulski Archive for Space Telescopes (MAST) at the Space Telescope Science Institute. The data include a database of measured attributes of 3 billion objects, stacked images, and metadata of the 3pi Steradian Survey. The DR1 contains all stationary objects with mean and stack photometry registered on the GAIA astrometric frame. DR2 is in preparation and will be released this winter with all the individual epoch images and time domain photometry and forced photometry on the individual epoch images. The characteristics of the Pan-STARRS1 Surveys will be presented, including image quality, depth, cadence, and coverage. Measured attributes include PSF model magnitudes, aperture magnitudes, Kron Magnitudes, radial moments, Petrosian magnitudes, DeVaucoulers, Exponential, and Sersic magnitudes for extended objects. Images include total intensity, variance, and masks.An overview of the Pan-STARRS1 Surveys and data releases will be presented together with a brief description of the data collected since the end of the PS1 Science Consortium surveys, and the plans for the upcoming survey with PS1 and PS2 begining in February 2018.
PanCoreGen - Profiling, detecting, annotating protein-coding genes in microbial genomes.
Paul, Sandip; Bhardwaj, Archana; Bag, Sumit K; Sokurenko, Evgeni V; Chattopadhyay, Sujay
2015-12-01
A large amount of genomic data, especially from multiple isolates of a single species, has opened new vistas for microbial genomics analysis. Analyzing the pan-genome (i.e. the sum of genetic repertoire) of microbial species is crucial in understanding the dynamics of molecular evolution, where virulence evolution is of major interest. Here we present PanCoreGen - a standalone application for pan- and core-genomic profiling of microbial protein-coding genes. PanCoreGen overcomes key limitations of the existing pan-genomic analysis tools, and develops an integrated annotation-structure for a species-specific pan-genomic profile. It provides important new features for annotating draft genomes/contigs and detecting unidentified genes in annotated genomes. It also generates user-defined group-specific datasets within the pan-genome. Interestingly, analyzing an example-set of Salmonella genomes, we detect potential footprints of adaptive convergence of horizontally transferred genes in two human-restricted pathogenic serovars - Typhi and Paratyphi A. Overall, PanCoreGen represents a state-of-the-art tool for microbial phylogenomics and pathogenomics study. Copyright © 2015 Elsevier Inc. All rights reserved.
Towards a holistic review of Pan-Africanism: linking the idea and the movement.
Young, Kurt B
2010-01-01
This article explores two general approaches to defining Pan-Africanism. Traditional Pan-Africanism reflects definitions of Pan-Africanism that begin with the assumption that distinctions must be made between early "ideas" of group identification with Africa versus modern organizational activities. However, holistic approaches emphasize the interconnectivity of Pan-African ideas and concrete activities. This discussion explores these approaches and their implications for contemporary analyses of Pan-Africanism. The essay concludes that the holistic line is best suited for developing a new model in Pan-Africanism.
Damage symptoms of plants due to PAN exposure
Energy Technology Data Exchange (ETDEWEB)
Nouchi, I; Sawada, T; Ohashi, T; Odaira, T
1974-11-01
In order to identify the cause of plant damage which differed from that by ozone, a series of exposure experiments was carried out on Beta vulgaris, Japanese radish, French bean, luthern, tomato, and spinach in a controlled weather room by artificially synthesized PAN (peroxyacetyl nitrate). The damage appeared generally on younger leaves as a lustering and bronzing on the lower surface; there was a specific symptom in which the interveinary part of the lower surface depressed, leaving the veins in relief. At higher concentrations of PAN, damages appeared on the upper surface of leaves, however, bronzing and lustering were clearer during exposure to lower concentrations of PAN. The position of the leaves and the part of a leaf which was damaged were constant in the petunia, morning glory, and tobacco. There was a hyperbolic relationship between the concentration of PAN and the time period of appearance of the damage as was seen during sulfur dioxide and ozone exposures.
In-air PIXE for analyzing heavy metals in water boiled in pans
International Nuclear Information System (INIS)
Tomita, M.; Haruyama, Y.; Saito, M.
1993-01-01
The release rates of heavy metals from pans were measured for boiling water as well as for an acidic solution prior to an investigation on the release or sorption of trace elements due to cooking of food by boiling. The boiled samples were condensed and analyzed by means of in-air PIXE. The release of heavy metals was measured for five kinds of pans. For all pans the release rates were considerably more increased by boiling of a 5% solution of acetic acid. Furthermore it was found that by using the alumina coated aluminum pan (alumina pan) the respective release rates of Fe, Cu and Zn were all less than 50 μg per 100 cm 2 of the pan surface dipped in the solution, and that monitoring of the contents of aluminum in the boiled solution enabled the estimation of the contribution of metal elements from the pan wall. (orig.)
The Pan-STARRS1 Survey Data Release
Chambers, Kenneth C.; Pan-STARRS Team
2017-01-01
The first Pan-STARRS1 Science Mission is complete and an initial Data Release 1, or DR1, including a database of measured attributes, stacked images, and metadata of the 3PI Survey, will be available from the STScI MAST archive. This release will contain all stationary objects with mean and stack photometry registered on the GAIA astrometric frame.The characteristics of the Pan-STARRS1 Surveys will be presented, including image quality, depth, cadence, and coverage. Measured attributes include PSF model magnitudes, aperture magnitudes, Kron Magnitudes, radial moments, Petrosian magnitudes, DeVaucoulers, Exponential, and Sersic magnitudes for extended objects. Images include total intensity, variance, and masks.An overview of both DR1 and the second data release DR2, to follow in the spring of 2017, will be presented. DR2 will add all time domain data and individual warped images. We will also report on the status of the Pan-STARRS2 Observatory and ongoing science with Pan-STARRS. The science from the PS1 surveys has included results in many t fields of astronomy from Near Earth Objects to cosmology.The Pan-STARRS1 Surveys have been made possible through contributions of the Institute for Astronomy of the University of Hawaii; the Pan-STARRS Project Office; the Max-Planck Society and its participating institutes: the Max Planck Institute for Astronomy, Heidelberg and the Max Planck Institute for Extraterrestrial Physics, Garching; The Johns Hopkins University; Durham University; the University of Edinburgh; Queen's University Belfast; the Harvard-Smithsonian Center for Astrophysics, the Las Cumbres Observatory Global Telescope Network Incorporated; the National Central University of Taiwan; the Space Telescope Science Institute; the National Aeronautics and Space Administration under Grants No. NNX08AR22G, NNX12AR65G, NNX14AM74G issued through the Planetary Science Division of the NASA Science Mission Directorate; the National Science Foundation under Grant No. AST
Using TES retrievals to investigate PAN in North American biomass burning plumes
Directory of Open Access Journals (Sweden)
E. V. Fischer
2018-04-01
Full Text Available Peroxyacyl nitrate (PAN is a critical atmospheric reservoir for nitrogen oxide radicals, and plays a lead role in their redistribution in the troposphere. We analyze new Tropospheric Emission Spectrometer (TES PAN observations over North America from July 2006 to July 2009. Using aircraft observations from the Colorado Front Range, we demonstrate that TES can be sensitive to elevated PAN in the boundary layer (∼ 750 hPa even in the presence of clouds. In situ observations have shown that wildfire emissions can rapidly produce PAN, and PAN decomposition is an important component of ozone production in smoke plumes. We identify smoke-impacted TES PAN retrievals by co-location with NOAA Hazard Mapping System (HMS smoke plumes. Depending on the year, 15–32 % of cases where elevated PAN is identified in TES observations (retrievals with degrees of freedom (DOF > 0.6 overlap smoke plumes during July. Of all the retrievals attempted in the July 2006 to July 2009 study period, 18 % is associated with smoke . A case study of smoke transport in July 2007 illustrates that PAN enhancements associated with HMS smoke plumes can be connected to fire complexes, providing evidence that TES is sufficiently sensitive to measure elevated PAN several days downwind of major fires. Using a subset of retrievals with TES 510 hPa carbon monoxide (CO > 150 ppbv, and multiple estimates of background PAN, we calculate enhancement ratios for tropospheric average PAN relative to CO in smoke-impacted retrievals. Most of the TES-based enhancement ratios fall within the range calculated from in situ measurements.
Sampling bee communities using pan traps: alternative methods increase sample size
Monitoring of the status of bee populations and inventories of bee faunas require systematic sampling. Efficiency and ease of implementation has encouraged the use of pan traps to sample bees. Efforts to find an optimal standardized sampling method for pan traps have focused on pan trap color. Th...
Compilation of PRF Canyon Floor Pan Sample Analysis Results
Energy Technology Data Exchange (ETDEWEB)
Pool, Karl N. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Minette, Michael J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Wahl, Jon H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Greenwood, Lawrence R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Coffey, Deborah S. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); McNamara, Bruce K. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Bryan, Samuel A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Scheele, Randall D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Delegard, Calvin H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Sinkov, Sergey I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Soderquist, Chuck Z. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Fiskum, Sandra K. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Brown, Garrett N. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Clark, Richard A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2016-06-30
On September 28, 2015, debris collected from the PRF (236-Z) canyon floor, Pan J, was observed to exhibit chemical reaction. The material had been transferred from the floor pan to a collection tray inside the canyon the previous Friday. Work in the canyon was stopped to allow Industrial Hygiene to perform monitoring of the material reaction. Canyon floor debris that had been sealed out was sequestered at the facility, a recovery plan was developed, and drum inspections were initiated to verify no additional reactions had occurred. On October 13, in-process drums containing other Pan J material were inspected and showed some indication of chemical reaction, limited to discoloration and degradation of inner plastic bags. All Pan J material was sealed back into the canyon and returned to collection trays. Based on the high airborne levels in the canyon during physical debris removal, ETGS (Encapsulation Technology Glycerin Solution) was used as a fogging/lock-down agent. On October 15, subject matter experts confirmed a reaction had occurred between nitrates (both Plutonium Nitrate and Aluminum Nitrate Nonahydrate (ANN) are present) in the Pan J material and the ETGS fixative used to lower airborne radioactivity levels during debris removal. Management stopped the use of fogging/lock-down agents containing glycerin on bulk materials, declared a Management Concern, and initiated the Potential Inadequacy in the Safety Analysis determination process. Additional drum inspections and laboratory analysis of both reacted and unreacted material are planned. This report compiles the results of many different sample analyses conducted by the Pacific Northwest National Laboratory on samples collected from the Plutonium Reclamation Facility (PRF) floor pans by the CH2MHill’s Plateau Remediation Company (CHPRC). Revision 1 added Appendix G that reports the results of the Gas Generation Rate and methodology. The scope of analyses requested by CHPRC includes the determination of
Evolution of the ATLAS PanDA Workload Management System for Exascale Computational Science
Maeno, T; The ATLAS collaboration; Klimentov, A; Nilsson, P; Oleynik, D; Panitkin, S; Petrosyan, A; Schovancova, J; Vaniachine, A; Wenaus, T; Yu, D
2013-01-01
An important foundation underlying the impressive success of data processing and analysis in the ATLAS experiment [1] at the LHC [2] is the Production and Distributed Analysis (PanDA) workload management system [3]. PanDA was designed specifically for ATLAS and proved to be highly successful in meeting all the distributed computing needs of the experiment. However, the core design of PanDA is not experiment specific. The PanDA workload management system is capable of meeting the needs of other data intensive scientific applications. Alpha-Magnetic Spectrometer [4], an astro-particle experiment on the International Space Station, and the Compact Muon Solenoid [5], an LHC experiment, have successfully evaluated PanDA and are pursuing its adoption. In this paper, a description of the new program of work to develop a generic version of PanDA will be given, as well as the progress in extending PanDA's capabilities to support supercomputers and clouds and to leverage intelligent networking. PanDA has demonstrated a...
Evolution of the ATLAS PanDA Workload Management System for Exascale Computational Science
Maeno, T; The ATLAS collaboration; Klimentov, A; Nilsson, P; Oleynik, D; Panitkin, S; Petrosyan, A; Schovancova, J; Vaniachine, A; Wenaus, T; Yu, D
2014-01-01
An important foundation underlying the impressive success of data processing and analysis in the ATLAS experiment [1] at the LHC [2] is the Production and Distributed Analysis (PanDA) workload management system [3]. PanDA was designed specifically for ATLAS and proved to be highly successful in meeting all the distributed computing needs of the experiment. However, the core design of PanDA is not experiment specific. The PanDA workload management system is capable of meeting the needs of other data intensive scientific applications. Alpha-Magnetic Spectrometer [4], an astro-particle experiment on the International Space Station, and the Compact Muon Solenoid [5], an LHC experiment, have successfully evaluated PanDA and are pursuing its adoption. In this paper, a description of the new program of work to develop a generic version of PanDA will be given, as well as the progress in extending PanDA's capabilities to support supercomputers and clouds and to leverage intelligent networking. PanDA has demonstrated a...
Pan-sharpening via compressed superresolution reconstruction and multidictionary learning
Shi, Cheng; Liu, Fang; Li, Lingling; Jiao, Licheng; Hao, Hongxia; Shang, Ronghua; Li, Yangyang
2018-01-01
In recent compressed sensing (CS)-based pan-sharpening algorithms, pan-sharpening performance is affected by two key problems. One is that there are always errors between the high-resolution panchromatic (HRP) image and the linear weighted high-resolution multispectral (HRM) image, resulting in spatial and spectral information lost. The other is that the dictionary construction process depends on the nontruth training samples. These problems have limited applications to CS-based pan-sharpening algorithm. To solve these two problems, we propose a pan-sharpening algorithm via compressed superresolution reconstruction and multidictionary learning. Through a two-stage implementation, compressed superresolution reconstruction model reduces the error effectively between the HRP and the linear weighted HRM images. Meanwhile, the multidictionary with ridgelet and curvelet is learned for both the two stages in the superresolution reconstruction process. Since ridgelet and curvelet can better capture the structure and directional characteristics, a better reconstruction result can be obtained. Experiments are done on the QuickBird and IKONOS satellites images. The results indicate that the proposed algorithm is competitive compared with the recent CS-based pan-sharpening methods and other well-known methods.
Experience with ATLAS MySQL PanDA database service
International Nuclear Information System (INIS)
Smirnov, Y; Wlodek, T; Hover, J; Smith, J; Wenaus, T; Yu, D; De, K; Ozturk, N
2010-01-01
The PanDA distributed production and analysis system has been in production use for ATLAS data processing and analysis since late 2005 in the US, and globally throughout ATLAS since early 2008. Its core architecture is based on a set of stateless web services served by Apache and backed by a suite of MySQL databases that are the repository for all PanDA information: active and archival job queues, dataset and file catalogs, site configuration information, monitoring information, system control parameters, and so on. This database system is one of the most critical components of PanDA, and has successfully delivered the functional and scaling performance required by PanDA, currently operating at a scale of half a million jobs per week, with much growth still to come. In this paper we describe the design and implementation of the PanDA database system, its architecture of MySQL servers deployed at BNL and CERN, backup strategy and monitoring tools. The system has been developed, thoroughly tested, and brought to production to provide highly reliable, scalable, flexible and available database services for ATLAS Monte Carlo production, reconstruction and physics analysis.
Experience with ATLAS MySQL PanDA database service
Energy Technology Data Exchange (ETDEWEB)
Smirnov, Y; Wlodek, T; Hover, J; Smith, J; Wenaus, T; Yu, D [Physics Department, Brookhaven National Laboratory, Upton, NY 11973-5000 (United States); De, K; Ozturk, N [Department of Physics, University of Texas at Arlington, Arlington, TX, 76019 (United States)
2010-04-01
The PanDA distributed production and analysis system has been in production use for ATLAS data processing and analysis since late 2005 in the US, and globally throughout ATLAS since early 2008. Its core architecture is based on a set of stateless web services served by Apache and backed by a suite of MySQL databases that are the repository for all PanDA information: active and archival job queues, dataset and file catalogs, site configuration information, monitoring information, system control parameters, and so on. This database system is one of the most critical components of PanDA, and has successfully delivered the functional and scaling performance required by PanDA, currently operating at a scale of half a million jobs per week, with much growth still to come. In this paper we describe the design and implementation of the PanDA database system, its architecture of MySQL servers deployed at BNL and CERN, backup strategy and monitoring tools. The system has been developed, thoroughly tested, and brought to production to provide highly reliable, scalable, flexible and available database services for ATLAS Monte Carlo production, reconstruction and physics analysis.
PanDA Beyond ATLAS: Workload Management for Data Intensive Science
Schovancova, J; The ATLAS collaboration; Klimentov, A; Maeno, T; Nilsson, P; Oleynik, D; Panitkin, S; Petrosyan, A; Vaniachine, A; Wenaus, T; Yu, D
2013-01-01
The PanDA Production ANd Distributed Analysis system has been developed by ATLAS to meet the experiment's requirements for a data-driven workload management system for production and distributed analysis processing capable of operating at LHC data processing scale. After 7 years of impressively successful PanDA operation in ATLAS there are also other experiments which can benefit from PanDA in the Big Data challenge, with several at various stages of evaluation and adoption. The new project "Next Generation Workload Management and Analysis System for Big Data" is extending PanDA to meet the needs of other data intensive scientific applications in HEP, astro-particle and astrophysics communities, bio-informatics and other fields as a general solution to large scale workload management. PanDA can utilize dedicated or opportunistic computing resources such as grids, clouds, and High Performance Computing facilities, and is being extended to leverage next generation intelligent networks in automated workflow mana...
Microbial comparative pan-genomics using binomial mixture models
Directory of Open Access Journals (Sweden)
Ussery David W
2009-08-01
Full Text Available Abstract Background The size of the core- and pan-genome of bacterial species is a topic of increasing interest due to the growing number of sequenced prokaryote genomes, many from the same species. Attempts to estimate these quantities have been made, using regression methods or mixture models. We extend the latter approach by using statistical ideas developed for capture-recapture problems in ecology and epidemiology. Results We estimate core- and pan-genome sizes for 16 different bacterial species. The results reveal a complex dependency structure for most species, manifested as heterogeneous detection probabilities. Estimated pan-genome sizes range from small (around 2600 gene families in Buchnera aphidicola to large (around 43000 gene families in Escherichia coli. Results for Echerichia coli show that as more data become available, a larger diversity is estimated, indicating an extensive pool of rarely occurring genes in the population. Conclusion Analyzing pan-genomics data with binomial mixture models is a way to handle dependencies between genomes, which we find is always present. A bottleneck in the estimation procedure is the annotation of rarely occurring genes.
International Nuclear Information System (INIS)
2014-02-01
Terrorism remains a threat to international stability and security. Often national and international high level public events are the subject of much public interest and receive extensive coverage in the media. In this sense, it is well known that there is a real threat of a terrorist attack in important public events, such as major economic summits, high level political meetings or sporting events. In 1955 and 1975, the 2nd and 7th Pan American Games were organized by the City of Mexico. In 2011, the Pan American Games was the third event of its kind held in Guadalajara, Jalisco. At the national level, the implementation of nuclear security measures in the Pan American Games laid the foundations for a sustainable national nuclear security framework that will continue long after the event. The political decision, the existing legal basis and structure, agency coordination facilitated the incorporation of nuclear security measures. It was also a challenge to integrate all the relevant organizations, provide focus to the threat of terrorism linked to weapons of mass destruction for security games, plan resources and execute the project on time, among other details. For this reason, information and lessons learned that are reported in this document, received in Mexico during the 16th edition of the Pan American Games will be useful for the implementation of nuclear security measures in States with similar situations
Clash of pans: pan-Africanism and pan-Anglo-Saxonism and the global colour line, 1919–1945
Ledwidge, M.; Parmar, I.
2017-01-01
The article demonstrates both conceptually and empirically that pan-Anglo-Saxonist knowledge networks reconstructed and reimagined an apparently de-racialised, scientific, sober and liberal world order that outwardly abandoned, but did not eradicate the twin phenomena of racism and imperialism. Rather the new liberal (imperial) internationalists, organised in newly formed “think tanks” such as Chatham House and the Council on Foreign Relations, and through their increasingly global elite netw...
Dean, M. Christopher
2010-01-01
A chronology of dental development in Pan troglodytes is arguably the best available model with which to compare and contrast reconstructed dental chronologies of the earliest fossil hominins. Establishing a time scale for growth is a requirement for being able to make further comparative observations about timing and rate during both dento-skeletal growth and brain growth. The absolute timing of anterior tooth crown and root formation appears not to reflect the period of somatic growth. In c...
PanCoreGen – profiling, detecting, annotating protein-coding genes in microbial genomes
Bhardwaj, Archana; Bag, Sumit K; Sokurenko, Evgeni V.
2015-01-01
A large amount of genomic data, especially from multiple isolates of a single species, has opened new vistas for microbial genomics analysis. Analyzing pan-genome (i.e. the sum of genetic repertoire) of microbial species is crucial in understanding the dynamics of molecular evolution, where virulence evolution is of major interest. Here we present PanCoreGen – a standalone application for pan- and core-genomic profiling of microbial protein-coding genes. PanCoreGen overcomes key limitations of the existing pan-genomic analysis tools, and develops an integrated annotation-structure for species-specific pan-genomic profile. It provides important new features for annotating draft genomes/contigs and detecting unidentified genes in annotated genomes. It also generates user-defined group-specific datasets within the pan-genome. Interestingly, analyzing an example-set of Salmonella genomes, we detect potential footprints of adaptive convergence of horizontally transferred genes in two human-restricted pathogenic serovars – Typhi and Paratyphi A. Overall, PanCoreGen represents a state-of-the-art tool for microbial phylogenomics and pathogenomics study. PMID:26456591
The future of PanDA in ATLAS distributed computing
De, K.; Klimentov, A.; Maeno, T.; Nilsson, P.; Oleynik, D.; Panitkin, S.; Petrosyan, A.; Schovancova, J.; Vaniachine, A.; Wenaus, T.
2015-12-01
Experiments at the Large Hadron Collider (LHC) face unprecedented computing challenges. Heterogeneous resources are distributed worldwide at hundreds of sites, thousands of physicists analyse the data remotely, the volume of processed data is beyond the exabyte scale, while data processing requires more than a few billion hours of computing usage per year. The PanDA (Production and Distributed Analysis) system was developed to meet the scale and complexity of LHC distributed computing for the ATLAS experiment. In the process, the old batch job paradigm of locally managed computing in HEP was discarded in favour of a far more automated, flexible and scalable model. The success of PanDA in ATLAS is leading to widespread adoption and testing by other experiments. PanDA is the first exascale workload management system in HEP, already operating at more than a million computing jobs per day, and processing over an exabyte of data in 2013. There are many new challenges that PanDA will face in the near future, in addition to new challenges of scale, heterogeneity and increasing user base. PanDA will need to handle rapidly changing computing infrastructure, will require factorization of code for easier deployment, will need to incorporate additional information sources including network metrics in decision making, be able to control network circuits, handle dynamically sized workload processing, provide improved visualization, and face many other challenges. In this talk we will focus on the new features, planned or recently implemented, that are relevant to the next decade of distributed computing workload management using PanDA.
Evolution of the ATLAS PanDA workload management system for exascale computational science
International Nuclear Information System (INIS)
Maeno, T; Klimentov, A; Panitkin, S; Schovancova, J; Wenaus, T; Yu, D; De, K; Nilsson, P; Oleynik, D; Petrosyan, A; Vaniachine, A
2014-01-01
An important foundation underlying the impressive success of data processing and analysis in the ATLAS experiment [1] at the LHC [2] is the Production and Distributed Analysis (PanDA) workload management system [3]. PanDA was designed specifically for ATLAS and proved to be highly successful in meeting all the distributed computing needs of the experiment. However, the core design of PanDA is not experiment specific. The PanDA workload management system is capable of meeting the needs of other data intensive scientific applications. Alpha-Magnetic Spectrometer [4], an astro-particle experiment on the International Space Station, and the Compact Muon Solenoid [5], an LHC experiment, have successfully evaluated PanDA and are pursuing its adoption. In this paper, a description of the new program of work to develop a generic version of PanDA will be given, as well as the progress in extending PanDA's capabilities to support supercomputers and clouds and to leverage intelligent networking. PanDA has demonstrated at a very large scale the value of automated dynamic brokering of diverse workloads across distributed computing resources. The next generation of PanDA will allow other data-intensive sciences and a wider exascale community employing a variety of computing platforms to benefit from ATLAS' experience and proven tools.
From evaporating pans to transpiring plants (John Dalton Medal Lecture)
Roderick, Michael
2013-04-01
The name of the original inventor of irrigated agriculture is lost to antiquity. Nevertheless, one can perhaps imagine an inquisitive desert inhabitant noting the greener vegetation along a watercourse and putting two and two together. Once water was being supplied and food was being produced it would be natural to ask a further question: how much water can we put on? No doubt much experience was gained down through the ages, but again, one can readily imagine someone inverting a rain gauge, filling it with water and measuring how fast the water evaporated. The inverted rain gauge measures the demand for water by the atmosphere. We call it the evaporative demand. I do not know if this is what actually happened but it sure makes an interesting start to a talk. Evaporation pans are basically inverted rain gauges. The rain gauge and evaporation pan measure the supply and demand respectively and these instruments are the workhorses of agricultural meteorology. Rain gauges are well known. Evaporation pans are lesser known but are in widespread use and are a key part of several national standardized meteorological networks. Many more pans are used for things like scheduling irrigation on farms or estimating evaporation from lakes. Analysis of the long records now available from standardized networks has revealed an interesting phenomenon, i.e., pan evaporation has increased in some places and decreased in other but when averaged over large numbers of pans there has been a steady decline. These independent reports from, for example, the US, Russia, China, India, Thailand, are replicated in the southern hemisphere in, for example, Australia, New Zealand and South Africa. One often hears the statement that because the earth is expected to warm with increasing greenhouse gas emissions then it follows that water will evaporate faster. The pan evaporation observations show that this widely held expectation is wrong. When expectations disagree with observations, it is the
Development and characterization of polyacrylonitrile (PAN based carbon hollow fiber membrane
Directory of Open Access Journals (Sweden)
Syed Mohd Saufi
2002-11-01
Full Text Available This paper reports the development and characterization of polyacrylonitrile (PAN based carbon hollow fiber membrane. Nitrogen was used as an inert gas during pyrolysis of the PAN hollow fiber membrane into carbon membrane. PAN membranes were pyrolyzed at temperature ranging from 500oC to 800oC for 30 minutes of thermal soak time. Scanning Electron Microscope (SEM, Fourier Transform Infrared Spectroscopy (FTIR and gas sorption analysis were applied to characterize the PAN based carbon membrane. Pyrolysis temperature was found to significantly change the structure and properties of carbon membrane. FTIR results concluded that the carbon yield still could be increased by pyrolyzing PAN membranes at temperature higher than 800oC since the existence of other functional group instead of CH group. Gas adsorption analysis showed that the average pore diameter increased up to 800oC.
Scholer, Micah N.
2015-01-01
I report on the unusual behavior of an adult House Wren (Troglodytes aedon) leading recently fledged young back to the nest for two consecutive nights. The ambient temperature reached below 0°C during both nights. Despite disadvantages associated with remaining in the nest, this observation suggests that adult birds may assess trade-offs between perceived risks versus the benefits of engaging in other activities, in this case roosting communally for thermoregulation.
A Real-Time Semiautonomous Audio Panning System for Music Mixing
Directory of Open Access Journals (Sweden)
Perez_Gonzalez Enrique
2010-01-01
Full Text Available A real-time semiautonomous stereo panning system for music mixing has been implemented. The system uses spectral decomposition, constraint rules, and cross-adaptive algorithms to perform real-time placement of sources in a stereo mix. A subjective evaluation test was devised to evaluate its quality against human panning. It was shown that the automatic panning technique performed better than a nonexpert and showed no significant statistical difference to the performance of a professional mixing engineer.
The ATLAS PanDA Monitoring System and its Evolution
Klimentov, A.; Nevski, P.; Potekhin, M.; Wenaus, T.
2011-12-01
The PanDA (Production and Distributed Analysis) Workload Management System is used for ATLAS distributed production and analysis worldwide. The needs of ATLAS global computing imposed challenging requirements on the design of PanDA in areas such as scalability, robustness, automation, diagnostics, and usability for both production shifters and analysis users. Through a system-wide job database, the PanDA monitor provides a comprehensive and coherent view of the system and job execution, from high level summaries to detailed drill-down job diagnostics. It is (like the rest of PanDA) an Apache-based Python application backed by Oracle. The presentation layer is HTML code generated on the fly in the Python application which is also responsible for managing database queries. However, this approach is lacking in user interface flexibility, simplicity of communication with external systems, and ease of maintenance. A decision was therefore made to migrate the PanDA monitor server to Django Web Application Framework and apply JSON/AJAX technology in the browser front end. This allows us to greatly reduce the amount of application code, separate data preparation from presentation, leverage open source for tools such as authentication and authorization mechanisms, and provide a richer and more dynamic user experience. We describe our approach, design and initial experience with the migration process.
The ATLAS PanDA Monitoring System and its Evolution
International Nuclear Information System (INIS)
Klimentov, A; Nevski, P; Wenaus, T; Potekhin, M
2011-01-01
The PanDA (Production and Distributed Analysis) Workload Management System is used for ATLAS distributed production and analysis worldwide. The needs of ATLAS global computing imposed challenging requirements on the design of PanDA in areas such as scalability, robustness, automation, diagnostics, and usability for both production shifters and analysis users. Through a system-wide job database, the PanDA monitor provides a comprehensive and coherent view of the system and job execution, from high level summaries to detailed drill-down job diagnostics. It is (like the rest of PanDA) an Apache-based Python application backed by Oracle. The presentation layer is HTML code generated on the fly in the Python application which is also responsible for managing database queries. However, this approach is lacking in user interface flexibility, simplicity of communication with external systems, and ease of maintenance. A decision was therefore made to migrate the PanDA monitor server to Django Web Application Framework and apply JSON/AJAX technology in the browser front end. This allows us to greatly reduce the amount of application code, separate data preparation from presentation, leverage open source for tools such as authentication and authorization mechanisms, and provide a richer and more dynamic user experience. We describe our approach, design and initial experience with the migration process.
The ATLAS PanDA Monitoring System and its Evolution
Klimentov, A; The ATLAS collaboration; Potekhin, M; Wenaus, T
2011-01-01
The PanDA (Production and Distributed Analysis) Workload Management System is used for ATLAS distributed production and analysis worldwide. The needs of ATLAS global computing imposed challenging requirements on PanDA design in areas such as scalability, robustness, automation, diagnostics, and usability for both production shifters and analysis users. Important to meeting these and other requirements is a comprehensive monitoring system. Through a system-wide job database, the PanDA monitor provides a comprehensive and coherent view of the system and job execution, from high level summaries to detailed drill-down job diagnostics. It is (like the rest of PanDA) an Apache-based Python application backed by Oracle. The presentation layer is HTML code generated on the fly in the Python application which is also responsible for managing database queries. However, this approach is lacking in user interface flexibility, simplicity of communication with external systems, and ease of maintenance. We decided to migrat...
The ATLAS PanDA Monitoring System and its Evolution
Klimentov, A; The ATLAS collaboration; Potekhin, M; Wenaus, T
2010-01-01
The PanDA (Production and Distributed Analysis) Workload Management System is used for ATLAS distributed production and analysis worldwide. The needs of ATLAS global computing imposed challenging requirements on PanDA design in areas such as scalability, robustness, automation, diagnostics, and usability for both production shifters and analysis users. Important to meeting these and other requirements is a comprehensive monitoring system. Through a system-wide job database, the PanDA monitor provides a comprehensive and coherent view of the system and job execution, from high level summaries to detailed drill-down job diagnostics. It is (like the rest of PanDA) an Apache-based Python application backed by Oracle. The presentation layer is HTML code generated on the fly in the Python application which is also responsible for managing database queries. However, this approach is lacking in user interface flexibility, simplicity of communication with external systems, and ease of maintenance. We decided to migrat...
The Future of PanDA in ATLAS Distributed Computing
De, Kaushik; The ATLAS collaboration; Maeno, Tadashi; Nilsson, Paul; Oleynik, Danila; Panitkin, Sergey; Petrosyan, Artem; Schovancova, Jaroslava; Vaniachine, Alexandre; Wenaus, Torre
2015-01-01
Experiments at the Large Hadron Collider (LHC) face unprecedented computing challenges. Heterogeneous resources are distributed worldwide at hundreds of sites, thousands of physicists analyze the data remotely, the volume of processed data is beyond the exabyte scale, while data processing requires more than a few billion hours of computing usage per year. The PanDA (Production and Distributed Analysis) system was developed to meet the scale and complexity of LHC distributed computing for the ATLAS experiment. In the process, the old batch job paradigm of locally managed computing in HEP was discarded in favor of a far more automated, flexible and scalable model. The success of PanDA in ATLAS is leading to widespread adoption and testing by other experiments. PanDA is the first exascale workload management system in HEP, already operating at more than a million computing jobs per day, and processing over an exabyte of data in 2013. There are many new challenges that PanDA will face in the near future, in addi...
Effectiveness of KNIFC-PAN Resin in Absorbing Radiocesium in Seawater
International Nuclear Information System (INIS)
Nurrul Assyikeen Mohd Jaffary; Abdul Kadir Ishak; Zal Uyun Wan Mahmood; Wo, Y.M.; Norfaizal Mohamed; Mohd Tarmizi Ishak
2016-01-01
The effectiveness of KNiFC-PAN absorber, potassium-nickel hexacyanoferrate (II) (KNiFC) bound into modified polyacrylonitrile (PAN) have been tested for capability in absorbing radiocesium in seawater samples. The efficiency of the KNiFC-PAN were measured by the different activity of the radiocesium measured using Hyper Pure Germanium Detector (HPGe) in initial spiked seawater and eluent seawater after passed through 5 ml of KNiFC absorber. Study showed 87 % effectiveness of the KNiFC-PAN in absorbing radiocesium. Further study conducted to illustrate relation between spiked seawater and activity measured for 5 ml of KniFC passed through spiked seawater in packed column. This study suggested this relative 15L cubitainer method can be used to monitor the radiocesium in emergency situation for the fast and reliable result. (author)
El Abasto de Pan en el Madrid del Siglo XVII
Directory of Open Access Journals (Sweden)
José Ignacio ANDRÉS UCENDO
2012-12-01
Full Text Available El mercado del pan era el más importante de los mercados de abastos, pero también el que contaba con el más complejo sistema de intervención. Los objetivos de la política de abastos eran asegurar un suministro continuo a precios estables y moderados.Los instrumentos incluían la regulación de los precios del grano y el pan, la provisión directa a través del pósito municipal y, en el caso de la corte, el pan de registro. En este trabajo examinamos la política de tasas, las disposiciones del gobierno y el comportamiento de los precios del pan en Madrid y del trigo en los mercados de origen.
Preparation of Ag/HBP/PAN Nanofiber Web and Its Antimicrobial and Filtration Property
Directory of Open Access Journals (Sweden)
Li-Rong Yao
2016-01-01
Full Text Available To widen the application of nanofibers web in the field of medical health materials, a new Ag/amino-terminated hyperbranched polymer (HBP/polyacrylonitrile (PAN nanofiber web with excellent antimicrobial activity and filtration property was produced with Ag/HBP dispersion solution and PAN nanofiber. Ag/HBP dispersion solution was prepared with HBP as reducer and stabilizer, and Ag/HBP/PAN nanofiber was prepared by modifying electrospun PAN nanofiber with Ag/HBP aqueous solution. The characterization results showed that spherical Ag nanoparticles were prepared and they had a narrow distribution in HBP aqueous solution. The results of Ag/HBP/PAN nanofiber characterized with SEM and EDS showed that the content of silver nanoparticles on the surface of PAN nanofiber was on the increase when the treating temperature rose. The bacterial reduction rates of HBP-treated PAN nanofiber against S. aureus and E. coli were about 89%, while those of the Ag/HBP/PAN nanofiber against S. aureus and E. coli were 99.9% and 99.96%, respectively, due to the cooperative effects from the amino groups in HBP and Ag nanoparticles. Moreover, the small pores and high porosity in Ag/HBP/PAN nanofiber web resulted in high filtration efficiency (99.9% for removing smaller particles (0.1 μm~0.7 μm, which was much higher than that of the gauze mask.
Source analysis of peroxyacetyl nitrate (PAN) in Guangzhou, China: a yearlong observation study
Wang, B. G.; Zhu, D.; Zou, Y.; Wang, H.; Zhou, L.; Ouyang, X.; Shao, H. F.; Deng, X. J.
2015-06-01
In recent years, photochemical smog has been a major cause of air pollution in the metropolitan area of Guangzhou, China, with a continuing increase in the concentrations of photochemical pollutants. The concentration of peroxyacetyl nitrate (PAN) has often been found to reach very high levels, posing a potential threat to the public health. To better understand the changes in PAN concentration and its sources, a study was carried from January to December of 2012 at the Guangzhou Panyu Atmospheric Composition Station (GPACS) to measure the atmospheric concentrations of PAN as well as those of ozone (O3), nitrogen oxides (NOx), and non-methane hydrocarbon (NMHC). These data were analyzed to investigate the quantitative relationships between PAN and its precursors. In the study period, the hourly concentrations of PAN varied from below instrument detection limit to 12.0 ppbv. The yearly mean concentration of PAN was 0.84 ppbv, with the daily mean concentration exceeding 5 ppbv in 32 of the total observation days. Calculations indicate that among the measured NMHC species, alkenes accounted for 53 % of the total NMHC contribution to the PAN production, with aromatics and alkanes accounting for about 11 and 7 % of the total, respectively. During the period of our observation only a modest correlation was found between the concentrations of PAN and O3 for daytime hours, and observed PAN concentrations were relatively high even though the observed NMHCs/NOx ratio was low. This suggests regional air mass transport of pollutants had a major impact on the PAN concentrations in Guangzhou area.
Intranasal Oxytocin Failed to Affect Chimpanzee (Pan troglodytes) Social Behavior
Calcutt, Sarah E.; Burke, Kimberly; de Waal, Frans B. M.
2017-01-01
Oxytocin has been suggested as a treatment to promote positive social interactions in people with Autism Spectrum Disorders (ASD). However, it is difficult to test this effect outside of the laboratory in realistic social situations. One way to resolve this issue is to study behavioral changes in closely related species with complex social relationships, such as chimpanzees. Here, we use captive, socially housed chimpanzees to evaluate the effects of oxytocin in a socially complex environment. After administering intranasal oxytocin or a placebo to an individual chimpanzee (total n = 8), she was returned to her social group. An experimenter blind to the condition measured the subject's social behavior. We failed to find a behavioral difference between conditions. As one of the goals for oxytocin administration as a treatment for ASD is increasing prosocial behaviors during ‘real world’ encounters, it is problematic that we failed to detect behavioral changes in our closest living relatives. However, our null findings may be related to methodological challenges such as determining an effective dose of oxytocin for chimpanzees and how long oxytocin takes to cross the blood-brain barrier. Thus, more research on intranasal oxytocin dosing and uptake are needed to continue exploring whether oxytocin changes social behavior in naturalistic settings and as a treatment for ASD. PMID:28845444
Neocortical synaptophysin asymmetry and behavioral lateralization in chimpanzees (Pan troglodytes)
DEFF Research Database (Denmark)
Sherwood, Chet C; Duka, Tetyana; Stimpson, Cheryl D
2010-01-01
Although behavioral lateralization is known to correlate with certain aspects of brain asymmetry in primates, there are limited data concerning hemispheric biases in the microstructure of the neocortex. In the present study, we investigated whether there is asymmetry in synaptophysin-immunoreacti......Although behavioral lateralization is known to correlate with certain aspects of brain asymmetry in primates, there are limited data concerning hemispheric biases in the microstructure of the neocortex. In the present study, we investigated whether there is asymmetry in synaptophysin...... density. In contrast, puncta densities were symmetrical in right-handed chimpanzees. These findings support the conclusion that synapse asymmetry is modulated by lateralization of skilled motor behavior in chimpanzees....
Untrained chimpanzees (Pan troglodytes schweinfurthii fail to imitate novel actions.
Directory of Open Access Journals (Sweden)
Claudio Tennie
Full Text Available Social learning research in apes has focused on social learning in the technical (problem solving domain - an approach that confounds action and physical information. Successful subjects in such studies may have been able to perform target actions not as a result of imitation learning but because they had learnt some technical aspect, for example, copying the movements of an apparatus (i.e., different forms of emulation learning.Here we present data on action copying by non-enculturated and untrained chimpanzees when physical information is removed from demonstrations. To date, only one such study (on gesture copying in a begging context has been conducted--with negative results. Here we have improved this methodology and have also added non-begging test situations (a possible confound of the earlier study. Both familiar and novel actions were used as targets. Prior to testing, a trained conspecific demonstrator was rewarded for performing target actions in view of observers. All but one of the tested chimpanzees already failed to copy familiar actions. When retested with a novel target action, also the previously successful subject failed to copy--and he did so across several contexts.Chimpanzees do not seem to copy novel actions, and only some ever copy familiar ones. Due to our having tested only non-enculturated and untrained chimpanzees, the performance of our test subjects speak more than most other studies of the general (dis-ability of chimpanzees to copy actions, and especially novel actions.
Untrained Chimpanzees (Pan troglodytes schweinfurthii) Fail to Imitate Novel Actions
Tennie, Claudio; Call, Josep; Tomasello, Michael
2012-01-01
Background Social learning research in apes has focused on social learning in the technical (problem solving) domain - an approach that confounds action and physical information. Successful subjects in such studies may have been able to perform target actions not as a result of imitation learning but because they had learnt some technical aspect, for example, copying the movements of an apparatus (i.e., different forms of emulation learning). Methods Here we present data on action copying by non-enculturated and untrained chimpanzees when physical information is removed from demonstrations. To date, only one such study (on gesture copying in a begging context) has been conducted – with negative results. Here we have improved this methodology and have also added non-begging test situations (a possible confound of the earlier study). Both familiar and novel actions were used as targets. Prior to testing, a trained conspecific demonstrator was rewarded for performing target actions in view of observers. All but one of the tested chimpanzees already failed to copy familiar actions. When retested with a novel target action, also the previously successful subject failed to copy – and he did so across several contexts. Conclusion Chimpanzees do not seem to copy novel actions, and only some ever copy familiar ones. Due to our having tested only non-enculturated and untrained chimpanzees, the performance of our test subjects speak more than most other studies of the general (dis-)ability of chimpanzees to copy actions, and especially novel actions. PMID:22905102
Genetic influences on receptive joint attention in chimpanzees (Pan troglodytes)
DEFF Research Database (Denmark)
Hopkins, William D; Keebaugh, Alaine C; Reamer, Lisa A
2014-01-01
Despite their genetic similarity to humans, our understanding of the role of genes on cognitive traits in chimpanzees remains virtually unexplored. Here, we examined the relationship between genetic variation in the arginine vasopressin V1a receptor gene (AVPR1A) and social cognition in chimpanzees...... cognition task was significantly heritable. Furthermore, males with one DupB(+) allele performed significantly better and were more responsive to socio-communicative cues than males homozygous for the DupB- deletion. Performance on a non-social cognition task was not associated with the AVPR1A genotype....... The collective findings show that AVPR1A polymorphisms are associated with individual differences in performance on a receptive joint attention task in chimpanzees....
Distal Communication by Chimpanzees (Pan troglodytes): Evidence for Common Ground?
Leavens, David A; Reamer, Lisa A; Mareno, Mary Catherine; Russell, Jamie L; Wilson, Daniel; Schapiro, Steven J; Hopkins, William D
2015-01-01
van der Goot et al. (2014) proposed that distal, deictic communication indexed the appreciation of the psychological state of a common ground between a signaler and a receiver. In their study, great apes did not signal distally, which they construed as evidence for the human uniqueness of a sense of common ground. This study exposed 166 chimpanzees to food and an experimenter, at an angular displacement, to ask, "Do chimpanzees display distal communication?" Apes were categorized as (a) proximal or (b) distal signalers on each of four trials. The number of chimpanzees who communicated proximally did not statistically differ from the number who signaled distally. Therefore, contrary to the claim by van der Goot et al., apes do communicate distally. © 2015 The Authors. Child Development © 2015 Society for Research in Child Development, Inc.
The ATLAS PanDA Pilot in Operation
International Nuclear Information System (INIS)
Nilsson, P; De, K; Stradling, A; Caballero, J; Maeno, T; Wenaus, T
2011-01-01
The Production and Distributed Analysis system (PanDA) was designed to meet ATLAS requirements for a data-driven workload management system capable of operating at LHC data processing scale. Submitted jobs are executed on worker nodes by pilot jobs sent to the grid sites by pilot factories. This paper provides an overview of the PanDA pilot system and presents major features added in light of recent operational experience, including multi-job processing, advanced job recovery for jobs with output storage failures, gLExec based identity switching from the generic pilot to the actual user, and other security measures. The PanDA system serves all ATLAS distributed processing and is the primary system for distributed analysis; it is currently used at over 100 sites worldwide. We analyze the performance of the pilot system in processing real LHC data on the OSG, EGI and Nordugrid infrastructures used by ATLAS, and describe plans for its evolution.
Stable isotope evidence of meat eating and hunting specialization in adult male chimpanzees
Fahy, Geraldine E.; Richards, Michael; Riedel, Julia; Hublin, Jean-Jacques; Boesch, Christophe
2013-01-01
Observations of hunting and meat eating in our closest living relatives, chimpanzees (Pan troglodytes), suggest that among primates, regular inclusion of meat in the diet is not a characteristic unique to Homo. Wild chimpanzees are known to consume vertebrate meat, but its actual dietary contribution is, depending on the study population, often either unknown or minimal. Constraints on continual direct observation throughout the entire hunting season mean that behavioral observations are limited in their ability to accurately quantify meat consumption. Here we present direct stable isotope evidence supporting behavioral observations of frequent meat eating among wild adult male chimpanzees (Pan troglodytes verus) in Taï National Park, Côte d’Ivoire. Meat eating among some of the male chimpanzees is significant enough to result in a marked isotope signal detectable on a short-term basis in their hair keratin and long-term in their bone collagen. Although both adult males and females and juveniles derive their dietary protein largely from daily fruit and seasonal nut consumption, our data indicate that some adult males also derive a large amount of dietary protein from hunted meat. Our results reinforce behavioral observations of male-dominated hunting and meat eating in adult Taï chimpanzees, suggesting that sex differences in food acquisition and consumption may have persisted throughout hominin evolution, rather than being a recent development in the human lineage. PMID:23530185
Directory of Open Access Journals (Sweden)
Dora Cecilia Ramírez
1989-01-01
Full Text Available Comenzar escribiendo que Pan fue una revista singular sería caer en un lugar común. Lo más fácil sería decir que Pan fue o es una caja de sorpresas. Corre 1935. Colombia es un país rural; cobija una sociedad que se resiste, a pesar de los discursos progresistas, a ese proceso de transformación que ya anuncia el comercio cafetero y las primeras huelgas. Es la época de auge de los ferrocarriles nacionales, cuando se toma Cafiaspirina y Griperol, se viaja a Nueva York vía La Habana en lujosos trasatlánticos y, por supuesto, no existe la televisión. La mujer está en la casa en "lo suyo" el hombre por fuera también en "lo suyo", "las ventanas de acero se imponen en las construcciones modernas" y la soledad del ser es la misma de hoy. Se respira una gran mediocridad nacional y los escritores adoran la retórica. Entonces aparece Pan, con su formato de 15 por 23 centímetros y sus ochenta y cuatro páginas.
PD2P : PanDA Dynamic Data Placement for ATLAS
Maeno, T; De, K; Panitkin, S
2012-01-01
The PanDA (Production and Distributed Analysis) system plays a key role in the ATLAS distributed computing infrastructure. PanDA is the ATLAS workload management system for processing all Monte-Carlo (MC) simulation and data reprocessing jobs in addition to user and group analysis jobs. The PanDA Dynamic Data Placement (PD2P) system has been developed to cope with difficulties of data placement for ATLAS. We will describe the design of the new system, its performance during the past year of d...
Kinematic measurement from panned cinematography.
Gervais, P; Bedingfield, E W; Wronko, C; Kollias, I; Marchiori, G; Kuntz, J; Way, N; Kuiper, D
1989-06-01
Traditional 2-D cinematography has used a stationary camera with its optical axis perpendicular to the plane of motion. This method has constrained the size of the object plane or has introduced potential errors from a small subject image size with large object field widths. The purpose of this study was to assess a panning technique that could overcome the inherent limitations of small object field widths, small object image sizes and limited movement samples. The proposed technique used a series of reference targets in the object field that provided the necessary scales and origin translations. A 102 m object field was panned. Comparisons between criterion distances and film measured distances for field widths of 46 m and 22 m resulted in absolute mean differences that were comparable to that of the traditional method.
RPAN: rice pan-genome browser for ∼3000 rice genomes.
Sun, Chen; Hu, Zhiqiang; Zheng, Tianqing; Lu, Kuangchen; Zhao, Yue; Wang, Wensheng; Shi, Jianxin; Wang, Chunchao; Lu, Jinyuan; Zhang, Dabing; Li, Zhikang; Wei, Chaochun
2017-01-25
A pan-genome is the union of the gene sets of all the individuals of a clade or a species and it provides a new dimension of genome complexity with the presence/absence variations (PAVs) of genes among these genomes. With the progress of sequencing technologies, pan-genome study is becoming affordable for eukaryotes with large-sized genomes. The Asian cultivated rice, Oryza sativa L., is one of the major food sources for the world and a model organism in plant biology. Recently, the 3000 Rice Genome Project (3K RGP) sequenced more than 3000 rice genomes with a mean sequencing depth of 14.3×, which provided a tremendous resource for rice research. In this paper, we present a genome browser, Rice Pan-genome Browser (RPAN), as a tool to search and visualize the rice pan-genome derived from 3K RGP. RPAN contains a database of the basic information of 3010 rice accessions, including genomic sequences, gene annotations, PAV information and gene expression data of the rice pan-genome. At least 12 000 novel genes absent in the reference genome were included. RPAN also provides multiple search and visualization functions. RPAN can be a rich resource for rice biology and rice breeding. It is available at http://cgm.sjtu.edu.cn/3kricedb/ or http://www.rmbreeding.cn/pan3k. © The Author(s) 2016. Published by Oxford University Press on behalf of Nucleic Acids Research.
Disordered eating and food restrictions in children with PANDAS/PANS.
Toufexis, Megan D; Hommer, Rebecca; Gerardi, Diana M; Grant, Paul; Rothschild, Leah; D'Souza, Precilla; Williams, Kyle; Leckman, James; Swedo, Susan E; Murphy, Tanya K
2015-02-01
Sudden onset clinically significant eating restrictions are a defining feature of the clinical presentation of some of the cases of pediatric acute-onset neuropsychiatric syndrome (PANS). Restrictions in food intake are typically fueled by contamination fears; fears of choking, vomiting, or swallowing; and/or sensory issues, such as texture, taste, or olfactory concerns. However, body image distortions may also be present. We investigate the clinical presentation of PANS disordered eating and compare it with that of other eating disorders. We describe 29 patients who met diagnostic criteria for PANS. Most also exhibited evidence that the symptoms might be sequelae of infections with Group A streptococcal bacteria (the pediatric autoimmune neuropsychiatric disorder associated with streptococcal infections [PANDAS] subgroup of PANS). The clinical presentations are remarkable for a male predominance (2:1 M:F), young age of the affected children (mean=9 years; range 5-12 years), acuity of symptom onset, and comorbid neuropsychiatric symptoms. The food refusal associated with PANS is compared with symptoms listed for the new Diagnostic and Statistical Manual of Mental Disorders, 5th ed. (DSM-V) diagnosis of avoidant/restrictive food intake disorder (ARFID). Treatment implications are discussed, as well as directions for further research.
Pan Drug-Resistant Environmental Isolate of Acinetobacter baumannii from Croatia.
Goic-Barisic, Ivana; Seruga Music, Martina; Kovacic, Ana; Tonkic, Marija; Hrenovic, Jasna
2017-06-01
Acinetobacter baumannii is an emerging nosocomial pathogen with also emerging resistance to different antibiotics. Multidrug and pan drug-resistant clinical isolates were reported worldwide. Here we report the first evidence of pan drug-resistant environmental isolate of A. baumannii. The isolate was recovered from the effluent of secondary treated municipal wastewater of the City of Zagreb, Croatia. The isolate was resistant to penicillins/β-lactamase inhibitors, carbapenems, fluoroquinolones, aminoglycosides, folate pathway inhibitors, and polymyxins, except intermediately susceptible to minocycline and tigecycline. Intrinsic chromosomally located bla OXA-51-like gene and acquired plasmid-located bla OXA-23-like gene were related to clinical isolates. Pan drug-resistant A. baumannii can occur in natural environments outside of the hospital. Secondary treated municipal wastewater represents a potential epidemiological reservoir of pan drug-resistant A. baumannii and carbapenem resistance gene.
The development and evolution of Etosha Pan, Namibia
Hipondoka, Martin H.T.
2005-01-01
This study explores and examines the geomorphology of a large endorheic basin, approximately twice the size of Luxemburg, situated in the Etosha National Park, Namibia. The main focus is directed on how and when this depression, known as Etosha Pan, came into being. Geomorphological investigation was complemented and guided primarily by the application and interpretation of satellite-derived information. Etosha Pan has attracted scientific investigations for nearly a century. Unfortunately, t...
Optimizing new components of PanDA for ATLAS production on HPC resources
Maeno, Tadashi; The ATLAS collaboration
2017-01-01
The Production and Distributed Analysis system (PanDA) has been used for workload management in the ATLAS Experiment for over a decade. It uses pilots to retrieve jobs from the PanDA server and execute them on worker nodes. While PanDA has been mostly used on Worldwide LHC Computing Grid (WLCG) resources for production operations, R&D work has been ongoing on cloud and HPC resources for many years. These efforts have led to the significant usage of large scale HPC resources in the past couple of years. In this talk we will describe the changes to the pilot which enabled the use of HPC sites by PanDA, specifically the Titan supercomputer at Oakridge National Laboratory. Furthermore, it was decided in 2016 to start a fresh redesign of the Pilot with a more modern approach to better serve present and future needs from ATLAS and other collaborations that are interested in using the PanDA System. Another new project for development of a resource oriented service, PanDA Harvester, was also launched in 2016. The...
A spatial neural fuzzy network for estimating pan evaporation at ungauged sites
Directory of Open Access Journals (Sweden)
C.-H. Chung
2012-01-01
Full Text Available Evaporation is an essential reference to the management of water resources. In this study, a hybrid model that integrates a spatial neural fuzzy network with the kringing method is developed to estimate pan evaporation at ungauged sites. The adaptive network-based fuzzy inference system (ANFIS can extract the nonlinear relationship of observations, while kriging is an excellent geostatistical interpolator. Three-year daily data collected from nineteen meteorological stations covering the whole of Taiwan are used to train and test the constructed model. The pan evaporation (Epan at ungauged sites can be obtained through summing up the outputs of the spatially weighted ANFIS and the residuals adjusted by kriging. Results indicate that the proposed AK model (hybriding ANFIS and kriging can effectively improve the accuracy of Epan estimation as compared with that of empirical formula. This hybrid model demonstrates its reliability in estimating the spatial distribution of Epan and consequently provides precise Epan estimation by taking geographical features into consideration.
International Nuclear Information System (INIS)
Murr, L.E.; Esquivel, E.V.; Lawrie, S.C.; Lopez, M.I.; Lair, S.L.; Soto, K.F.; Gaytan, S.M.; Bujanda, D.; Kerns, R.G.; Guerrero, P.A.; Flores, J.A.
2006-01-01
We report herein the first development and fabrication of a 6061 aluminum alloy pan and compare its tuning and acoustic spectra for selected notes with a standard low-carbon steel Caribbean pan fabricated from a 210-L barrel. The experimental aluminum alloy pan was completely manufactured by welding a 1.68-mm-thick head sheet to a 9-mm 2 aluminum alloy hoop, sinking the head by pneumatic hammering and welding a 1.15-mm-thick aluminum alloy side or skirt to the hoop. This experimental pan was 0.66 m in diameter, in contrast to the 210-L steel barrel standard, which had a diameter of 0.57 m. Chromatic tones were observed for most rim notes on the aluminum alloy pan, but the highest octave range notes at the pan bottom were not tuned. Microstructural characterization by light optical metallography and transmission electron microscopy illustrated the necessity for high dislocation densities and associated hardness in order to stabilize the notes and to assure their chromatic tuning
Mutagenicity of pan residues and gravy from fried meat.
Overvik, E; Nilsson, L; Fredholm, L; Levin, O; Nord, C E; Gustafsson, J A
1987-02-01
Lean pork meat was fried with or without the addition of frying-fat at 200 or 250 degrees C. The pan residues were collected by washing the hot pan with boiling water. When producing thickened gravy the water was substituted by a mixture of water and flour, milk and flour or cream and flour. The basic extracts were tested for mutagenicity in Ames' Salmonella test on strain TA98 with the addition of S9 mix. High amounts of mutagenicity were found in all samples. The amounts of mutagenicity in the pan residues were at a comparable level of the amounts found in the meat crusts. Thickening of the gravy caused only small changes in the mutagenicity.
Microbial comparative pan-genomics using binomial mixture models
DEFF Research Database (Denmark)
Ussery, David; Snipen, L; Almøy, T
2009-01-01
The size of the core- and pan-genome of bacterial species is a topic of increasing interest due to the growing number of sequenced prokaryote genomes, many from the same species. Attempts to estimate these quantities have been made, using regression methods or mixture models. We extend the latter...... approach by using statistical ideas developed for capture-recapture problems in ecology and epidemiology. RESULTS: We estimate core- and pan-genome sizes for 16 different bacterial species. The results reveal a complex dependency structure for most species, manifested as heterogeneous detection...... probabilities. Estimated pan-genome sizes range from small (around 2600 gene families) in Buchnera aphidicola to large (around 43000 gene families) in Escherichia coli. Results for Echerichia coli show that as more data become available, a larger diversity is estimated, indicating an extensive pool of rarely...
International Nuclear Information System (INIS)
Murr, L.E.; Gaytan, S.M.; Lopez, M.I.; Bujanda, D.E.; Martinez, E.Y.; Whitmyre, G.; Price, H.
2008-01-01
We report herein the metallurgical and acoustical characterization of hydroformed 304 stainless steel, Caribbean pans. These pans were fully tuned to chromatic tones and compared to a manufactured, low-carbon, Caribbean steel pan standard. Hydroformed platforms had a Vickers microindentation hardness of HV 345, which was reduced by annealing during pan fabrication to HV 270. Skirts welded to the hydroformed head had a microindentation hardness of HV 440. Microstructural characterization by light optical metallography and transmission electron microscopy illustrated microstructures (including grain structures) characteristic of these pan microindentation hardnesses
The Salmonella enterica Pan-genome
DEFF Research Database (Denmark)
Jacobsen, Annika; Hendriksen, Rene S.; Aarestrup, Frank Møller
2011-01-01
Salmonella enterica is divided into four subspecies containing a large number of different serovars, several of which are important zoonotic pathogens and some show a high degree of host specificity or host preference. We compare 45 sequenced S. enterica genomes that are publicly available (22......, and the core and pan-genome of Salmonella were estimated to be around 2,800 and 10,000 gene families, respectively. The constructed pan-genomic dendrograms suggest that gene content is often, but not uniformly correlated to serotype. Any given Salmonella strain has a large stable core, whilst...... there is an abundance of accessory genes, including the Salmonella pathogenicity islands (SPIs), transposable elements, phages, and plasmid DNA. We visualize conservation in the genomes in relation to chromosomal location and DNA structural features and find that variation in gene content is localized in a selection...
Petrosyan, A. Sh.
2016-09-01
PanDA (Production and Distributed Analysis System) is a workload management system, widely used for data processing at experiments on Large Hadron Collider and others. COMPASS is a high-energy physics experiment at the Super Proton Synchrotron. Data processing for COMPASS runs locally at CERN, on lxbatch, the data itself stored in CASTOR. In 2014 an idea to start running COMPASS production through PanDA arose. Such transformation in experiment's data processing will allow COMPASS community to use not only CERN resources, but also Grid resources worldwide. During the spring and summer of 2015 installation, validation and migration work is being performed at JINR. Details and results of this process are presented in this paper.
Evolution of the ATLAS PanDA Workload Management System for Exascale Computational Science
Maeno, T; De, K; Klimentov, A; Nilsson, P; Oleynik, D; Panitkin, S; Petrosyan, A; Schovancova, J; Vaniachine, A; Wenaus, T; Yu, D
2013-01-01
An important foundation underlying the impressive success of data processing and analysis in the ATLAS experiment [1] at the LHC [2] is the Production and Distributed Analysis (PanDA) workload management system [3]. PanDA was designed specifically for ATLAS and proved to be highly successful in meeting all the distributed computing needs of the experiment. However, the core design of PanDA is not experiment specific. The PanDA workload management system is capable of meeting the needs of othe...
Recent Improvements in the ATLAS PanDA Pilot
International Nuclear Information System (INIS)
Nilsson, P; De, K; Bejar, J Caballero; Maeno, T; Potekhin, M; Wenaus, T; Compostella, G; Contreras, C; Dos Santos, T
2012-01-01
The Production and Distributed Analysis system (PanDA) in the ATLAS experiment uses pilots to execute submitted jobs on the worker nodes. The pilots are designed to deal with different runtime conditions and failure scenarios, and support many storage systems. This talk will give a brief overview of the PanDA pilot system and will present major features and recent improvements including CernVM File System integration, the job retry mechanism, advanced job monitoring including JEM technology, and validation of new pilot code using the HammerCloud stress-testing system. PanDA is used for all ATLAS distributed production and is the primary system for distributed analysis. It is currently used at over 130 sites worldwide. We analyze the performance of the pilot system in processing LHC data on the OSG, EGI and Nordugrid infrastructures used by ATLAS, and describe plans for its further evolution.
The Pan-STARRS PS1 Image Processing Pipeline
Magnier, E.
The Pan-STARRS PS1 Image Processing Pipeline (IPP) performs the image processing and data analysis tasks needed to enable the scientific use of the images obtained by the Pan-STARRS PS1 prototype telescope. The primary goals of the IPP are to process the science images from the Pan-STARRS telescopes and make the results available to other systems within Pan-STARRS. It also is responsible for combining all of the science images in a given filter into a single representation of the non-variable component of the night sky defined as the "Static Sky". To achieve these goals, the IPP also performs other analysis functions to generate the calibrations needed in the science image processing, and to occasionally use the derived data to generate improved astrometric and photometric reference catalogs. It also provides the infrastructure needed to store the incoming data and the resulting data products. The IPP inherits lessons learned, and in some cases code and prototype code, from several other astronomy image analysis systems, including Imcat (Kaiser), the Sloan Digital Sky Survey (REF), the Elixir system (Magnier & Cuillandre), and Vista (Tonry). Imcat and Vista have a large number of robust image processing functions. SDSS has demonstrated a working analysis pipeline and large-scale databasesystem for a dedicated project. The Elixir system has demonstrated an automatic image processing system and an object database system for operational usage. This talk will present an overview of the IPP architecture, functional flow, code development structure, and selected analysis algorithms. Also discussed is the HW highly parallel HW configuration necessary to support PS1 operational requirements. Finally, results are presented of the processing of images collected during PS1 early commissioning tasks utilizing the Pan-STARRS Test Camera #3.
File list: Unc.Pan.10.AllAg.Pancreas [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Unc.Pan.10.AllAg.Pancreas mm9 Unclassified Pancreas Pancreas SRX1125784,SRX1125785,...1125798 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.Pan.10.AllAg.Pancreas.bed ...
File list: Unc.Pan.20.AllAg.Pancreas [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Unc.Pan.20.AllAg.Pancreas mm9 Unclassified Pancreas Pancreas SRX1125784,SRX1125785,...1125798 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.Pan.20.AllAg.Pancreas.bed ...
File list: Unc.Pan.50.AllAg.Pancreas [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Unc.Pan.50.AllAg.Pancreas mm9 Unclassified Pancreas Pancreas SRX1125784,SRX1125785,...1125791 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.Pan.50.AllAg.Pancreas.bed ...
Tibet- Himalayan Analogs of Pan-African Shear Zones : Implications for Neoproterozoic Tectonics
Attoh, K.; Brown, L. D.
2009-12-01
Large-scale shear zones are distinct features of Tibet-Himalayan orogen and the Pan-African Trans-Saharan belt. Prominent examples in the Pan-African-belt extend for ~2500 km from the Sahara to the Gulf of Guinea and are characterized by right-slip movements. The NS shear zones, such as 4°50’-Kandi shear zone (KSZ) are complemented by NE-SW shear zones that preserve a record of sinistral movements and are represented by the Central Cameroon shear zone (CCSZ) in the eastern part of the Pan-African domain. The West African shear zones project into similar structures in the Borborema Province of northeast Brazil. In addition, the Pan-African belt preserves structures and rock assemblages that indicate subduction-collision tectonics We propose that structures of Tibet-Himalayan collisional orogen are instructive analogs of the Pan-African structures where: (i) the Pan-African front corresponds to the Main Himalayan thrust and it’s splays; (ii) the main Pan-African suture zone is analogous to the Indus-Tsangpo suture in the Tibet-Himalayan belt; (iii) the 4°50’-KSZ corresponds to Karakoram and it’s linkages with Jiali fault system and (iv) left-slip CCSZ and related shear zones are analogs of Altyn Tagh and Kumlun faults and their splays. This suggests the operation of escape-type tectonics in the Neoproterozoic belt of West-Africa and predicts the nature of the deep structures in the Cenozoic Tibet-Himalayan orogen.
Estrategias mundiales en la reducción de sal/sodio en el pan
Mónica Valverde Guillén; Jennifer Picado Pérez
2013-01-01
Objetivo: Proporcionar información sobre las acciones mundiales en la reducción de sal/sodio en el pan para generar datos útiles en la implementación de estrategias que busquen la disminución del consumo de sal/sodio a partir de productos panificados. Método: Se realizó una búsqueda de información en las bases de datos de Binass, PubMed, Scielo e instituciones gubernamentales. Las palabras claves fueron: contenido de sodio en el pan, menos sodio en pan, acciones para reducir sal en el pan, co...
BRDF of Salt Pan Regolith Samples
Georgiev, Georgi T.; Gatebe, Charles K.; Butler, James J.; King, Michael D.
2008-01-01
Laboratory Bi-directional Reflectance Distribution Function (BRDF) measurements of salt pan regolith samples are presented in this study in an effort to understand the role of spatial and spectral variability of the natural biome. The samples were obtained from Etosha Pan, Namibia (19.20 deg S, 15.93 deg E, alt. 1100 m). It is shown how the BRDF depends on the measurement geometry - incident and scatter angles and on the sample particle sizes. As a demonstration of the application of the results, airborne BRDF measurements acquires with NASA's Cloud Absorption Radiometer (CAR) over the same general site where the regolith samples were collected are compared with the laboratory results. Good agreement between laboratory measured and field measured BRDF is reported.
Pan masala advertisements are surrogate for tobacco products
Sushma C; Sharang C
2005-01-01
BACKGROUND: Pan masala is a comparatively recent habit in India and is marketed with and without tobacco. Advertisements of tobacco products have been banned in India since 1st May 2004. The advertisements of plain pan masala, which continue in Indian media, have been suspected to be surrogate for tobacco products bearing the same name. The study was carried out to assess whether these advertisements were for the intended product, or for tobacco products with same brand name. MATERIALS AND ...
Integration of PanDA workload management system with Titan supercomputer at OLCF
AUTHOR|(INSPIRE)INSPIRE-00300320; Klimentov, Alexei; Oleynik, Danila; Panitkin, Sergey; Petrosyan, Artem; Vaniachine, Alexandre; Wenaus, Torre; Schovancova, Jaroslava
2015-01-01
The PanDA (Production and Distributed Analysis) workload management system (WMS) was developed to meet the scale and complexity of LHC distributed computing for the ATLAS experiment. While PanDA currently distributes jobs to more than 100,000 cores at well over 100 Grid sites, next LHC data taking run will require more resources than Grid computing can possibly provide. To alleviate these challenges, ATLAS is engaged in an ambitious program to expand the current computing model to include additional resources such as the opportunistic use of supercomputers. We will describe a project aimed at integration of PanDA WMS with Titan supercomputer at Oak Ridge Leadership Computing Facility (OLCF). Current approach utilizes modi ed PanDA pilot framework for job submission to Titan's batch queues and local data management, with light-weight MPI wrappers to run single threaded workloads in parallel on Titan's multi-core worker nodes. It also gives PanDA new capability to collect, in real time, information about unused...
Integration of PanDA workload management system with Titan supercomputer at OLCF
Panitkin, Sergey; The ATLAS collaboration; Klimentov, Alexei; Oleynik, Danila; Petrosyan, Artem; Schovancova, Jaroslava; Vaniachine, Alexandre; Wenaus, Torre
2015-01-01
The PanDA (Production and Distributed Analysis) workload management system (WMS) was developed to meet the scale and complexity of LHC distributed computing for the ATLAS experiment. While PanDA currently uses more than 100,000 cores at well over 100 Grid sites with a peak performance of 0.3 petaFLOPS, next LHC data taking run will require more resources than Grid computing can possibly provide. To alleviate these challenges, ATLAS is engaged in an ambitious program to expand the current computing model to include additional resources such as the opportunistic use of supercomputers. We will describe a project aimed at integration of PanDA WMS with Titan supercomputer at Oak Ridge Leadership Computing Facility (OLCF). Current approach utilizes modified PanDA pilot framework for job submission to Titan's batch queues and local data management, with light-weight MPI wrappers to run single threaded workloads in parallel on Titan's multi-core worker nodes. It also gives PanDA new capability to collect, in real tim...
Global heterogeneous resource harvesting: the next-generation PanDA Pilot for ATLAS
Nilsson, Paul; The ATLAS collaboration
2017-01-01
The Production and Distributed Analysis system (PanDA), used for workload management in the ATLAS Experiment for over a decade, has in recent years expanded its reach to diverse new resource types such as HPCs, and innovative new workflows such as the Event Service. PanDA meets the heterogeneous resources it harvests in the PanDA pilot, which has embarked on a next-generation reengineering to efficiently integrate and exploit the new platforms and workflows. The new modular architecture is the product of a year of design and prototyping in conjunction with the design of a completely new component, Harvester, that will mediate a richer flow of control and information between pilot and PanDA. Harvester will enable more intelligent and dynamic matching between processing tasks and resources, with an initial focus on HPCs, simplifying the operator and user view of a PanDA site but internally leveraging deep information gathering on the resource to accrue detailed knowledge of a site's capabilities and dynamic sta...
Global heterogeneous resource harvesting: the next-generation PanDA pilot for ATLAS
Nilsson, Paul; The ATLAS collaboration
2017-01-01
The Production and Distributed Analysis system (PanDA), used for workload management in the ATLAS Experiment for over a decade, has in recent years expanded its reach to diverse new resource types such as HPCs, and innovative new workflows such as the event service. PanDA meets the heterogeneous resources it harvests in the PanDA pilot, which has embarked on a next-generation reengineering to efficiently integrate and exploit the new platforms and workflows. The new modular architecture is the product of a year of design and prototyping in conjunction with the design of a completely new component, Harvester, that will mediate a richer flow of control and information between pilot and PanDA. Harvester will enable more intelligent and dynamic matching between processing tasks and resources, with an initial focus on HPCs, simplifying the operator and user view of a PanDA site but internally leveraging deep information gathering on the resource to accrue detailed knowledge of a site's capabilities and dynamic sta...
PD2P: PanDA Dynamic Data Placement for ATLAS
International Nuclear Information System (INIS)
Maeno, T; Panitkin, S; De, K
2012-01-01
The PanDA (Production and Distributed Analysis) system plays a key role in the ATLAS distributed computing infrastructure. PanDA is the ATLAS workload management system for processing all Monte-Carlo (MC) simulation and data reprocessing jobs in addition to user and group analysis jobs. The PanDA Dynamic Data Placement (PD2P) system has been developed to cope with difficulties of data placement for ATLAS. We will describe the design of the new system, its performance during the past year of data taking, dramatic improvements it has brought about in the efficient use of storage and processing resources, and plans for the future.
File list: Unc.Pan.05.AllAg.Pancreas [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Unc.Pan.05.AllAg.Pancreas mm9 Unclassified Pancreas Pancreas SRX527836,SRX1125784,S...X527839 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.Pan.05.AllAg.Pancreas.bed ...
NCBI nr-aa BLAST: CBRC-TSYR-01-1316 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TSYR-01-1316 ref|NP_057167.2| cannabinoid receptor 1 isoform a [Homo sapiens] ref|NP_001013035.1| cann...abinoid receptor 1 [Pan troglodytes] ref|NP_001027997.1| cannabinoid receptor 1 [Mac...aca mulatta] ref|NP_001153698.1| cannabinoid receptor 1 isoform a [Homo sapiens] ref|NP_001153730.1| cannabi...noid receptor 1 isoform a [Homo sapiens] ref|NP_001153731.1| cannabinoid receptor... 1 isoform a [Homo sapiens] ref|NP_001153732.1| cannabinoid receptor 1 isoform a [Homo sapiens] sp|P21554|CN
PNL1 and PNL2 : Arabidopsis homologs of maize PAN1
Clark, Lauren Gail
2010-01-01
PNL1 and PNL2 are the closest Arabidopsis relatives of maize pan1. pan1 and the PNL family of 11 genes encode leucine-rich repeat, receptor-like kinases, however none of these putative kinases is predicted to have actual kinase function, due to one or more amino acid substitutions in residues necessary for kinase function. Because PAN1 plays a role in subsidiary cell formation in maize, it is hypothesized that PNL1 and PNL2 are involved in stomatal formation in Arabidopsis. YFP fusions of the...
Design of an Enterobacteriaceae Pan-genome Microarray Chip
DEFF Research Database (Denmark)
Lukjancenko, Oksana; Ussery, David
2010-01-01
-density microarray chip has been designed, using 116 Enterobacteriaceae genome sequences, taking into account the enteric pan-genome. Probes for the microarray were checked in silico and performance of the chip, based on experimental strains from four different genera, demonstrate a relatively high ability...... to distinguish those strains on genus, species, and pathotype/serovar levels. Additionally, the microarray performed well when investigating which genes were found in a given strain of interest. The Enterobacteriaceae pan-genome microarray, based on 116 genomes, provides a valuable tool for determination...
File list: ALL.Pan.50.AllAg.Pancreas [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available ALL.Pan.50.AllAg.Pancreas mm9 All antigens Pancreas Pancreas SRX111395,ERX651337,SR...ERX383750,SRX672452 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Pan.50.AllAg.Pancreas.bed ...
File list: ALL.Pan.10.AllAg.Pancreas [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available ALL.Pan.10.AllAg.Pancreas mm9 All antigens Pancreas Pancreas SRX111395,ERX651337,SR...ERX383754,ERX383752 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Pan.10.AllAg.Pancreas.bed ...
File list: ALL.Pan.05.AllAg.Pancreas [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available ALL.Pan.05.AllAg.Pancreas mm9 All antigens Pancreas Pancreas ERX651337,SRX527836,SR...ERX383754,ERX383752 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Pan.05.AllAg.Pancreas.bed ...
File list: ALL.Pan.20.AllAg.Pancreas [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available ALL.Pan.20.AllAg.Pancreas mm9 All antigens Pancreas Pancreas SRX111395,ERX651337,SR...ERX383750,SRX672452 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Pan.20.AllAg.Pancreas.bed ...
Next Generation PanDA Pilot for ATLAS and Other Experiments
Nilsson, P; The ATLAS collaboration; Caballero Bejar, J; De, K; Hover, J; Love, P; Maeno, T; Medrano Llamas, R; Walker, R; Wenaus, T
2013-01-01
The Production and Distributed Analysis system (PanDA) has been in use in the ATLAS Experiment since 2005. It uses a sophisticated pilot system to execute submitted jobs on the worker nodes. While originally designed for ATLAS, the PanDA Pilot has recently been refactored to facilitate use outside of ATLAS. Experiments are now handled as plug-ins such that a new PanDA Pilot user only has to implement a set of prototyped methods in the plug-in classes, and provide a script that configures and runs the experiment specific payload. We will give an overview of the Next Generation PanDA Pilot system and will present major features and recent improvements including live user payload debugging, data access via the Federated XRootD system, stage-out to alternative storage elements, support for the new ATLAS DDM system (Rucio), and an improved integration with glExec, as well as a description of the experiment specific plug-in classes. The performance of the pilot system in processing LHC data on the OSG, LCG and Nord...
Next Generation PanDA Pilot for ATLAS and Other Experiments
Nilsson, P; The ATLAS collaboration; Caballero Bejar, J; De, K; Hover, J; Love, P; Maeno, T; Medrano Llamas, R; Walker, R; Wenaus, T
2014-01-01
The Production and Distributed Analysis system (PanDA) has been in use in the ATLAS Experiment since 2005. It uses a sophisticated pilot system to execute submitted jobs on the worker nodes. While originally designed for ATLAS, the PanDA Pilot has recently been refactored to facilitate use outside of ATLAS. Experiments are now handled as plug-ins such that a new PanDA Pilot user only has to implement a set of prototyped methods in the plug-in classes, and provide a script that configures and runs the experiment specific payload. We will give an overview of the Next Generation PanDA Pilot system and will present major features and recent improvements including live user payload debugging, data access via the Federated XRootD system, stage-out to alternative storage elements, support for the new ATLAS DDM system (Rucio), and an improved integration with glExec, as well as a description of the experiment specific plug-in classes. The performance of the pilot system in processing LHC data on the OSG, LCG and Nord...
The next generation of the ATLAS PanDA Monitoring System
Schovancova, J; The ATLAS collaboration; Klimentov, A; Love, P; Potekhin, M; Wenaus, T
2014-01-01
For many years the PanDA Workload Management System has been the basis for distributed production and analysis for the ATLAS experiment at the LHC. Since the start of data taking PanDA usage has ramped up steadily, with up to 1M completed jobs/day in 2013. The associated monitoring data volume has been rising as well, to levels that present a new set of challenges in the areas of database scalability and monitoring system performance and efficiency. Outside of ATLAS, the PanDA system is also being used in projects like AMS, LSST and a few others. It currently undergoes a significant redesign, both of the core server components responsible for workload management, brokerage and data access, and of the monitoring part, which is critically important for efficient execution of the workflow in a way that’s transparent to the user and also provides an effective set of tools for operational support. The new generation of the PanDA Monitoring Service is designed based on a proven, scalable, industry-standard Web Fr...
PanDA Pilot Submission using Condor-G: Experience and Improvements
Zhao, Xin; The ATLAS collaboration; Wlodek, Tom; Wenaus, Torre; Frey, Jaime; Tannenbaum, Todd; Livny, Miron
2010-01-01
PanDA is the workload management system of the ATLAS experiment, used to run production and user analysis jobs on the grid. As a late-binding, pilot-based system, the maintenance of a smooth and steady stream of pilot jobs to all grid sites is critical for PanDA operation. The ATLAS Computing Facility (ACF) at BNL, as the ATLAS Tier 1 center in the US, operates the pilot submission systems for the US. This is done using the PanDA "AutoPilot" scheduler component which submits pilot jobs via Condor-G, a grid job scheduling system developed at the University of Wisconsin-Madison. In this talk, we discuss the operation and performance of the Condor-G pilot submission at BNL, with emphasis on the challenges and issues encountered in the real grid production environment. With the close collaboration of Condor and PanDA teams, the scalability and stability of the overall system has been greatly improved over the last year. We review improvements made to Condor-G resulting from this collaboration, including isolation...
PanDA Pilot Submission using Condor-G: Experience and Improvements
Zhao, X; The ATLAS collaboration; Wlodek, T; Wenaus, T; Frey, J; Tannenbaum, T; Livny, M
2011-01-01
PanDA (Production and Distributed Analysis) is the workload management system of the ATLAS experiment, used to run managed production and user analysis jobs on the grid. As a late-binding, pilot-based system, the maintenance of a smooth and steady stream of pilot jobs to all grid sites is critical for PanDA operation. The ATLAS Computing Facility (ACF) at BNL, as the ATLAS Tier1 center in the US, operates the pilot submission systems for the US. This is done using the PanDA “AutoPilot” scheduler component which submits pilot jobs via Condor-G, a grid job scheduling system developed at the University of Wisconsin-Madison. In this paper, we discuss the operation and performance of the Condor-G pilot submission at BNL, with emphasis on the challenges and issues encountered in the real grid production environment. With the close collaboration of Condor and PanDA teams, the scalability and stability of the overall system has been greatly improved over the last year. We review improvements made to Condor-G resu...
File list: ALL.Pan.05.AllAg.Pancreas [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available ALL.Pan.05.AllAg.Pancreas hg19 All antigens Pancreas Pancreas SRX347280,SRX134735,S...71,SRX342269,SRX188948,SRX188958 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.Pan.05.AllAg.Pancreas.bed ...
File list: ALL.Pan.20.AllAg.Pancreas [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available ALL.Pan.20.AllAg.Pancreas hg19 All antigens Pancreas Pancreas SRX136972,ERX103432,S...58,SRX188948,SRX270968,SRX347271 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.Pan.20.AllAg.Pancreas.bed ...
File list: ALL.Pan.10.AllAg.Pancreas [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available ALL.Pan.10.AllAg.Pancreas hg19 All antigens Pancreas Pancreas SRX136972,SRX136967,S...71,SRX342269,SRX188948,SRX188958 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.Pan.10.AllAg.Pancreas.bed ...
75 FR 8919 - Federal Consistency Appeal by Pan American Grain Co.
2010-02-26
... by Pan American Grain Co. AGENCY: National Oceanic and Atmospheric Administration (NOAA), Department... Grain Co., has filed an administrative appeal with the Department of Commerce (Department), requesting..., 2010, Pan American Grain Co. filed notice of an appeal with the Secretary of Commerce (Secretary...
PD2P : PanDA Dynamic Data Placement for ATLAS
CERN. Geneva
2012-01-01
The PanDA Dynamic Data Placement (PD2P) system has been developed to cope with difficulties of data placement for ATLAS. PD2P is an intelligent subsystem of PanDA to distribute data by taking the following factors into account: popularity, locality, the usage pattern of the data, the distribution of CPU and storage resources, ...
Utilization of Prickly Pear Peels to Improve Quality of Pan Bread
International Nuclear Information System (INIS)
Anwar, M.M.; Sallam, E.M.
2016-01-01
This investigation aimed to study utilization of prickly pear peels to improve quality of pan bread. Prickly pear peels powder added to wheat flour 72 % at levels 1.0 and 2.0% to make pan beard. In this study, evaluation of nutrients and chemical constitutes and functional properties of prickly pear peels as well as the rheological properties of dough contained prickly pear peels at levels 1% and 2% has been conducted. Then evaluated organoleptic characteristics of pan bread made of it also determined staling rate. Results showed that prickly pear peels had higher content of 32.67 % fiber, 14.25 % pectin and 87.82 % ascorbic acid, and higher contents of antioxidant components. It consists of 441.11 mg/100 g, total phenols, 35.2 flavonoids mg/100 g and DPPH radical-scavenging 62.14%, also water holding capacity was 1.8 ml H 2 O / g , oil holding capacity 2.35 (ml oil/g) and foam stability 7.15%. The major phenolic compounds Oleuro 1264.407, pyrogallo 1149.68, Benzoic 982.37, 3-oH Tyrosol 588.53, Ellagic 413.26, Chorogenic 271.10, Protocatechuic acid 176.02, P-oH- Benzoic 112.78, Epicatechin105.99, Gallic acid 61.26 ppm. The results revealed that addition of prickly pear peels to wheat flour increased the nutrition values of pan bread made of it due to high contents of fiber, ascorbic acid and natural antioxidants, and also decreased staling which improves the quality of pan bread, as well as increases shelf-life of pan bread.
File list: Oth.Pan.05.AllAg.Pancreas [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.Pan.05.AllAg.Pancreas mm9 TFs and others Pancreas Pancreas SRX111395,SRX672451,...ERX383750,ERX383751,ERX383754,ERX383752 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.Pan.05.AllAg.Pancreas.bed ...
File list: Oth.Pan.10.AllAg.Pancreas [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.Pan.10.AllAg.Pancreas mm9 TFs and others Pancreas Pancreas SRX111395,SRX672451,...ERX383750,ERX383751,ERX383754,ERX383752 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.Pan.10.AllAg.Pancreas.bed ...
File list: Oth.Pan.20.AllAg.Pancreas [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.Pan.20.AllAg.Pancreas mm9 TFs and others Pancreas Pancreas SRX111395,SRX672451,...ERX383752,ERX383751,ERX383754,ERX383750 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.Pan.20.AllAg.Pancreas.bed ...
File list: Oth.Pan.50.AllAg.Pancreas [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.Pan.50.AllAg.Pancreas mm9 TFs and others Pancreas Pancreas SRX111395,SRX672451,...ERX383752,ERX383751,ERX383754,ERX383750 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.Pan.50.AllAg.Pancreas.bed ...
PanDA Pilot Submission using Condor-G: Experience and Improvements
International Nuclear Information System (INIS)
Zhao Xin; Hover, John; Wlodek, Tomasz; Wenaus, Torre; Frey, Jaime; Tannenbaum, Todd; Livny, Miron
2011-01-01
PanDA (Production and Distributed Analysis) is the workload management system of the ATLAS experiment, used to run managed production and user analysis jobs on the grid. As a late-binding, pilot-based system, the maintenance of a smooth and steady stream of pilot jobs to all grid sites is critical for PanDA operation. The ATLAS Computing Facility (ACF) at BNL, as the ATLAS Tier1 center in the US, operates the pilot submission systems for the US. This is done using the PanDA 'AutoPilot' scheduler component which submits pilot jobs via Condor-G, a grid job scheduling system developed at the University of Wisconsin-Madison. In this paper, we discuss the operation and performance of the Condor-G pilot submission at BNL, with emphasis on the challenges and issues encountered in the real grid production environment. With the close collaboration of Condor and PanDA teams, the scalability and stability of the overall system has been greatly improved over the last year. We review improvements made to Condor-G resulting from this collaboration, including isolation of site-based issues by running a separate Gridmanager for each remote site, introduction of the 'Nonessential' job attribute to allow Condor to optimize its behavior for the specific character of pilot jobs, better understanding and handling of the Gridmonitor process, as well as better scheduling in the PanDA pilot scheduler component. We will also cover the monitoring of the health of the system.
Evaluation of chemopreventive effects of betel leaf on the genotoxicity of pan masala.
Trivedi, A H; Patel, R K; Rawal, U M; Adhvaryu, S G; Balar, D B
1994-01-01
The antigenotoxic effect of the aqueous extract of betel leaf (BL-ext.) against the pan masala was tested with the help of cytogenetic endpoints like chromosome aberration (CA) and sister chromatid exchange (SCE) utilizing Chinese hamster ovary (CHO) cells. Compared to the cultures treated with aqueous extract of pan masala alone, a reduction in CA and SCE frequencies in CHO cells was observed following a combined treatment with pan masala (with or without tobacco) extract and BL-ext. The protective effect of BL-ext. against the genomic damage caused by pan masala was statistically significant only after treating the cells for a longer period.
Real-Time Penetrating Particle Analyzer (PAN)
Wu, X.; Ambrosi, G.; Bertucci, B.
2018-02-01
The PAN can measure penetrating particles with great precision to study energetic particles, solar activities, and the origin and propagation of cosmic rays. The real-time monitoring of penetrating particles is crucial for deep space human travel.
Pan-Am seeks to salvage premature well investment
Energy Technology Data Exchange (ETDEWEB)
1965-01-18
Whether accelerated oil production should be permitted when a waterflood project has been delayed came up in a rare ''show cause'' hearing before the Alberta Oil and Gas Conservation Board, January 12. The Board ordered Pan American Petroleum Corp. to show cause why an order giving it 80-acre instead of 160-acre spacing in a 2,040-acre sector of the Pembina Oil Field should not be rescinded because of extensive delays in getting a related water flood scheme into operation. Pan Am has $750,000 tied up in infill wells drilled in November and December, following the new spacing unit order issued Sept. 29, 1964, said G.J. Last. Pan Am applied Nov. 24 for deferment of injection to July 1, 1965, because of delays in getting the unit agreement completed and ordering equipment. However it wants to produce the new wells, which are expected to average 20 bbl per day each in this marginal area. The board granted the deferment Dec. 29, but instituted the hearing on the question of interim producing rates.
Afro-Americans and Early Pan-Africanism
Contee, Clarence G.
1970-01-01
History of the Pan-African movement, the roles of W.E.B.Du Bois and Marcus Garvey in the movement activities, and the shift to African based leadership of the movement in the 1940's are discussed. (KG)
Pan-genome and phylogeny of Bacillus cereus sensu lato
Bazinet, Adam
2017-01-01
Background: Bacillus cereus sensu lato ( s . l .) is an ecologically diverse bacterial group of medical and agricultural significance. In this study, I use publicly available genomes to characterize the B. cereus s. l. pan-genome and perform the largest phylogenetic and population genetic analyses of this group to date in terms of the number of genes and taxa included. With these fundamental data in hand, I identify genes associated with particular phenotypic traits (i.e., "pan-GWAS" analysis...
NCBI nr-aa BLAST: CBRC-DDIS-01-0111 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DDIS-01-0111 ref|NP_060837.2| phytoceramidase, alkaline [Homo sapiens] ref|XP_...001175032.1| PREDICTED: phytoceramidase, alkaline isoform 3 [Pan troglodytes] sp|Q9NUN7|APHC_HUMAN Alkaline ...phytoceramidase (aPHC) (Alkaline ceramidase) (Alkaline dihydroceramidase SB89) gb|AAK71923.1|AF214454_1 alkali...ne phytoceramidase [Homo sapiens] gb|AAL56013.1|AF327353_1 alkaline dihydrocera...midase SB89 [Homo sapiens] gb|AAH73853.1| Phytoceramidase, alkaline [Homo sapiens] gb|EAW75010.1| phytoceramidase, alkaline, isoform CRA_b [Homo sapiens] NP_060837.2 3e-23 29% ...
Extending the ATLAS PanDA Workload Management System for New Big Data Applications
De, K; The ATLAS collaboration; Maeno, T; Nilsson, P; Panitkin, S; Vaniachine, A; Wenaus, T; Yu, D
2013-01-01
The LHC experiments are today at the leading edge of large scale distributed data-intensive computational science. The LHC's ATLAS experiment processes data volumes which are particularly extreme, over 130 PB to date, distributed worldwide at over of 120 sites. An important element in the success of the exciting physics results from ATLAS is the highly scalable integrated workflow and dataflow management afforded by the PanDA workload management system, used for all the distributed computing needs of the experiment. The PanDA design is not experiment specific and PanDA is now being extended to support other data intensive scientific applications. Alpha-Magnetic Spectrometer, an astro-particle experiment on the International Space Station, and the Compact Muon Solenoid, an LHC experiment, have successfully evaluated PanDA and are pursuing its adoption. PanDA was cited as an example of "a high performance, fault tolerant software for fast, scalable access to data repositories of many kinds" during the "Big Data...
PanDA: Exascale Federation of Resources for the ATLAS Experiment at the LHC
Directory of Open Access Journals (Sweden)
Megino Fernando Barreiro
2016-01-01
The PanDA (Production and Distributed Analysis system was developed in 2005 for the ATLAS experiment on top of this heterogeneous infrastructure to seamlessly integrate the computational resources and give the users the feeling of a unique system. Since its origins, PanDA has evolved together with upcoming computing paradigms in and outside HEP, such as changes in the networking model, Cloud Computing and HPC. It is currently running steadily up to 200 thousand simultaneous cores (limited by the available resources for ATLAS, up to two million aggregated jobs per day and processes over an exabyte of data per year. The success of PanDA in ATLAS is triggering the widespread adoption and testing by other experiments. In this contribution we will give an overview of the PanDA components and focus on the new features and upcoming challenges that are relevant to the next decade of distributed computing workload management using PanDA.
"A Constant Transit of Finding": Fantasy as Realisation in "Pan's Labyrinth"
Clark, Roger; McDonald, Keith
2010-01-01
This article considers Guillermo Del Toro's "Pan's Labyrinth" as a text which utilises key codes and conventions of children's literature as a means of encountering the trauma of Fascism. The article begins by placing "Pan's Labyrinth" at a contextual crossroads involving fairy tale and a Spanish cinematic tradition and…
Improvements for PanDA and intermediate layers
Energy Technology Data Exchange (ETDEWEB)
Kawamura, Gen; Magradze, Erekle; Musheghyan, Haykuhi; Nadal, Jordi; Quadt, Arnulf; Rzehorz, Gerhard [II. Physikalisches Institut, Georg-August-Universitaet Goettingen (Germany)
2015-07-01
The PanDA Production and Distributed Analysis system is handling the ATLAS workload management for production and distributed analysis processing. It was designed for analysis as well as production for High Energy Physics. One of the advantages of this pilot based system is, that it has its own integrated monitoring solution. Monitoring is a method used in computing, it means that a certain process is observed and overseen and is usually also protocolled. In the case of a process or system failure, a responsible person should be notified and countermeasures taken. Since PanDA is very versatile, it can also be used to process jobs on a computing Cloud, instead of just using the Grid(WLCG). Cloud computing resources can be provided by private companies, that bill the resources that are actually being used, for example CPU power over time. The advantage of this is obvious if one looks at the cost. They are basically the same, whether a huge task is done on little CPU power over a long time or on plenty of CPU power in a short time. For these reasons, a close monitoring, for example by the PanDA system for the usage of Cloud resources is important.
Improving Security in the ATLAS PanDA System
International Nuclear Information System (INIS)
Caballero, J; Maeno, T; Potekhin, M; Wenaus, T; Nilsson, P; Stewart, G
2011-01-01
The security challenges faced by users of the grid are considerably different to those faced in previous environments. The adoption of pilot jobs systems by LHC experiments has mitigated many of the problems associated with the inhomogeneities found on the grid and has greatly improved job reliability; however, pilot jobs systems themselves must then address many security issues, including the execution of multiple users' code under a common 'grid' identity. In this paper we describe the improvements and evolution of the security model in the ATLAS PanDA (Production and Distributed Analysis) system. We describe the security in the PanDA server which is in place to ensure that only authorized members of the VO are allowed to submit work into the system and that jobs are properly audited and monitored. We discuss the security in place between the pilot code itself and the PanDA server, ensuring that only properly authenticated workload is delivered to the pilot for execution. When the code to be executed is from a 'normal' ATLAS user, as opposed to the production system or other privileged actor, then the pilot may use an EGEE developed identity switching tool called gLExec. This changes the grid proxy available to the job and also switches the UNIX user identity to protect the privileges of the pilot code proxy. We describe the problems in using this system and how they are overcome. Finally, we discuss security drills which have been run using PanDA and show how these improved our operational security procedures.
Next generation PanDA pilot for ATLAS and other experiments
International Nuclear Information System (INIS)
Nilsson, P; De, K; Megino, F Barreiro; Llamas, R Medrano; Bejar, J Caballero; Hover, J; Maeno, T; Wenaus, T; Love, P; Walker, R
2014-01-01
The Production and Distributed Analysis system (PanDA) has been in use in the ATLAS Experiment since 2005. It uses a sophisticated pilot system to execute submitted jobs on the worker nodes. While originally designed for ATLAS, the PanDA Pilot has recently been refactored to facilitate use outside of ATLAS. Experiments are now handled as plug-ins such that a new PanDA Pilot user only has to implement a set of prototyped methods in the plug-in classes, and provide a script that configures and runs the experiment-specific payload. We will give an overview of the Next Generation PanDA Pilot system and will present major features and recent improvements including live user payload debugging, data access via the Federated XRootD system, stage-out to alternative storage elements, support for the new ATLAS DDM system (Rucio), and an improved integration with glExec, as well as a description of the experiment-specific plug-in classes. The performance of the pilot system in processing LHC data on the OSG, LCG and Nordugrid infrastructures used by ATLAS will also be presented. We will describe plans for future development on the time scale of the next few years.
Acupuncture as an Adjunct Therapy for Osteoarthritis in Chimpanzees (Pan troglodytes)
Magden, Elizabeth R; Haller, Rachel L; Thiele, Erica J; Buchl, Stephanie J; Lambeth, Susan P; Schapiro, Steven J
2013-01-01
Acupuncture is an ancient practice that is currently used to treat disorders ranging from osteoarthritis to cardiomyopathy. Acupuncture involves the insertion of thin, sterile needles into defined acupuncture points that stimulate physiologic processes through neural signaling. Numerous scientific studies have proven the benefits of acupuncture, and given this scientific support, we hypothesized that acupuncture could benefit the nonhuman primates at our facility. As our chimpanzee colony ages, we are observing an increase in osteoarthritis and have focused our initial acupuncture treatments on this condition. We successfully trained 3 chimpanzees, by using positive-reinforcement training techniques, to voluntarily participate in acupuncture treatments for stifle osteoarthritis. We used 3 acupuncture points that correlate with alleviation of stifle pain and inflammation in humans. A mobility scoring system was used to assess improvements in mobility as a function of the acupuncture treatments. The 2 chimpanzees with the most severe osteoarthritis showed significant improvement in mobility after acupuncture treatments. Acupuncture therapy not only resulted in improved mobility, but the training sessions also served as enrichment for the animals, as demonstrated by their voluntary participation in the training and treatment sessions. Acupuncture is an innovative treatment technique that our data show to be safe, inexpensive, and, most importantly, effective for chimpanzees. PMID:23849446
Task Design Influences Prosociality in Captive Chimpanzees (Pan troglodytes)
DEFF Research Database (Denmark)
House, Bailey R; Silk, Joan B; Lambeth, Susan P
2014-01-01
Chimpanzees confer benefits on group members, both in the wild and in captive populations. Experimental studies of how animals allocate resources can provide useful insights about the motivations underlying prosocial behavior, and understanding the relationship between task design and prosocial...... and the methods used, and in most cases employ procedures that reduce critical features of naturalistic social interactions, such as partner choice. The focus of the current study is on understanding the link between experimental methodology and prosocial behavior in captive chimpanzees, rather than on describing...... these animals' social motivations themselves. We introduce a task design that avoids isolating subjects and allows them to freely decide whether to participate in the experiment. We explore key elements of the methods utilized in previous experiments in an effort to evaluate two possibilities that have been...
Dogs (Canis familiaris, but not chimpanzees (Pan troglodytes, understand imperative pointing.
Directory of Open Access Journals (Sweden)
Katharina C Kirchhofer
Full Text Available Chimpanzees routinely follow the gaze of humans to outside targets. However, in most studies using object choice they fail to use communicative gestures (e.g. pointing to find hidden food. Chimpanzees' failure to do this may be due to several difficulties with this paradigm. They may, for example, misinterpret the gesture as referring to the opaque cup instead of the hidden food. Or perhaps they do not understand informative communicative intentions. In contrast, dogs seem to be skilful in using human communicative cues in the context of finding food, but as of yet there is not much data showing whether they also use pointing in the context of finding non-food objects. Here we directly compare chimpanzees' (N = 20 and dogs' (N = 32 skills in using a communicative gesture directed at a visible object out of reach of the human but within reach of the subject. Pairs of objects were placed in view of and behind the subjects. The task was to retrieve the object the experimenter wanted. To indicate which one she desired, the experimenter pointed imperatively to it and directly rewarded the subject for handing over the correct one. While dogs performed well on this task, chimpanzees failed to identify the referent. Implications for great apes' and dogs' understanding of human communicative intentions are discussed.
Cognitive and physiological markers of emotional awareness in chimpanzees (Pan troglodytes).
Parr, L A
2001-11-01
The ability to understand emotion in others is one of the most important factors involved in regulating social interactions in primates. Such emotional awareness functions to coordinate activity among group members, enable the formation of long-lasting individual relationships, and facilitate the pursuit of shared interests. Despite these important evolutionary implications, comparative studies of emotional processing in humans and great apes are practically nonexistent, constituting a major gap in our understanding of the extent to which emotional awareness has played an important role in shaping human behavior and societies. This paper presents the results of two experiments that examine chimpanzees' responses to emotional stimuli. First, changes in peripheral skin temperature were measured while subjects viewed three categories of emotionally negative video scenes; conspecifics being injected with needles (INJ), darts and needles alone (DART), and conspecific directing agonism towards the veterinarians (CHASE). Second, chimpanzees were required to use facial expressions to categorize emotional video scenes, i.e., favorite food and objects and veterinarian procedures, according to their positive and negative valence. With no prior training, subjects spontaneously matched the emotional videos to conspecific facial expressions according to their shared emotional meaning, indicating that chimpanzee facial expressions are processed emotionally, as are human expressions. Decreases in peripheral skin temperature, indicative of negative sympathetic arousal, were significantly lower when subjects viewed the INJ and DART videos, compared to the CHASE videos, indicating greater negative arousal when viewing conspecifics being injected with needles, and needles themselves, than when viewing conspecifics engaged in general agonism.
Primate archaeology reveals cultural transmission in wild chimpanzees (Pan troglodytes verus)
Luncz, Lydia V.; Wittig, Roman M.; Boesch, Christophe
2015-01-01
Recovering evidence of past human activities enables us to recreate behaviour where direct observations are missing. Here, we apply archaeological methods to further investigate cultural transmission processes in percussive tool use among neighbouring chimpanzee communities in the Taï National Park, Côte d'Ivoire, West Africa. Differences in the selection of nut-cracking tools between neighbouring groups are maintained over time, despite frequent female transfer, which leads to persistent cultural diversity between chimpanzee groups. Through the recovery of used tools in the suggested natal territory of immigrants, we have been able to reconstruct the tool material selection of females prior to migration. In combination with direct observations of tool selection of local residents and immigrants after migration, we uncovered temporal changes in tool selection for immigrating females. After controlling for ecological differences between territories of immigrants and residents our data suggest that immigrants abandoned their previous tool preference and adopted the pattern of their new community, despite previous personal proficiency of the same foraging task. Our study adds to the growing body of knowledge on the importance of conformist tendencies in animals. PMID:26483527
Acupuncture as an adjunct therapy for osteoarthritis in chimpanzees (Pan troglodytes).
Magden, Elizabeth R; Haller, Rachel L; Thiele, Erica J; Buchl, Stephanie J; Lambeth, Susan P; Schapiro, Steven J
2013-07-01
Acupuncture is an ancient practice that is currently used to treat disorders ranging from osteoarthritis to cardiomyopathy. Acupuncture involves the insertion of thin, sterile needles into defined acupuncture points that stimulate physiologic processes through neural signaling. Numerous scientific studies have proven the benefits of acupuncture, and given this scientific support, we hypothesized that acupuncture could benefit the nonhuman primates at our facility. As our chimpanzee colony ages, we are observing an increase in osteoarthritis and have focused our initial acupuncture treatments on this condition. We successfully trained 3 chimpanzees, by using positive-reinforcement training techniques, to voluntarily participate in acupuncture treatments for stifle osteoarthritis. We used 3 acupuncture points that correlate with alleviation of stifle pain and inflammation in humans. A mobility scoring system was used to assess improvements in mobility as a function of the acupuncture treatments. The 2 chimpanzees with the most severe osteoarthritis showed significant improvement in mobility after acupuncture treatments. Acupuncture therapy not only resulted in improved mobility, but the training sessions also served as enrichment for the animals, as demonstrated by their voluntary participation in the training and treatment sessions. Acupuncture is an innovative treatment technique that our data show to be safe, inexpensive, and, most importantly, effective for chimpanzees.
Primate archaeology reveals cultural transmission in wild chimpanzees (Pan troglodytes verus).
Luncz, Lydia V; Wittig, Roman M; Boesch, Christophe
2015-11-19
Recovering evidence of past human activities enables us to recreate behaviour where direct observations are missing. Here, we apply archaeological methods to further investigate cultural transmission processes in percussive tool use among neighbouring chimpanzee communities in the Taï National Park, Côte d'Ivoire, West Africa. Differences in the selection of nut-cracking tools between neighbouring groups are maintained over time, despite frequent female transfer, which leads to persistent cultural diversity between chimpanzee groups. Through the recovery of used tools in the suggested natal territory of immigrants, we have been able to reconstruct the tool material selection of females prior to migration. In combination with direct observations of tool selection of local residents and immigrants after migration, we uncovered temporal changes in tool selection for immigrating females. After controlling for ecological differences between territories of immigrants and residents our data suggest that immigrants abandoned their previous tool preference and adopted the pattern of their new community, despite previous personal proficiency of the same foraging task. Our study adds to the growing body of knowledge on the importance of conformist tendencies in animals. © 2015 The Author(s).
Great apes distinguish true from false beliefs in an interactive helping task.
Directory of Open Access Journals (Sweden)
David Buttelmann
Full Text Available Understanding the behavior of others in a wide variety of circumstances requires an understanding of their psychological states. Humans' nearest primate relatives, the great apes, understand many psychological states of others, for example, perceptions, goals, and desires. However, so far there is little evidence that they possess the key marker of advanced human social cognition: an understanding of false beliefs. Here we demonstrate that in a nonverbal (implicit false-belief test which is passed by human 1-year-old infants, great apes as a group, including chimpanzees (Pan troglodytes, bonobos (Pan paniscus, and orangutans (Pongo abelii, distinguish between true and false beliefs in their helping behavior. Great apes thus may possess at least some basic understanding that an agent's actions are based on her beliefs about reality. Hence, such understanding might not be the exclusive province of the human species.
Pan-specific MHC class I predictors: A benchmark of HLA class I pan-specific prediction methods
DEFF Research Database (Denmark)
Zhang, Hao; Lundegaard, Claus; Nielsen, Morten
2009-01-01
not previously been compared using independent evaluation sets. Results: A diverse set of quantitative peptide binding affinity measurements was collected from IEDB, together with a large set of HLA class I ligands from the SYFPEITHI database. Based on these data sets, three different pan-specific HLA web...
File list: NoD.Pan.20.AllAg.Pancreas [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available NoD.Pan.20.AllAg.Pancreas mm9 No description Pancreas Pancreas ERX651337,ERX651340,...ERX651341,ERX651342 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/NoD.Pan.20.AllAg.Pancreas.bed ...
File list: NoD.Pan.05.AllAg.Pancreas [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available NoD.Pan.05.AllAg.Pancreas mm9 No description Pancreas Pancreas ERX651337,ERX651340,...ERX651342,ERX651341 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/NoD.Pan.05.AllAg.Pancreas.bed ...
File list: NoD.Pan.10.AllAg.Pancreas [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available NoD.Pan.10.AllAg.Pancreas mm9 No description Pancreas Pancreas ERX651337,ERX651340,...ERX651342,ERX651341 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/NoD.Pan.10.AllAg.Pancreas.bed ...
Directory of Open Access Journals (Sweden)
G. J. Phillips
2013-02-01
Full Text Available We describe measurements of peroxyacetyl nitrate (CH3C(OO2NO2, PAN and peroxyacetic acid (CH3C(OOOH, PAA in the Boreal forest using iodide chemical ionization mass spectrometry (ICIMS. The measurements were made during the Hyytiälä United Measurement of Photochemistry and Particles – Comprehensive Organic Particle and Environmental Chemistry (HUMPPA-COPEC-2010 measurement intensive. Mixing ratios of PAN and PAA were determined by measuring the acetate ion signal (CH3C(OO−, m/z = 59 resulting from reaction of CH3C(OO2 (from the thermal dissociation of PAN or CH3C(OOOH with iodide ions using alternatively heated and ambient temperature inlet lines. During some periods of high temperature (~ 30 °C and low NOx (< 1 ppbv, PAA mixing ratios were similar to, or exceeded those of PAN and thus contributed a significant fraction of the total acetate signal. PAA is thus a potential interference for ICIMS measurements of PAN, and especially eddy covariance flux measurements in environments where the PAA flux is likely to be a significant proportion of the (short timescale acetate ion variability. Within the range of mixing ratios of NOx measured during HUMPPA-COPEC, the modelled ratio of PAA-to-PAN was found to be sensitive to temperature (through the thermal decomposition rate of PAN and the HO2 mixing ratio, thus providing some constraint to estimates of photochemical activity and oxidation rates in the Boreal environment.
Eddy covariance fluxes of acyl peroxy nitrates (PAN, PPN and MPAN above a Ponderosa pine forest
Directory of Open Access Journals (Sweden)
G. M. Wolfe
2009-01-01
Full Text Available During the Biosphere Effects on AeRosols and Photochemistry EXperiment 2007 (BEARPEX-2007, we observed eddy covariance (EC fluxes of speciated acyl peroxy nitrates (APNs, including peroxyacetyl nitrate (PAN, peroxypropionyl nitrate (PPN and peroxymethacryloyl nitrate (MPAN, above a Ponderosa pine forest in the western Sierra Nevada. All APN fluxes are net downward during the day, with a median midday PAN exchange velocity of −0.3 cm s−1; nighttime storage-corrected APN EC fluxes are smaller than daytime fluxes but still downward. Analysis with a standard resistance model shows that loss of PAN to the canopy is not controlled by turbulent or molecular diffusion. Stomatal uptake can account for 25 to 50% of the observed downward PAN flux. Vertical gradients in the PAN thermal decomposition (TD rate explain a similar fraction of the flux, suggesting that a significant portion of the PAN flux into the forest results from chemical processes in the canopy. The remaining "unidentified" portion of the net PAN flux (~15% is ascribed to deposition or reactive uptake on non-stomatal surfaces (e.g. leaf cuticles or soil. Shifts in temperature, moisture and ecosystem activity during the summer – fall transition alter the relative contribution of stomatal uptake, non-stomatal uptake and thermochemical gradients to the net PAN flux. Daytime PAN and MPAN exchange velocities are a factor of 3 smaller than those of PPN during the first two weeks of the measurement period, consistent with strong intra-canopy chemical production of PAN and MPAN during this period. Depositional loss of APNs can be 3–21% of the gross gas-phase TD loss depending on temperature. As a source of nitrogen to the biosphere, PAN deposition represents approximately 4–19% of that due to dry deposition of nitric acid at this site.
Integration Of PanDA Workload Management System With Supercomputers
Klimentov, Alexei; The ATLAS collaboration; Maeno, Tadashi; Mashinistov, Ruslan; Nilsson, Paul; Oleynik, Danila; Panitkin, Sergey; Read, Kenneth; Ryabinkin, Evgeny; Wenaus, Torre
2015-01-01
The Large Hadron Collider (LHC), operating at the international CERN Laboratory in Geneva, Switzerland, is leading Big Data driven scientific explorations. Experiments at the LHC explore the fundamental nature of matter and the basic forces that shape our universe, and were recently credited for the discovery of a Higgs boson. ATLAS, one of the largest collaborations ever assembled in the sciences, is at the forefront of research at the LHC. To address an unprecedented multi-petabyte data processing challenge, the ATLAS experiment is relying on a heterogeneous distributed computational infrastructure. The ATLAS experiment uses PanDA (Production and Data Analysis) Workload Management System for managing the workflow for all data processing on over 140 data centers. Through PanDA, ATLAS physicists see a single computing facility that enables rapid scientific breakthroughs for the experiment, even though the data centers are physically scattered all over the world. While PanDA currently uses more than 100,000 co...
Pan-genome and phylogeny of Bacillus cereus sensu lato.
Bazinet, Adam L
2017-08-02
Bacillus cereus sensu lato (s. l.) is an ecologically diverse bacterial group of medical and agricultural significance. In this study, I use publicly available genomes and novel bioinformatic workflows to characterize the B. cereus s. l. pan-genome and perform the largest phylogenetic and population genetic analyses of this group to date in terms of the number of genes and taxa included. With these fundamental data in hand, I identify genes associated with particular phenotypic traits (i.e., "pan-GWAS" analysis), and quantify the degree to which taxa sharing common attributes are phylogenetically clustered. A rapid k-mer based approach (Mash) was used to create reduced representations of selected Bacillus genomes, and a fast distance-based phylogenetic analysis of this data (FastME) was performed to determine which species should be included in B. cereus s. l. The complete genomes of eight B. cereus s. l. species were annotated de novo with Prokka, and these annotations were used by Roary to produce the B. cereus s. l. pan-genome. Scoary was used to associate gene presence and absence patterns with various phenotypes. The orthologous protein sequence clusters produced by Roary were filtered and used to build HaMStR databases of gene models that were used in turn to construct phylogenetic data matrices. Phylogenetic analyses used RAxML, DendroPy, ClonalFrameML, PAUP*, and SplitsTree. Bayesian model-based population genetic analysis assigned taxa to clusters using hierBAPS. The genealogical sorting index was used to quantify the phylogenetic clustering of taxa sharing common attributes. The B. cereus s. l. pan-genome currently consists of ≈60,000 genes, ≈600 of which are "core" (common to at least 99% of taxa sampled). Pan-GWAS analysis revealed genes associated with phenotypes such as isolation source, oxygen requirement, and ability to cause diseases such as anthrax or food poisoning. Extensive phylogenetic analyses using an unprecedented amount of data
DEFF Research Database (Denmark)
Lynggaard, Kennet
2017-01-01
: (1) pan-EU NGOs are receptive to political myths, including in the short term; (2) pan-EU NGOs contribute to the reproduction of myths, especially already-institutionalised myths and myths that resonate with their sectoral activities; and (3) pan-EU NGOs strategically use political myths to justify...
Jongman, R.H.G.; Bouwma, I.M.; Doorn, van A.M.
2006-01-01
The Pan European Ecological Network for Western Europe is the third project in developing the Pan European Ecological Network The objective of the Pan-European Ecological Network is to develop a vision for a coherent network of high value areas for biodiversity, as internationally and nationally
Pan-Domain Analysis of ZIP Zinc Transporters
Directory of Open Access Journals (Sweden)
Laura E. Lehtovirta-Morley
2017-12-01
Full Text Available The ZIP (Zrt/Irt-like protein family of zinc transporters is found in all three domains of life. However, little is known about the phylogenetic relationship amongst ZIP transporters, their distribution, or their origin. Here we employed phylogenetic analysis to explore the evolution of ZIP transporters, with a focus on the major human fungal pathogen, Candida albicans. Pan-domain analysis of bacterial, archaeal, fungal, and human proteins revealed a complex relationship amongst the ZIP family members. Here we report (i a eukaryote-wide group of cellular zinc importers, (ii a fungal-specific group of zinc importers having genetic association with the fungal zincophore, and, (iii a pan-kingdom supercluster made up of two distinct subgroups with orthologues in bacterial, archaeal, and eukaryotic phyla.
Targeting the HER family with Pan-HER effectively overcomes resistance to cetuximab
Iida, Mari; Bahrar, Harsh; Brand, Toni M; Pearson, Hannah E; Coan, John P; Orbuch, Rachel A; Flanigan, Bailey G; Swick, Adam D; Prabakaran, Prashanth; Lantto, Johan; Horak, Ivan D.; Kragh, Michael; Salgia, Ravi; Kimple, Randy J; Wheeler, Deric L
2016-01-01
Cetuximab, an antibody against the Epidermal Growth Factor Receptor (EGFR) has shown efficacy in treating head and neck squamous cell carcinoma (HNSCC), metastatic colorectal cancer and non-small cell lung cancer (NSCLC). Despite the clinical success of cetuximab, many patients do not respond to cetuximab. Furthermore, virtually all patients who do initially respond become refractory, highlighting both intrinsic and acquired resistance to cetuximab as significant clinical problems. To understand mechanistically how cancerous cells acquire resistance, we previously developed models of acquired resistance using the H226 NSCLC and UM-SCC1 HNSCC cell lines. Cetuximab-resistant clones showed a robust upregulation and dependency on the HER family receptors EGFR, HER2 and HER3. Here, we examined Pan-HER, a mixture of six antibodies targeting these receptors on cetuximab-resistant clones. In cells exhibiting acquired or intrinsic resistance to cetuximab, Pan-HER treatment decreased all three receptors’ protein levels and down-stream activation of AKT and MAPK. This correlated with decreased cell proliferation in cetuximab-resistant clones. To determine whether Pan-HER had a therapeutic benefit in vivo, we established de novo cetuximab-resistant mouse xenografts and treated resistant tumors with Pan-HER. This regimen resulted in a superior growth delay of cetuximab-resistant xenografts compared to mice continued on cetuximab. Furthermore, intrinsically cetuximab-resistant HNSCC patient-derived xenograft tumors treated with Pan-HER exhibited significant growth delay compared to vehicle/cetuximab controls. These results suggest that targeting HER family receptors simultaneously with Pan-HER is a promising treatment strategy for tumors displaying intrinsic or acquired resistance to cetuximab. PMID:27422810
PanFP: pangenome-based functional profiles for microbial communities.
Jun, Se-Ran; Robeson, Michael S; Hauser, Loren J; Schadt, Christopher W; Gorin, Andrey A
2015-09-26
For decades there has been increasing interest in understanding the relationships between microbial communities and ecosystem functions. Current DNA sequencing technologies allows for the exploration of microbial communities in two principle ways: targeted rRNA gene surveys and shotgun metagenomics. For large study designs, it is often still prohibitively expensive to sequence metagenomes at both the breadth and depth necessary to statistically capture the true functional diversity of a community. Although rRNA gene surveys provide no direct evidence of function, they do provide a reasonable estimation of microbial diversity, while being a very cost-effective way to screen samples of interest for later shotgun metagenomic analyses. However, there is a great deal of 16S rRNA gene survey data currently available from diverse environments, and thus a need for tools to infer functional composition of environmental samples based on 16S rRNA gene survey data. We present a computational method called pangenome-based functional profiles (PanFP), which infers functional profiles of microbial communities from 16S rRNA gene survey data for Bacteria and Archaea. PanFP is based on pangenome reconstruction of a 16S rRNA gene operational taxonomic unit (OTU) from known genes and genomes pooled from the OTU's taxonomic lineage. From this lineage, we derive an OTU functional profile by weighting a pangenome's functional profile with the OTUs abundance observed in a given sample. We validated our method by comparing PanFP to the functional profiles obtained from the direct shotgun metagenomic measurement of 65 diverse communities via Spearman correlation coefficients. These correlations improved with increasing sequencing depth, within the range of 0.8-0.9 for the most deeply sequenced Human Microbiome Project mock community samples. PanFP is very similar in performance to another recently released tool, PICRUSt, for almost all of survey data analysed here. But, our method is unique
Isotopic composition of atmospheric moisture from pan water evaporation measurements.
Devi, Pooja; Jain, Ashok Kumar; Rao, M Someshwer; Kumar, Bhishm
2015-01-01
A continuous and reliable time series data of the stable isotopic composition of atmospheric moisture is an important requirement for the wider applicability of isotope mass balance methods in atmospheric and water balance studies. This requires routine sampling of atmospheric moisture by an appropriate technique and analysis of moisture for its isotopic composition. We have, therefore, used a much simpler method based on an isotope mass balance approach to derive the isotopic composition of atmospheric moisture using a class-A drying evaporation pan. We have carried out the study by collecting water samples from a class-A drying evaporation pan and also by collecting atmospheric moisture using the cryogenic trap method at the National Institute of Hydrology, Roorkee, India, during a pre-monsoon period. We compared the isotopic composition of atmospheric moisture obtained by using the class-A drying evaporation pan method with the cryogenic trap method. The results obtained from the evaporation pan water compare well with the cryogenic based method. Thus, the study establishes a cost-effective means of maintaining time series data of the isotopic composition of atmospheric moisture at meteorological observatories. The conclusions drawn in the present study are based on experiments conducted at Roorkee, India, and may be examined at other regions for its general applicability.
CanWEA Pan-Canadian wind integration study paper
Energy Technology Data Exchange (ETDEWEB)
Tremblay, Martin [GL Garrad Hassan Canada Inc, Ottawa, ON (Canada); Gardner, Paul [GL Garrad Hassan and Partners, Glasgow (United Kingdom); Price, Doug; Le, Don [GL Garrad Hassan America, San Diego, CA (United States)
2010-07-01
GL Garrad Hassan has been contracted by CanWEA to undertake a scoping study for a future Pan-Canadian Wide-Scale Wind Integration Study. The scoping study provides the methodology and the rationale on which the actual wind integration study and request for proposals will be based on. Major system operators and owners of each Canadian Province along with experts involved in major US wind integration studies have been consulted and contributed to the decisional process. This paper provides a summary of the factors considered in the study and outline the actual methodology that was adopted for the future Pan-Canadian wind integration study. (orig.)
EUPAN enables pan-genome studies of a large number of eukaryotic genomes.
Hu, Zhiqiang; Sun, Chen; Lu, Kuang-Chen; Chu, Xixia; Zhao, Yue; Lu, Jinyuan; Shi, Jianxin; Wei, Chaochun
2017-08-01
Pan-genome analyses are routinely carried out for bacteria to interpret the within-species gene presence/absence variations (PAVs). However, pan-genome analyses are rare for eukaryotes due to the large sizes and higher complexities of their genomes. Here we proposed EUPAN, a eukaryotic pan-genome analysis toolkit, enabling automatic large-scale eukaryotic pan-genome analyses and detection of gene PAVs at a relatively low sequencing depth. In the previous studies, we demonstrated the effectiveness and high accuracy of EUPAN in the pan-genome analysis of 453 rice genomes, in which we also revealed widespread gene PAVs among individual rice genomes. Moreover, EUPAN can be directly applied to the current re-sequencing projects primarily focusing on single nucleotide polymorphisms. EUPAN is implemented in Perl, R and C ++. It is supported under Linux and preferred for a computer cluster with LSF and SLURM job scheduling system. EUPAN together with its standard operating procedure (SOP) is freely available for non-commercial use (CC BY-NC 4.0) at http://cgm.sjtu.edu.cn/eupan/index.html . ccwei@sjtu.edu.cn or jianxin.shi@sjtu.edu.cn. Supplementary data are available at Bioinformatics online. © The Author (2017). Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com
Form gene clustering method about pan-ethnic-group products based on emotional semantic
Chen, Dengkai; Ding, Jingjing; Gao, Minzhuo; Ma, Danping; Liu, Donghui
2016-09-01
The use of pan-ethnic-group products form knowledge primarily depends on a designer's subjective experience without user participation. The majority of studies primarily focus on the detection of the perceptual demands of consumers from the target product category. A pan-ethnic-group products form gene clustering method based on emotional semantic is constructed. Consumers' perceptual images of the pan-ethnic-group products are obtained by means of product form gene extraction and coding and computer aided product form clustering technology. A case of form gene clustering about the typical pan-ethnic-group products is investigated which indicates that the method is feasible. This paper opens up a new direction for the future development of product form design which improves the agility of product design process in the era of Industry 4.0.
A Portable Burn Pan for the Disposal of Excess Propellants
2016-06-01
2013 - 06/01/2016 A Portable Burn Pan for the Disposal of Excess Propellants Michael Walsh USA CRREL USA CRREL 72 Lyme Road Hanover, NH 03755...Army Alaska XRF X-Ray Florescence vii ACKNOWLEDGEMENTS Project ER-201323, A Portable Burn Pan for the Disposal of Gun Propellants, was a very...contamination problem while allowing troops to train as they fight, we have developed a portable training device for burning excess gun propellants. 1.1
Völter, Christoph J; Call, Josep
2014-05-01
Whether nonhuman primates understand causal relations beyond mere associations is still a matter of debate. We presented all four species of nonhuman great apes (N = 36) with a choice between 2 opaque, upside down cups after displacing them out of sight from their starting positions. Crucially, 1 of them had left a yogurt trail behind it. Great apes spontaneously used the trail to select the yogurt baited cup. Follow-up experiments demonstrated that chimpanzees distinguished trails based on the temporal order of cause and effect by ignoring trails that were already present before the reward was hidden. Additionally, chimpanzees did not select cups based on the amount of yogurt near them but instead preferred cups that signaled the endpoint of the trail. We conclude that apes' choices reveal sensitivity to a causal relation between cause (reward) and effect (trail) including their temporal order. ©2014 APA, all rights reserved.
The Rise of Pan-Islamism in Britain
National Research Council Canada - National Science Library
Shepard, Scott
2006-01-01
.... This thesis explains what is fueling the rise of pan-Islamism in Britain. For many Muslims, their religious identity is stronger than their British identity because they are alienated from the rest of society...
Energy Technology Data Exchange (ETDEWEB)
Gray, E
1968-12-16
Muskeg Oil Co., wholly-owned subsidiary of Pan American Canada Oil Co. Ltd., hopes to expand its proposed initial 8,000 bpd in situ Athabasca tar sand production scheme to an ultimate rate of 60,000 bpd. The Muskeg recovery process involves an in situ combustion technique developed by Pan American and applied successfully in experimental work in the Athabasca area. The underground burning process develops heat in the formation, reduces crude bitumen viscosity, and displaces the bitumen to the producing wells. Core analyses have been used to determine bitumen in place, wherever possible. Values for uncored wells were based on logs, through development of an empirical relationship between formation resistivity measured by focused logging devices and bitumen content determined by core analysis. The proposed recovery process is a 10-acre well spacing with 9-spot configuration. The McMurray Formation will be fractured hydraulically and preheated by a combustion process. The bitumen will be recovered by a combustion displacement process utilizing air and water.
Simplified pilot module development and testing within the ATLAS PanDA Pilot 2.0 Project
Drizhuk, Daniil; The ATLAS collaboration; Nilsson, Paul
2016-01-01
The Production and Distributed Analysis (PanDA) system has been developed to meet ATLAS production and analysis requirements for a data-driven workload management system capable of operating at the LHC data processing scale. The PanDA pilot is one of the major components in the PanDA system. It runs on a worker node and takes care of setting up the environment, fetching and pushing data to storage, getting jobs from the PanDA server and executing them. The original PanDA Pilot was designed over 10 years ago and has since then grown organically. Large parts of the original pilot code base are now getting old and are difficult to maintain. Incremental changes and refactoring have been pushed to the limit, and the time is now right for a fresh start, informed by a decade of experience, with the PanDA Pilot 2.0 Project. To create a testing environment for module development and automated unit and functional testing for next generation pilot tasks, a simple pilot version was developed. It resembles the basic workf...
File list: Unc.Pan.50.AllAg.Pancreatic_cancer_cells [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Unc.Pan.50.AllAg.Pancreatic_cancer_cells mm9 Unclassified Pancreas Pancreatic cancer... cells http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.Pan.50.AllAg.Pancreatic_cancer_cells.bed ...
International Nuclear Information System (INIS)
Sebesta, F.; John, J.; Motl, A.; Stamberg, K.
1995-11-01
The chemical and radiation stability of polyacrylonitrile (PAN) in the form of beads (B-PAN), similar to the beads of composite absorbers, and one selected composite absorber (ammonium molybdophosphate, the active component in PAN binder [AMP-PAN], a prospective candidate for the treatment of acidic wastes) were studied. Aqueous 1M HNO 3 + 1M NaNO 3 , 1M NaOH + 1M NaNO 3 , and 1M NaOH were chosen as simulants of DOE acidic and alkaline wastes. In addition,radiation stability was determined indistilled water. The chemical stability of B-PAN and AMP-PAN beads was tested for a period up to one month of contact with the solution at ambient temperature. The radiation stability of the beads was checked in a radiation dose range 10 3 --10 6 Gy (10 5 --10 8 rads). In acidic solutions the stability of PAN binder was proved not to be limited by either chemical or radiation decomposition. PAN binder may thus be used for preparing composite absorbers for treatment of acid wastes from DOE facilities. The same conclusion is valid for alkaline solutions with pH up to 13. In highly alkaline solutions (concentration of NAOH higher than I M) and in the presence of NaNO 3 , the stability of the tested polyacrylonitrile polymer was sufficient for applications not extending over 10 days. Cross-linking of the polymer caused by ionizing radiation was found to have a positive influence on chemical stability. This effect enables a longer period of applicability of PAN-based composite absorbers. Because of the high sorption rate achievable with PAN-based absorbers, the stability achieved is sufficient for most applications in the DOE complex. The chemical stability of binding polymer may also be further improved by testing another, more suitable type of polymer from the broad family of polyacrylonitrile polymers
File list: His.Pan.20.AllAg.PANC-1 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available His.Pan.20.AllAg.PANC-1 hg19 Histone Pancreas PANC-1 SRX825369,SRX101484,SRX101485,...SRX825383,SRX152077,SRX190044,SRX825376,SRX825390 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.Pan.20.AllAg.PANC-1.bed ...
File list: His.Pan.05.AllAg.PANC-1 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available His.Pan.05.AllAg.PANC-1 hg19 Histone Pancreas PANC-1 SRX825369,SRX101484,SRX101485,...SRX152077,SRX825383,SRX825376,SRX190044,SRX825390 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.Pan.05.AllAg.PANC-1.bed ...
File list: His.Pan.10.AllAg.PANC-1 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available His.Pan.10.AllAg.PANC-1 hg19 Histone Pancreas PANC-1 SRX825369,SRX101484,SRX101485,...SRX825383,SRX152077,SRX190044,SRX825376,SRX825390 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.Pan.10.AllAg.PANC-1.bed ...
File list: His.Pan.50.AllAg.PANC-1 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available His.Pan.50.AllAg.PANC-1 hg19 Histone Pancreas PANC-1 SRX825369,SRX101484,SRX825383,...SRX152077,SRX190044,SRX825390,SRX825376,SRX101485 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.Pan.50.AllAg.PANC-1.bed ...
Characterization of probiotic Escherichia coli isolates with a novel pan-genome microarray
DEFF Research Database (Denmark)
Willenbrock, Hanni; Hallin, Peter Fischer; Wassenaar, Trudy
2007-01-01
of the same species are rapidly becoming available, allowing for the definition and characterization of a whole species as a population of genomes - the 'pan-genome'. Results: Using 32 Escherichia coli and Shigella genome sequences we estimate the pan- and core genome of the species. We designed a high...
Michael T. Hobbins; Jorge A. Ramirez; Thomas C. Brown
2004-01-01
Pan evaporation (ETpan) has decreased at 64% of pans in the conterminous U.S. over the past half-century. Comparing trends in ETpan and water budget-derived actual evapotranspiration (ET*a), we observe the so-called ââPan Evaporation Paradox,ââ which we confirm is no more than a...
File list: His.Pan.20.AllAg.Pancreatic_cancer_cells [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available His.Pan.20.AllAg.Pancreatic_cancer_cells mm9 Histone Pancreas Pancreatic cancer cel...ls http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Pan.20.AllAg.Pancreatic_cancer_cells.bed ...
File list: His.Pan.10.AllAg.Pancreatic_cancer_cells [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available His.Pan.10.AllAg.Pancreatic_cancer_cells mm9 Histone Pancreas Pancreatic cancer cel...ls http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Pan.10.AllAg.Pancreatic_cancer_cells.bed ...
File list: Pol.Pan.50.AllAg.Pancreatic_cancer_cells [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Pol.Pan.50.AllAg.Pancreatic_cancer_cells mm9 RNA polymerase Pancreas Pancreatic cancer... cells http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Pol.Pan.50.AllAg.Pancreatic_cancer_cells.bed ...
File list: His.Pan.50.AllAg.Pancreatic_cancer_cells [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available His.Pan.50.AllAg.Pancreatic_cancer_cells mm9 Histone Pancreas Pancreatic cancer cel...ls http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Pan.50.AllAg.Pancreatic_cancer_cells.bed ...
Activated carbon fiber obtained from textile PAN fiber to electrodes for supercapacitor
International Nuclear Information System (INIS)
Silva, Elen Leal da; Marcuzzo, Jossano Saldanha; Baldan, Mauricio Ribeiro; Cuna, Andres; Rodrigues, Aline Castilho; Goncalves, Emerson Sarmento
2016-01-01
Full text: Supercapacitors are devices for electrical energy storage with application in distribution power generation, electric vehicles, electronic equipment, among others. Current challenges in the development of supercapacitors focuses on making an increasing on system density of energy. An increase of energy accumulated in the supercapacitor electrode can be achieved by developing materials with high specific electrical capacitance and low electrical resistance. Furthermore, it is expected that the electrode material present a simple procedure for obtaining, low cost and environmentally friendly. Carbon fibers are interesting materials for use as a supercapacitor electrode. Among them are carbon fibers from polyacrylonitrile (PAN). In this work were studied activated carbon fibers obtained from textile polyacrylonitrile (ACF-PAN) with deposition of Fe particles aiming to use as active material of supercapacitor electrodes. ACFPAN and ACF-PAN-Fe were characterized by textural analysis, x-ray diffraction (XRD), scanning electron microscopy equipped with energy dispersive x-ray (SEM-EDX), Raman spectroscopy and x-ray photoelectron spectroscopy (XPS). The behavior of the activated carbon fibers as a supercapacitor electrode was evaluated by galvanostatic charge and discharge curves, cyclic voltammetry and a electrochemical impedance using a symmetrical two-electrode Swagelok®-type cell and sulfuric acid as electrolyte. ACF-PAN had a high specific surface area, which makes it an interesting material for electrodes of supercapacitors. The electrical capacitance for the ACF-PAN is 96 F/g and ACF-PAN-Fe is 106 F/g both at a current density of 0.30 A/g. This increase in electrical capacitance can be related to the presence of iron oxides which are deposited on the activated carbon fiber. (author)
File list: Pol.Pan.05.RNA_polymerase_III.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Pol.Pan.05.RNA_polymerase_III.AllCell hg19 RNA polymerase RNA polymerase III Pancre...as http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.Pan.05.RNA_polymerase_III.AllCell.bed ...
File list: Pol.Pan.10.RNA_Polymerase_III.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Pol.Pan.10.RNA_Polymerase_III.AllCell mm9 RNA polymerase RNA Polymerase III Pancrea...s http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Pol.Pan.10.RNA_Polymerase_III.AllCell.bed ...
File list: DNS.Pan.20.AllAg.Pancreatic_cancer_cells [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available DNS.Pan.20.AllAg.Pancreatic_cancer_cells mm9 DNase-seq Pancreas Pancreatic cancer c...ells http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/DNS.Pan.20.AllAg.Pancreatic_cancer_cells.bed ...
File list: Pol.Pan.10.RNA_polymerase_III.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Pol.Pan.10.RNA_polymerase_III.AllCell hg19 RNA polymerase RNA polymerase III Pancre...as http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.Pan.10.RNA_polymerase_III.AllCell.bed ...
An electronic pan/tilt/magnify and rotate camera system
International Nuclear Information System (INIS)
Zimmermann, S.; Martin, H.L.
1992-01-01
A new camera system has been developed for omnidirectional image-viewing applications that provides pan, tilt, magnify, and rotational orientation within a hemispherical field of view (FOV) without any moving parts. The imaging device is based on the fact that the image from a fish-eye lens, which produces a circular image of an entire hemispherical FOV, can be mathematically corrected using high-speed electronic circuitry. More specifically, an incoming fish-eye image from any image acquisition source is captured in the memory of the device, a transformation is performed for the viewing region of interest and viewing direction, and a corrected image is output as a video image signal for viewing, recording, or analysis. The image transformation device can provide corrected images at frame rates compatible with RS-170 standard video equipment. As a result, this device can accomplish the functions of pan, tilt, rotation, and magnification throughout a hemispherical FOV without the need for any mechanical devices. Multiple images, each with different image magnifications and pan-tilt-rotate parameters, can be obtained from a single camera
Properties and Structure of In Situ Transformed PAN-Based Carbon Fibers
Directory of Open Access Journals (Sweden)
Jingjing Cao
2018-06-01
Full Text Available Carbon fibers in situ prepared during the hot-pressed sintering in a vacuum is termed in situ transformed polyacrylonitrile-based (PAN-based carbon fibers, and the fibrous precursors are the pre-oxidized PAN fibers. The properties and structure of in situ transformed PAN-based carbon fibers are investigated by Nano indenter, SEM, TEM, XRD, and Raman. The results showed that the microstructure of the fiber surface layer was compact, while the core was loose, with evenly-appearing microvoids. The elastic modulus and nanohardness of the fiber surface layer (303.87 GPa and 14.82 GPa were much higher than that of the core (16.57 GPa and 1.54 GPa, and its interlayer spacing d002 and crystallinity were about 0.347 nm and 0.97 respectively. It was found that the preferred orientation of the surface carbon layers with ordered carbon atomic arrangement tended to be parallel to the fiber axis, whereas the fiber core in the amorphous region exhibited a random texture and the carbon atomic arrangement was in a disordered state. It indicates that the in situ transformed PAN-based carbon fibers possess significantly turbostratic structure and anisotropy.
File list: ALL.Pan.50.AllAg.PANC-1 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available ALL.Pan.50.AllAg.PANC-1 hg19 All antigens Pancreas PANC-1 SRX825369,SRX101484,SRX19...29,SRX190252,SRX825390,SRX644404,SRX825376,SRX101485 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.Pan.50.AllAg.PANC-1.bed ...
File list: ALL.Pan.20.AllAg.PANC-1 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available ALL.Pan.20.AllAg.PANC-1 hg19 All antigens Pancreas PANC-1 SRX825369,SRX101484,SRX19...12,SRX644404,SRX825376,SRX199860,SRX190029,SRX825390 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.Pan.20.AllAg.PANC-1.bed ...
File list: ALL.Pan.10.AllAg.PANC-1 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available ALL.Pan.10.AllAg.PANC-1 hg19 All antigens Pancreas PANC-1 SRX825369,SRX101484,SRX19...44,SRX190248,SRX199860,SRX190029,SRX825376,SRX825390 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.Pan.10.AllAg.PANC-1.bed ...
File list: Pol.Pan.10.RNA_polymerase_II.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Pol.Pan.10.RNA_polymerase_II.AllCell hg19 RNA polymerase RNA polymerase II Pancreas... SRX190244 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.Pan.10.RNA_polymerase_II.AllCell.bed ...
File list: Pol.Pan.50.RNA_polymerase_II.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Pol.Pan.50.RNA_polymerase_II.AllCell hg19 RNA polymerase RNA polymerase II Pancreas... SRX190244 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.Pan.50.RNA_polymerase_II.AllCell.bed ...
File list: Pol.Pan.05.RNA_polymerase_II.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Pol.Pan.05.RNA_polymerase_II.AllCell hg19 RNA polymerase RNA polymerase II Pancreas... SRX190244 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.Pan.05.RNA_polymerase_II.AllCell.bed ...
Development of pan-Arctic database for river chemistry
McClelland, J.W.; Holmes, R.M.; Peterson, B.J.; Amon, R.; Brabets, T.; Cooper, L.; Gibson, J.; Gordeev, V.V.; Guay, C.; Milburn, D.; Staples, R.; Raymond, P.A.; Shiklomanov, I.; Striegl, Robert G.; Zhulidov, A.; Gurtovaya, T.; Zimov, S.
2008-01-01
More than 10% of all continental runoff flows into the Arctic Ocean. This runoff is a dominant feature of the Arctic Ocean with respect to water column structure and circulation. Yet understanding of the chemical characteristics of runoff from the pan-Arctic watershed is surprisingly limited. The Pan- Arctic River Transport of Nutrients, Organic Matter, and Suspended Sediments ( PARTNERS) project was initiated in 2002 to help remedy this deficit, and an extraordinary data set has emerged over the past few years as a result of the effort. This data set is publicly available through the Cooperative Arctic Data and Information Service (CADIS) of the Arctic Observing Network (AON). Details about data access are provided below.
PAN-DA and beyond: Data acquisition for the next generation experiments
International Nuclear Information System (INIS)
Pordes, R.; Anderson, J.; Berg, D.; Berman, E.; Brown, D.; Dorries, T.; Mackinnon, B.; Meadows, J.; Moore, C.; Nicinski, T.; Oleynik, G.; Petravick, D.; Rechenmacher, R.; Sergey, G.; Slimmer, D.; Streets, J.; Vittone, M.; Votava, M.; Wilcer, N.; White, V.
1991-06-01
We report on the status of the PAN-DA data acquisition system presented at the last Real Time Conference. Since that time, PAN-DA has been successfully used in the fixed target program at Fermilab. We also report on the plans and strategies for development of a new data acquisition system for the next generation of fixed target experiments at Fermilab. 10 refs., 3 figs
Li, Meng; Chu, Ronghao; Shen, Shuanghe; Islam, Abu Reza Md Towfiqul
2018-06-01
Pan evaporation (E pan ), which we examine in this study to better understand atmospheric evaporation demand, represents a pivotal indicator of the terrestrial ecosystem and hydrological cycle, particularly in the Huai River Basin (HRB) in eastern China, where high potential risks of drought and flooding are commonly observed. In this study, we examine the spatiotemporal trend patterns of climatic factors and E pan by using the Mann-Kendall test and the Theil-Sen estimator based on a daily meteorological dataset from 89 weather stations during 1965-2013 in the HRB. Furthermore, the PenPan model is employed to estimate E pan at a monthly time scale, and a differential equation method is applied to quantify contributions from four meteorological variables to E pan trends. The results show that E pan significantly decreased (P<0.001) at an average rate of -8.119mm·a -2 at annual time scale in the whole HRB, with approximately 90% of stations occupied. Meanwhile, the generally higher E pan values were detected in the northern HRB. The values of the aerodynamic components in the PenPan model were much greater than those of the radiative components, which were responsible for the variations in the E pan trend. The significantly decreasing wind speed (u 2 ) was the most dominant factor that controlled the decreasing E pan trend at each time scale, followed by the notable decreasing net radiation (R n ) at the annual time scale also in growing season and summer. However, the second dominant factor shifted to the mean temperature (T a ) during the spring and winter and the vapor pressure deficit (vpd) during the autumn. These phenomena demonstrated a positive link between the significance of climate variables and their control over the E pan trend. Copyright © 2017 Elsevier B.V. All rights reserved.
Kaburu, Stefano S K; Newton-Fisher, Nicholas E
2015-06-01
Across taxa, males employ a variety of mating strategies, including sexual coercion and the provision, or trading, of resources. Biological market theory (BMT) predicts that trading of commodities for mating opportunities should exist only when males cannot monopolize access to females and/or obtain mating by force, in situations where power differentials between males are low; both coercion and trading have been reported for chimpanzees ( Pan troglodytes ). Here, we investigate whether the choice of strategy depends on the variation in male power differentials, using data from two wild communities of East African chimpanzees ( Pan troglodytes schweinfurthii ): the structurally despotic Sonso community (Budongo, Uganda) and the structurally egalitarian M-group (Mahale, Tanzania). We found evidence of sexual coercion by male Sonso chimpanzees, and of trading-of grooming for mating-by M-group males; females traded sex for neither meat nor protection from male aggression. Our results suggest that the despotism-egalitarian axis influences strategy choice: male chimpanzees appear to pursue sexual coercion when power differentials are large and trading when power differentials are small and coercion consequently ineffective. Our findings demonstrate that trading and coercive strategies are not restricted to particular chimpanzee subspecies; instead, their occurrence is consistent with BMT predictions. Our study raises interesting, and as yet unanswered, questions regarding female chimpanzees' willingness to trade sex for grooming, if doing so represents a compromise to their fundamentally promiscuous mating strategy. It highlights the importance of within-species cross-group comparisons and the need for further study of the relationship between mating strategy and dominance steepness.
ATLAS WORLD-cloud and networking in PanDA
Barreiro Megino, F.; De, K.; Di Girolamo, A.; Maeno, T.; Walker, R.; ATLAS Collaboration
2017-10-01
The ATLAS computing model was originally designed as static clouds (usually national or geographical groupings of sites) around the Tier 1 centres, which confined tasks and most of the data traffic. Since those early days, the sites’ network bandwidth has increased at 0(1000) and the difference in functionalities between Tier 1s and Tier 2s has reduced. After years of manual, intermediate solutions, we have now ramped up to full usage of World-cloud, the latest step in the PanDA Workload Management System to increase resource utilization on the ATLAS Grid, for all workflows (MC production, data (re)processing, etc.). We have based the development on two new site concepts. Nuclei sites are the Tier 1s and large Tier 2s, where tasks will be assigned and the output aggregated, and satellites are the sites that will execute the jobs and send the output to their nucleus. PanDA dynamically pairs nuclei and satellite sites for each task based on the input data availability, capability matching, site load and network connectivity. This contribution will introduce the conceptual changes for World-cloud, the development necessary in PanDA, an insight into the network model and the first half-year of operational experience.
File list: ALL.Pan.05.AllAg.Pancreatic_cancer_cells [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available ALL.Pan.05.AllAg.Pancreatic_cancer_cells mm9 All antigens Pancreas Pancreatic cancer... cells SRX174586,SRX174585,SRX174587 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Pan.05.AllAg.Pancreatic_cancer_cells.bed ...
File list: Oth.Pan.20.AllAg.Pancreatic_cancer_cells [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.Pan.20.AllAg.Pancreatic_cancer_cells mm9 TFs and others Pancreas Pancreatic cancer... cells SRX174585,SRX174586 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.Pan.20.AllAg.Pancreatic_cancer_cells.bed ...
File list: Oth.Pan.05.AllAg.Pancreatic_cancer_cells [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.Pan.05.AllAg.Pancreatic_cancer_cells mm9 TFs and others Pancreas Pancreatic cancer... cells SRX174586,SRX174585 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.Pan.05.AllAg.Pancreatic_cancer_cells.bed ...
File list: ALL.Pan.50.AllAg.Pancreatic_cancer_cells [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available ALL.Pan.50.AllAg.Pancreatic_cancer_cells mm9 All antigens Pancreas Pancreatic cancer... cells SRX174585,SRX174586,SRX174587 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Pan.50.AllAg.Pancreatic_cancer_cells.bed ...
Integration of PanDA workload management system with Titan supercomputer at OLCF
De, K.; Klimentov, A.; Oleynik, D.; Panitkin, S.; Petrosyan, A.; Schovancova, J.; Vaniachine, A.; Wenaus, T.
2015-12-01
The PanDA (Production and Distributed Analysis) workload management system (WMS) was developed to meet the scale and complexity of LHC distributed computing for the ATLAS experiment. While PanDA currently distributes jobs to more than 100,000 cores at well over 100 Grid sites, the future LHC data taking runs will require more resources than Grid computing can possibly provide. To alleviate these challenges, ATLAS is engaged in an ambitious program to expand the current computing model to include additional resources such as the opportunistic use of supercomputers. We will describe a project aimed at integration of PanDA WMS with Titan supercomputer at Oak Ridge Leadership Computing Facility (OLCF). The current approach utilizes a modified PanDA pilot framework for job submission to Titan's batch queues and local data management, with light-weight MPI wrappers to run single threaded workloads in parallel on Titan's multicore worker nodes. It also gives PanDA new capability to collect, in real time, information about unused worker nodes on Titan, which allows precise definition of the size and duration of jobs submitted to Titan according to available free resources. This capability significantly reduces PanDA job wait time while improving Titan's utilization efficiency. This implementation was tested with a variety of Monte-Carlo workloads on Titan and is being tested on several other supercomputing platforms. Notice: This manuscript has been authored, by employees of Brookhaven Science Associates, LLC under Contract No. DE-AC02-98CH10886 with the U.S. Department of Energy. The publisher by accepting the manuscript for publication acknowledges that the United States Government retains a non-exclusive, paid-up, irrevocable, world-wide license to publish or reproduce the published form of this manuscript, or allow others to do so, for United States Government purposes.
Bioenergy and biodiversity: Key lessons from the Pan American region
Energy Technology Data Exchange (ETDEWEB)
Kline, Keith L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Martinelli, Fernanda Silva [UFRRJ/Conservation International Brazil, Seropedica (Brazil); Mayer, Audrey L. [Michigan Technological Univ., Houghton, MI (United States); Medeiros, Rodrigo [Federal Rural Univ. of Rio de Janeiro, Rio de Janeiro (Brazil); Oliveira, Camila Ortolan F. [Univ. of Campinas, Campinas (Brazil); Sparovek, Gerd [Univ. of Sao Paulo, Piracicaba (Brazil); Walter, Arnaldo [Univ. of Campinas, Campinas (Brazil); Venier, Lisa A. [Canadian Forest Service, Sault Ste. Marie (Canada). Great Lakes Forestry Centre
2015-06-24
Understanding how large-scale bioenergy production can affect biodiversity and ecosystems is important if society is to meet current and future sustainable development goals. A variety of bioenergy production systems have been established within different contexts throughout the Pan American region, with wide-ranging results in terms of documented and projected effects on biodiversity and ecosystems. The Pan American region is home to the majority of commercial bioenergy production and therefore the region offers a broad set of experiences and insights on both conflicts and opportunities for biodiversity and bioenergy. This paper synthesizes lessons learned focusing on experiences in Canada, the United States, and Brazil, regarding the conflicts that can arise between bioenergy production and ecological conservation, and benefits that can be derived when bioenergy policies promote planning and more sustainable land management systems. Lastly, we propose a research agenda to address priority information gaps that are relevant to biodiversity concerns and related policy challenges in the Pan American region.
Using Of Learning Vector Quantization Network for Pan Evaporation Estimation
Directory of Open Access Journals (Sweden)
Kamil7 A. Abdulmohsen
2013-05-01
Full Text Available A modern technique is presented to study the evaporation process which is considered as an important component of the hydrological cycle. The Pan Evaporation depth is estimated depending upon four metrological factors viz. (temperature, relative humidity, sunshine, and wind speed. Unsupervised Artificial Neural Network has been proposed to accomplish the study goal, specifically, a type called Linear Vector Quantitization, (LVQ. A step by step method is used to cope with difficulties that usually associated with computation procedures inherent in these kind of networks. Such systematic approach may close the gap between the hesitation of the user to make use of the capabilities of these type of neural networks and the relative complexity involving the computations procedures. The results reveal the possibility of using LVQ for of Pan Evaporation depth estimation where a good agreement has been noticed between the outputs of the proposed network and the observed values of the Pan Evaporation depth with a correlation coefficient of 0.986.
PanDA for ATLAS Distributed Computing in the Next Decade
Barreiro Megino, Fernando Harald; The ATLAS collaboration
2016-01-01
The Production and Distributed Analysis (PanDA) system has been developed to meet ATLAS production and analysis requirements for a data-driven workload management system capable of operating at the Large Hadron Collider (LHC) data processing scale. Heterogeneous resources used by the ATLAS experiment are distributed worldwide at hundreds of sites, thousands of physicists analyse the data remotely, the volume of processed data is beyond the exabyte scale, dozens of scientific applications are supported, while data processing requires more than a few billion hours of computing usage per year. PanDA performed very well over the last decade including the LHC Run 1 data taking period. However, it was decided to upgrade the whole system concurrently with the LHC’s first long shutdown in order to cope with rapidly changing computing infrastructure. After two years of reengineering efforts, PanDA has embedded capabilities for fully dynamic and flexible workload management. The static batch job paradigm was discarde...
PanDA for ATLAS distributed computing in the next decade
AUTHOR|(SzGeCERN)643806; The ATLAS collaboration; De, Kaushik; Klimentov, Alexei; Maeno, Tadashi; Nilsson, Paul; Oleynik, Danila; Padolski, Siarhei; Panitkin, Sergey; Wenaus, Torre
2017-01-01
The Production and Distributed Analysis (PanDA) system has been developed to meet ATLAS production and analysis requirements for a data-driven workload management system capable of operating at the Large Hadron Collider (LHC) data processing scale. Heterogeneous resources used by the ATLAS experiment are distributed worldwide at hundreds of sites, thousands of physicists analyse the data remotely, the volume of processed data is beyond the exabyte scale, dozens of scientific applications are supported, while data processing requires more than a few billion hours of computing usage per year. PanDA performed very well over the last decade including the LHC Run 1 data taking period. However, it was decided to upgrade the whole system concurrently with the LHC’s first long shutdown in order to cope with rapidly changing computing infrastructure. After two years of reengineering efforts, PanDA has embedded capabilities for fully dynamic and flexible workload management. The static batch job paradigm was discarde...
Bioenergy and Biodiversity: Key Lessons from the Pan American Region
Kline, Keith L.; Martinelli, Fernanda Silva; Mayer, Audrey L.; Medeiros, Rodrigo; Oliveira, Camila Ortolan F.; Sparovek, Gerd; Walter, Arnaldo; Venier, Lisa A.
2015-12-01
Understanding how large-scale bioenergy production can affect biodiversity and ecosystems is important if society is to meet current and future sustainable development goals. A variety of bioenergy production systems have been established within different contexts throughout the Pan American region, with wide-ranging results in terms of documented and projected effects on biodiversity and ecosystems. The Pan American region is home to the majority of commercial bioenergy production and therefore the region offers a broad set of experiences and insights on both conflicts and opportunities for biodiversity and bioenergy. This paper synthesizes lessons learned focusing on experiences in Canada, the United States, and Brazil regarding the conflicts that can arise between bioenergy production and ecological conservation, and benefits that can be derived when bioenergy policies promote planning and more sustainable land-management systems. We propose a research agenda to address priority information gaps that are relevant to biodiversity concerns and related policy challenges in the Pan American region.
The next generation PanDA Pilot for and beyond the ATLAS experiment
Nilsson, Paul; The ATLAS collaboration
2018-01-01
The Production and Distributed Analysis system (PanDA) is a pilot-based workload management system that was originally designed for the ATLAS Experiment at the LHC to operate on grid sites. Since the coming LHC data taking runs will require more resources than grid computing alone can provide, the various LHC experiments are engaged in an ambitious program to extend the computing model to include opportunistically used resources such as High Performance Computers (HPCs), clouds and volunteer computers. To this end, PanDA is being extended beyond grids and ATLAS to be used on the new types of resources as well as by other experiments. A new key component is being developed, the next generation PanDA Pilot (Pilot 2). Pilot 2 is a complete rewrite of the original PanDA Pilot which has been used in the ATLAS Experiment for over a decade. The new Pilot architecture follows a component-based approach which improves system flexibility, enables a clear workflow control, evolves the system according to modern function...
Phamacognostical Evaluation and Determination of Total Phenols of Paeonia sinjiangensis K. Y. Pan
Directory of Open Access Journals (Sweden)
H. Y. Gong
2012-01-01
Full Text Available Paeonia sinjiangensis K. Y. Pan is a perennial herb belonging to the family Ranunculaceae which is one of the most important crude drugs in traditional Chinese medicine, used as an anti-inflammatory, analgesic and sedative agent. This paper deals with the detailed pharmacognostical evaluation of the crude drug P. sinjiangensis K. Y. Pan. The microscopic, physico-chemical, preliminary physicochemical parameters, total phenols contents presented in this paper may be proposed as parameters to establish the authenticity of P. sinjiangensis K. Y. Pan and can possibly help to differentiate the drug from its other species.
File list: Oth.Pan.20.AllAg.PANC-1 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.Pan.20.AllAg.PANC-1 hg19 TFs and others Pancreas PANC-1 SRX100415,SRX190241,SRX...100942,SRX644410,SRX825399,SRX1026679,SRX1026680,SRX1026681,SRX1026678,SRX190248,SRX190315 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.Pan.20.AllAg.PANC-1.bed ...
File list: Oth.Pan.50.AllAg.PANC-1 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.Pan.50.AllAg.PANC-1 hg19 TFs and others Pancreas PANC-1 SRX100415,SRX825399,SRX...1026679,SRX1026680,SRX1026681,SRX1026678,SRX190315,SRX190248,SRX190241,SRX100942,SRX644410 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.Pan.50.AllAg.PANC-1.bed ...
File list: Oth.Pan.05.AllAg.PANC-1 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.Pan.05.AllAg.PANC-1 hg19 TFs and others Pancreas PANC-1 SRX100942,SRX100415,SRX...190241,SRX190248,SRX190315,SRX644410,SRX825399,SRX1026680,SRX1026679,SRX1026678,SRX1026681 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.Pan.05.AllAg.PANC-1.bed ...
File list: Oth.Pan.10.AllAg.PANC-1 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.Pan.10.AllAg.PANC-1 hg19 TFs and others Pancreas PANC-1 SRX100942,SRX100415,SRX...190241,SRX644410,SRX825399,SRX190315,SRX1026680,SRX1026679,SRX1026681,SRX1026678,SRX190248 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.Pan.10.AllAg.PANC-1.bed ...
NCBI nr-aa BLAST: CBRC-OGAR-01-0927 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OGAR-01-0927 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-HSAP-06-0071 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-06-0071 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-RNOR-08-0291 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-08-0291 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-XTRO-01-3060 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-3060 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-CBRE-01-0003 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CBRE-01-0003 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-FRUB-02-0072 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0072 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-TNIG-14-0037 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TNIG-14-0037 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-TGUT-05-0034 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TGUT-05-0034 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-DNOV-01-2922 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-2922 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-OCUN-01-1054 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OCUN-01-1054 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-EEUR-01-0984 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-EEUR-01-0984 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-GACU-18-0028 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GACU-18-0028 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-MMUS-09-0191 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-09-0191 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-OLAT-24-0056 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OLAT-24-0056 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-SARA-01-1691 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1691 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-FRUB-02-0383 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0383 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-FCAT-01-0104 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FCAT-01-0104 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-ACAR-01-0724 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0724 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-GGAL-03-0036 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-03-0036 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
Dean, M C; Wood, B A
1981-01-01
This study of the developing pongid dentition is based on cross-sectional radiographic data of juvenile Pan troglodytes, Gorilla gorilla, and Pongo pygmaeus skulls. Comparisons with developmental features of the human dentition are made, and possible explanations for the formation of larger teeth within the reduced pongid growth period are discussed. The data presented in this study provide an alternative method for ageing individual pongid crania in comparative cross-sectional growth studies. The advantages of this method are demonstrated by ageing individual Gorilla crania form radiographs and plotting relative dental age against length of the jaw.
NCBI nr-aa BLAST: CBRC-XTRO-01-3489 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-3489 ref|NP_940906.1| progestin and adipoQ receptor family member IX [...Homo sapiens] ref|XP_526335.1| PREDICTED: hypothetical protein [Pan troglodytes] sp|Q6ZVX9|PAQR9_HUMAN Progesti...n and adipoQ receptor family member 9 (Progestin and adipoQ receptor family member IX) dbj|BAC85729.1| un...named protein product [Homo sapiens] gb|AAR08375.1| progestin and adipoQ receptor... family member IX [Homo sapiens] gb|AAI18667.1| Progestin and adipoQ receptor family member IX [Homo sapiens] gb|AAI22528.1| Progesti
NCBI nr-aa BLAST: CBRC-PMAR-01-0530 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PMAR-01-0530 ref|NP_940906.1| progestin and adipoQ receptor family member IX [...Homo sapiens] ref|XP_526335.1| PREDICTED: hypothetical protein [Pan troglodytes] sp|Q6ZVX9|PAQR9_HUMAN Progesti...n and adipoQ receptor family member 9 (Progestin and adipoQ receptor family member IX) dbj|BAC85729.1| un...named protein product [Homo sapiens] gb|AAR08375.1| progestin and adipoQ receptor... family member IX [Homo sapiens] gb|AAI18667.1| Progestin and adipoQ receptor family member IX [Homo sapiens] gb|AAI22528.1| Progesti
NCBI nr-aa BLAST: CBRC-OLAT-26-0036 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OLAT-26-0036 ref|NP_940906.1| progestin and adipoQ receptor family member IX [...Homo sapiens] ref|XP_526335.1| PREDICTED: hypothetical protein [Pan troglodytes] sp|Q6ZVX9|PAQR9_HUMAN Progesti...n and adipoQ receptor family member 9 (Progestin and adipoQ receptor family member IX) dbj|BAC85729.1| un...named protein product [Homo sapiens] gb|AAR08375.1| progestin and adipoQ receptor... family member IX [Homo sapiens] gb|AAI18667.1| Progestin and adipoQ receptor family member IX [Homo sapiens] gb|AAI22528.1| Progesti
NCBI nr-aa BLAST: CBRC-ETEL-01-0817 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ETEL-01-0817 ref|NP_940906.1| progestin and adipoQ receptor family member IX [...Homo sapiens] ref|XP_526335.1| PREDICTED: hypothetical protein [Pan troglodytes] sp|Q6ZVX9|PAQR9_HUMAN Progesti...n and adipoQ receptor family member 9 (Progestin and adipoQ receptor family member IX) dbj|BAC85729.1| un...named protein product [Homo sapiens] gb|AAR08375.1| progestin and adipoQ receptor... family member IX [Homo sapiens] gb|AAI18667.1| Progestin and adipoQ receptor family member IX [Homo sapiens] gb|AAI22528.1| Progesti
NCBI nr-aa BLAST: CBRC-CFAM-23-0010 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CFAM-23-0010 ref|NP_940906.1| progestin and adipoQ receptor family member IX [...Homo sapiens] ref|XP_526335.1| PREDICTED: hypothetical protein [Pan troglodytes] sp|Q6ZVX9|PAQR9_HUMAN Progesti...n and adipoQ receptor family member 9 (Progestin and adipoQ receptor family member IX) dbj|BAC85729.1| un...named protein product [Homo sapiens] gb|AAR08375.1| progestin and adipoQ receptor... family member IX [Homo sapiens] gb|AAI18667.1| Progestin and adipoQ receptor family member IX [Homo sapiens] gb|AAI22528.1| Progesti
NCBI nr-aa BLAST: CBRC-DRER-07-0075 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-07-0075 ref|NP_940906.1| progestin and adipoQ receptor family member IX [...Homo sapiens] ref|XP_526335.1| PREDICTED: hypothetical protein [Pan troglodytes] sp|Q6ZVX9|PAQR9_HUMAN Progesti...n and adipoQ receptor family member 9 (Progestin and adipoQ receptor family member IX) dbj|BAC85729.1| un...named protein product [Homo sapiens] gb|AAR08375.1| progestin and adipoQ receptor... family member IX [Homo sapiens] gb|AAI18667.1| Progestin and adipoQ receptor family member IX [Homo sapiens] gb|AAI22528.1| Progesti
NCBI nr-aa BLAST: CBRC-GACU-23-0054 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GACU-23-0054 ref|NP_940906.1| progestin and adipoQ receptor family member IX [...Homo sapiens] ref|XP_526335.1| PREDICTED: hypothetical protein [Pan troglodytes] sp|Q6ZVX9|PAQR9_HUMAN Progesti...n and adipoQ receptor family member 9 (Progestin and adipoQ receptor family member IX) dbj|BAC85729.1| un...named protein product [Homo sapiens] gb|AAR08375.1| progestin and adipoQ receptor... family member IX [Homo sapiens] gb|AAI18667.1| Progestin and adipoQ receptor family member IX [Homo sapiens] gb|AAI22528.1| Progesti
NCBI nr-aa BLAST: CBRC-TNIG-22-0228 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TNIG-22-0228 ref|NP_940906.1| progestin and adipoQ receptor family member IX [...Homo sapiens] ref|XP_526335.1| PREDICTED: hypothetical protein [Pan troglodytes] sp|Q6ZVX9|PAQR9_HUMAN Progesti...n and adipoQ receptor family member 9 (Progestin and adipoQ receptor family member IX) dbj|BAC85729.1| un...named protein product [Homo sapiens] gb|AAR08375.1| progestin and adipoQ receptor... family member IX [Homo sapiens] gb|AAI18667.1| Progestin and adipoQ receptor family member IX [Homo sapiens] gb|AAI22528.1| Progesti
PERFORMING MANHOOD: GLAHN AND THE MASCULINITY CRISIS IN HAMSUN'S PAN
Directory of Open Access Journals (Sweden)
Chengzhou He
2016-04-01
Full Text Available In Hamsun’s novel Pan, Lieutenant Glahn holds an essentialist notion of masculinity that is somewhat outdated in the context of emerging Norwegian modernity. His acts of violence, which are performative of his male pride, not only bring harm to others, but also become destructive to himself. The masculinity crisis enacted in Pan is put into the context of the social, historical, and cultural changes related to gender and modernity that occurred during the end of the 19th century in Norway and beyond.
Jongman, R.H.G.; Bouwma, I.M.; Doorn, van, A.M.
2006-01-01
The Pan European Ecological Network for Western Europe is the third project in developing the Pan European Ecological Network The objective of the Pan-European Ecological Network is to develop a vision for a coherent network of high value areas for biodiversity, as internationally and nationally protected areas in combination with other suitable habitat areas for long term favourable conservation of Europe’s key ecosystems, habitats and species
Evolution of the ATLAS PanDA Production and Distributed Analysis System
International Nuclear Information System (INIS)
Maeno, T; Wenaus, T; Fine, V; Potekhin, M; Panitkin, S; De, K; Nilsson, P; Stradling, A; Walker, R; Compostella, G
2012-01-01
The PanDA (Production and Distributed Analysis) system has been developed to meet ATLAS production and analysis requirements for a data-driven workload management system capable of operating at LHC data processing scale. PanDA has performed well with high reliability and robustness during the two years of LHC data-taking, while being actively evolved to meet the rapidly changing requirements for analysis use cases. We will present an overview of system evolution including automatic rebrokerage and reattempt for analysis jobs, adaptation for the CernVM File System, support for the multi-cloud model through which Tier-2 sites act as members of multiple clouds, pledged resource management and preferential brokerage, and monitoring improvements. We will also describe results from the analysis of two years of PanDA usage statistics, current issues, and plans for the future.
PanDA Beyond ATLAS : A Scalable Workload Management System For Data Intensive Science
Borodin, M; The ATLAS collaboration; Jha, S; Golubkov, D; Klimentov, A; Maeno, T; Nilsson, P; Oleynik, D; Panitkin, S; Petrosyan, A; Schovancova, J; Vaniachine, A; Wenaus, T
2014-01-01
The LHC experiments are today at the leading edge of large scale distributed data-intensive computational science. The LHC's ATLAS experiment processes data volumes which are particularly extreme, over 140 PB to date, distributed worldwide at over of 120 sites. An important element in the success of the exciting physics results from ATLAS is the highly scalable integrated workflow and dataflow management afforded by the PanDA workload management system, used for all the distributed computing needs of the experiment. The PanDA design is not experiment specific and PanDA is now being extended to support other data intensive scientific applications. PanDA was cited as an example of "a high performance, fault tolerant software for fast, scalable access to data repositories of many kinds" during the "Big Data Research and Development Initiative" announcement, a 200 million USD U.S. government investment in tools to handle huge volumes of digital data needed to spur science and engineering discoveries. In this talk...
Control of Pan-tilt Mechanism Angle using Position Matrix Method
Directory of Open Access Journals (Sweden)
Hendri Maja Saputra
2013-12-01
Full Text Available Control of a Pan-Tilt Mechanism (PTM angle for the bomb disposal robot Morolipi-V2 using inertial sensor measurement unit, x-IMU, has been done. The PTM has to be able to be actively controlled both manually and automatically in order to correct the orientation of the moving Morolipi-V2 platform. The x-IMU detects the platform orientation and sends the result in order to automatically control the PTM. The orientation is calculated using the quaternion combined with Madwick and Mahony filter methods. The orientation data that consists of angles of roll (α, pitch (β, and yaw (γ from the x-IMU are then being sent to the camera for controlling the PTM motion (pan & tilt angles after calculating the reverse angle using position matrix method. Experiment results using Madwick and Mahony methods show that the x-IMU can be used to find the robot platform orientation. Acceleration data from accelerometer and flux from magnetometer produce noise with standard deviation of 0.015 g and 0.006 G, respectively. Maximum absolute errors caused by Madgwick and Mahony method with respect to Xaxis are 48.45º and 33.91º, respectively. The x-IMU implementation as inertia sensor to control the Pan-Tilt Mechanism shows a good result, which the probability of pan angle tends to be the same with yaw and tilt angle equal to the pitch angle, except a very small angle shift due to the influence of roll angle..
File list: InP.Pan.05.Input_control.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.Pan.05.Input_control.AllCell hg19 Input control Input control Pancreas SRX19030...0794,SRX188948,SRX190029,SRX199860,SRX026707,SRX825393 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.Pan.05.Input_control.AllCell.bed ...
File list: InP.Pan.10.Input_control.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.Pan.10.Input_control.AllCell hg19 Input control Input control Pancreas SRX19030...8948,SRX825393,SRX199860,SRX190029,SRX026707,SRX375320 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.Pan.10.Input_control.AllCell.bed ...
File list: InP.Pan.20.Input_control.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.Pan.20.Input_control.AllCell hg19 Input control Input control Pancreas SRX34080...0803,SRX340794,SRX199860,SRX190029,SRX026707,SRX375320 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.Pan.20.Input_control.AllCell.bed ...
Initial Burn Pan (JMTF) Testing Results
2016-03-01
burn pan and one located high on the Ex-USS Shadwell. There were also a number of GoPro cameras (3-4) that were positioned to observe specific...locations around the test area. A remote control drone equipped with a GoPro camera was also used to video the third test. All recorded video and still
International Nuclear Information System (INIS)
Mestres, M.; Schmid, E.; Stephan, G.; Barrios, L.; Caballin, M. R.; Barquinero, J. F.
2004-01-01
The aim of the present study has been the evaluation of the incompleteness of α-particle induced chromosome aberrations by the simultaneous detection of all centromeres and telomeres present in human lymphocytes. For this purpose attached lymphocytes were irradiated at doses of 0.2, 0.5,0.7 and 1 Gy in a ''241Am source. FISH techniques were applied using pan-centromeric and pan-telomeric probes. All abnormal cells were digitalised and analysed using a Cytovision FISH workstation. A total of 378 incomplete chromosomes plus incomplete acentrics was found. Cases with more than 92 telomeres were not detected. The ratio between total incomplete elements and multicentrics was 1.00. The total number of acentric fragments was 822; 57% of then were complete fragments ace (+.+), 26% incomplete fragments ace (+,-), and 17% interstitial fragment ace (-.-). The percentage of incomplete aberrations is higher after high-LET than described for low-LET exposure. The results seem to indicate that compared to low-LET. after α-particle exposure it is more likely to repair the centromere-containing elements. (Author) 30 refs
A Peptide-Fc Opsonin with Pan-Amyloid Reactivity
Directory of Open Access Journals (Sweden)
James S. Foster
2017-09-01
Full Text Available There is a continuing need for therapeutic interventions for patients with the protein misfolding disorders that result in systemic amyloidosis. Recently, specific antibodies have been employed to treat AL amyloidosis by opsonizing tissue amyloid deposits thereby inducing cell-mediated dissolution and organ improvement. To develop a pan-amyloid therapeutic agent, we have produced an Fc-fusion product incorporating a peptide, p5, which binds many if not all forms of amyloid. This protein, designated Fcp5, expressed in mammalian cells, forms the desired bivalent dimer structure and retains pan-amyloid reactivity similar to the p5 peptide as measured by immunosorbent assays, immunohistochemistry, surface plasmon resonance, and pulldown assays using radioiodinated Fcp5. Additionally, Fcp5 was capable of opsonizing amyloid fibrils in vitro using a pH-sensitive fluorescence assay of phagocytosis. In mice,125 I-labeled Fcp5 exhibited an extended serum circulation time, relative to the p5 peptide. It specifically bound AA amyloid deposits in diseased mice, as evidenced by biodistribution and microautoradiographic methods, which coincided with an increase in active, Iba-1-positive macrophages in the liver at 48 h postinjection of Fcp5. In healthy mice, no specific tissue accumulation was observed. The data indicate that polybasic, pan-amyloid-targeting peptides, in the context of an Fc fusion, can yield amyloid reactive, opsonizing reagents that may serve as next-generation immunotherapeutics.
What do PANs Tell us about VOC-NOx Photochemistry in the Urban/Rural Interface?
Roberts, J. M.; Flocke, F. M.; Zheng, W.; Bertman, S.; Marchewka, M.; Williams, E.; Lerner, B.; Kuster, W.; Goldan, P.; Gilman, J.; Sommariva, R.; Trainer, M.; Fehsenfeld, F.
2006-12-01
Peroxycarboxylic Nitric Anhydrides (PANs) are co-products of the VOC-NOx photochemistry that is responsible for O3 and secondary organic aerosol (SOA) formation in the troposphere. The relative abundance of the various PAN type compounds can provide important diagnostic information as to the contribution of different VOC sources to these processes. Anthropogenic, biogenic and petrochemical VOC sources have shown distinct profiles of PAN, PPN, MPAN, PiBN, and APAN, which can be analyzed using simple numerical models and compared to the results of detailed chemical mechanisms. One result of these studies is that the PAN compounds can be used to better define the contribution of isoprene to O3 production in the urban/rural interface. Another result is that high relative concentrations of APAN are characteristic of high petrochemical source impact. In addition, changes in the relative abundance of PPN and PAN can indicate the aging of a continental photochemical plume. This paper will present selected results from five field experiments and modeling studies from the Nashville 1999 Southern Oxidant Study up through the TexAQS 2006 study, in and around Houston, TX.
File list: NoD.Pan.10.AllAg.Pancreatic_cancer_cells [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available NoD.Pan.10.AllAg.Pancreatic_cancer_cells mm9 No description Pancreas Pancreatic cancer... cells http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/NoD.Pan.10.AllAg.Pancreatic_cancer_cells.bed ...
Publishing datasets with eSciDoc and panMetaDocs
Ulbricht, D.; Klump, J.; Bertelmann, R.
2012-04-01
Currently serveral research institutions worldwide undertake considerable efforts to have their scientific datasets published and to syndicate them to data portals as extensively described objects identified by a persistent identifier. This is done to foster the reuse of data, to make scientific work more transparent, and to create a citable entity that can be referenced unambigously in written publications. GFZ Potsdam established a publishing workflow for file based research datasets. Key software components are an eSciDoc infrastructure [1] and multiple instances of the data curation tool panMetaDocs [2]. The eSciDoc repository holds data objects and their associated metadata in container objects, called eSciDoc items. A key metadata element in this context is the publication status of the referenced data set. PanMetaDocs, which is based on PanMetaWorks [3], is a PHP based web application that allows to describe data with any XML-based metadata schema. The metadata fields can be filled with static or dynamic content to reduce the number of fields that require manual entries to a minimum and make use of contextual information in a project setting. Access rights can be applied to set visibility of datasets to other project members and allow collaboration on and notifying about datasets (RSS) and interaction with the internal messaging system, that was inherited from panMetaWorks. When a dataset is to be published, panMetaDocs allows to change the publication status of the eSciDoc item from status "private" to "submitted" and prepare the dataset for verification by an external reviewer. After quality checks, the item publication status can be changed to "published". This makes the data and metadata available through the internet worldwide. PanMetaDocs is developed as an eSciDoc application. It is an easy to use graphical user interface to eSciDoc items, their data and metadata. It is also an application supporting a DOI publication agent during the process of
Directory of Open Access Journals (Sweden)
D. P. Moore
2010-07-01
Full Text Available The Michelson Interferometer for Passive Atmospheric Sounding onboard ENVISAT (MIPAS–E offers the opportunity to detect and spectrally resolve many atmospheric minor constituents affecting atmospheric chemistry. In this paper, we retrieve global, seasonal PAN volume mixing ratio (vmr data from MIPAS-E measurements made in January, March, August and October 2003 and present results from this scheme between approximately 300 and 150 hPa. The total error on a single PAN retrieval is better than 20% outside the tropics and better than 50% in the tropics where uncertainties in water vapor dominate the total error budget. We observe clear differences in the seasonal cycle of PAN in our data, linked closely to biomass burning regions and growing seasons. Highest Northern Hemisphere mid-latitude PAN vmrs were observed in August (300–600 pptv on average compared with the January and October data (less than 250 pptv on average. In the March 2003 data we observe highest PAN vmrs in the tropics with evidence of vmrs between 600 and 1000 pptv over Eastern Asia and over the Central Pacific at 333 hPa. The vertical distribution of PAN as a function of latitude (i.e. the zonal mean highlights the strong inter-annual variability of PAN in the upper troposphere and lower stratosphere (UTLS, most pronounced poleward of 40° N (up to 400 pptv over the year. The variability of PAN in the tropical UTLS is also significant and we derive a variability of up to 250 pptv in the averages between January and October 2003. These results represent the first seasonal observations of PAN in the UTLS.
File list: InP.Pan.50.AllAg.PANC-1 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.Pan.50.AllAg.PANC-1 hg19 Input control Pancreas PANC-1 SRX190309,SRX150696,SRX1...99860,SRX101486,SRX190029,SRX190252,SRX644404 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.Pan.50.AllAg.PANC-1.bed ...
File list: InP.Pan.20.AllAg.PANC-1 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.Pan.20.AllAg.PANC-1 hg19 Input control Pancreas PANC-1 SRX101486,SRX190309,SRX1...50696,SRX190252,SRX644404,SRX199860,SRX190029 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.Pan.20.AllAg.PANC-1.bed ...
File list: InP.Pan.05.AllAg.PANC-1 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.Pan.05.AllAg.PANC-1 hg19 Input control Pancreas PANC-1 SRX190309,SRX101486,SRX1...50696,SRX190252,SRX644404,SRX190029,SRX199860 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.Pan.05.AllAg.PANC-1.bed ...
File list: InP.Pan.10.AllAg.PANC-1 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.Pan.10.AllAg.PANC-1 hg19 Input control Pancreas PANC-1 SRX190309,SRX101486,SRX1...50696,SRX190252,SRX644404,SRX199860,SRX190029 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.Pan.10.AllAg.PANC-1.bed ...
THE PHOTOMETRIC CLASSIFICATION SERVER FOR Pan-STARRS1
International Nuclear Information System (INIS)
Saglia, R. P.; Bender, R.; Seitz, S.; Senger, R.; Snigula, J.; Phleps, S.; Wilman, D.; Tonry, J. L.; Burgett, W. S.; Chambers, K. C.; Heasley, J. N.; Kaiser, N.; Magnier, E. A.; Morgan, J. S.; Greisel, N.; Bailer-Jones, C. A. L.; Klement, R. J.; Rix, H.-W.; Smith, K.; Green, P. J.
2012-01-01
The Pan-STARRS1 survey is obtaining multi-epoch imaging in five bands (g P1 r P1 i P1 z P1 y P1 ) over the entire sky north of declination –30 deg. We describe here the implementation of the Photometric Classification Server (PCS) for Pan-STARRS1. PCS will allow the automatic classification of objects into star/galaxy/quasar classes based on colors and the measurement of photometric redshifts for extragalactic objects, and will constrain stellar parameters for stellar objects, working at the catalog level. We present tests of the system based on high signal-to-noise photometry derived from the Medium-Deep Fields of Pan-STARRS1, using available spectroscopic surveys as training and/or verification sets. We show that the Pan-STARRS1 photometry delivers classifications and photometric redshifts as good as the Sloan Digital Sky Survey (SDSS) photometry to the same magnitude limits. In particular, our preliminary results, based on this relatively limited data set down to the SDSS spectroscopic limits, and therefore potentially improvable, show that stars are correctly classified as such in 85% of cases, galaxies in 97%, and QSOs in 84%. False positives are less than 1% for galaxies, ≈19% for stars, and ≈28% for QSOs. Moreover, photometric redshifts for 1000 luminous red galaxies up to redshift 0.5 are determined to 2.4% precision (defined as 1.48 × Median|z phot – z spec |/(1 + z)) with just 0.4% catastrophic outliers and small (–0.5%) residual bias. For bluer galaxies up to the same redshift, the residual bias (on average –0.5%) trend, percentage of catastrophic failures (1.2%), and precision (4.2%) are higher, but still interestingly small for many science applications. Good photometric redshifts (to 5%) can be obtained for at most 60% of the QSOs of the sample. PCS will create a value-added catalog with classifications and photometric redshifts for eventually many millions of sources.
HEALTH INITIATIVES IN NATIONAL PAN-AMERICAN SWIMMING FEDERATIONS
Directory of Open Access Journals (Sweden)
Clarence Perez Diaz
Full Text Available ABSTRACT Introduction: National Swimming Federations (NFs supervise a large number of athletes and have the duty to protect their health that implies also the opportunity to improve public health. Objective: 1 To determine if the health professionals, the priorities, activities, and researches of the Pan-American NFs are focused on protecting athletes’ health and promoting the health of the population in general. 2 To determine if the FINA rules, projects and programs are applied. Method: A cross-sectional descriptive survey was carried out among the 45 Pan-American NFs requesting information on the profile of the health professionals (dimension 1; D1, on programs, activities and research to promote health measures (dimension 2; D2, and on the importance of Pan-American NFs for the health of athletes and for the promotion of health in society in general (dimension 3; D3. We performed a similarity study according to the Rogers-Tanimoto coefficient (D1 and D2 and the chi-squared test (χ² (D3. Results: Thirty NFs answered the survey (response rate: 66.6%. For each dimension, the NFs were classified into five groups (A, B, C, D, E. Among the NFs, 33.3% have physicians and 33.3% have physical therapists. In each of the dimensions, Group A accounted for the majority of NFs but their results were lower. The groups with the highest rates in each dimension contained a maximum of two NFs. The health of the elite athletes was ranked as the fourth most important issue. The health of the recreational athletes and the health of the general population had the lowest priority. Drowning prevention programs were the most common. Conclusions: Pan-American NFs have few medical resources and only a few have injury prevention programs for elite athletes. There is a need to improve health promotion programs to achieve relevant social outcomes.
PEMIKIRAN DAN PERGERAKAN PAN ISLAMISME DI INDONESIA PADA AWAL ABAD KE-20
Directory of Open Access Journals (Sweden)
Abdul Somad
2015-11-01
Full Text Available Tulisan ini mengambil topik tentang wacana pemikiran dan gerakan Pan Islamisme di Indonesia pada perempat pertama abad ke-20. Permasalahan yang muncul adalah bagaimana konsepsi Pan Islamisme menurut kaum muslim Indonesia dan bagaimana bentuk aksi-aksi Pan Islamisme yang pernah mereka lakukan, baik dalam negeri maupun di luar negeri.Metode yang dipakai dalam penulisan tulisan ini adalah metode sejarah. Metode ini meliputi empat tahapan, yaitu heuristik, kritik, interpretasi, dan historiografi.Pemikiran dan gerakan Pan Islamisme di Indonesia dilandasi oleh kesadaran kaum muslim untuk mewujudkan persatuan dan kesatuan umat Islam. Di dalam negeri, keinginan itu diupayakan dalam Kongres Al-Islam Hindia Timur. Dalam kongres ini berkumpul sejumlah organisasi massa Islam. Mereka melakukan dialog keagamaan guna mencari akar-akar persamaan di antara mereka, dan memahami perbedaan masing-masing dalam soal-soal agama yang bersifat cabang. Sementara itu, di luar negeri, kaum muslim Indonesia merasa perlu melibatkan diri dalam pergerakan khilafah dan persoalan tanah suci Makkah-Madinah yang dibicarakan pada tahun 1926 lewat Kongres Islam Sedunia yang di selenggarakan di Timur Tengah. Keterlibatan mereka dalam persoalan-persoalan Dunia Islam ini sebagai bagian dari usaha kaum muslim Indonesia untuk turut aktif dalam mempersatukan umat Islam sedunia.
File list: InP.Pan.05.AllAg.Pancreatic_cancer_cells [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.Pan.05.AllAg.Pancreatic_cancer_cells mm9 Input control Pancreas Pancreatic cancer... cells SRX174587 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.Pan.05.AllAg.Pancreatic_cancer_cells.bed ...
Campylobacter in chicken livers and their destruction by pan frying.
Whyte, R; Hudson, J A; Graham, C
2006-12-01
To enumerate Campylobacter spp. on the external surface and internal portions of chicken livers, and to assess the cooking required to inactivate naturally present cells. Of 30 livers tested all yielded Campylobacter spp. on their surfaces and 90% were found to contain the organism in internal tissue. Four (13%) livers contained >10(4) MPN campylobacters, and an additional seven (23%) contained >10(3) MPN campylobacters per liver. The internal temperature of pan-fried livers under the conditions used reached a maximum of 70-80 degrees C, and maintaining this temperature for 2-3 min was necessary to inactivate naturally occurring Campylobacter spp. All isolates identified were either C. jejuni or C. coli. Chicken livers represent a potential source of human campylobacteriosis as they contained >10(4) MPN per liver in 13% of the samples tested. Pan-frying can produce an acceptable product that is safe to eat. SIGNIFICANCE AND IMPACT OF THIS STUDY: The data provided can be used in exposure assessments of Campylobacter in poultry products in terms of both quantitative data and assessing pan-frying and its ability to destroy campylobacters.
File list: InP.Pan.20.Input_control.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.Pan.20.Input_control.AllCell mm9 Input control Input control Pancreas SRX188611...035142,SRX751762,SRX751759,SRX751765,SRX751768,SRX327162,SRX672452,SRX327163 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.Pan.20.Input_control.AllCell.bed ...
International Nuclear Information System (INIS)
Borlini, Monica Castoldi; Aguiar, Mariane Costalonga de; Vieira, Carlos Mauricio Fontes; Monteiro, Sergio Neves
2009-01-01
The fabrication process of clay pans in the state of Espirito Santo, southeast of Brazil, is a recognized part of the country's popular culture. In Goiabeiras, a district of the state capital Vitoria, the traditional production of these pans is the source of income for many families. The technique used in these ceramic pans is of indigenous origin, characterized by manual molding, outdoor burning and application of tannin dye. The clay pans are distributed to several Brazilian states and are nowadays conquering the external market. In producing these pans, two types of, yellow and gray, clays are used. The actual source of raw material comes from the deposit of the Mulemba valley, where a concern on the possibility of exhaustion exists. The objective of this study was then to characterize these two types of clays and so contribute to the continuity of traditional clay pan production by knowing the characteristics of the local clays in case of an eventual need for their replacement. Chemical analysis, X-ray diffraction, particle size distribution, plasticity and thermal analysis of the clays were performed. The results showed that the clays are high plasticity kaolinite with considerable amounts of SiO 2 and Al 2 O 3 as well as of alkaline oxides, earth alkaline oxides and Fe 2 O 3 . (author)
Cross-linked PAN-based thin-film composite membranes for non-aqueous nanofiltration
Pérez-Manríquez, Liliana
2015-01-01
A new approach on the development of cross-linked PAN based thin film composite (TFC) membranes for non-aqueous application is presented in this work. Polypropylene backed neat PAN membranes fabricated by phase inversion process were cross-linked with hydrazine to get excellent solvent stability toward dimethylformamide (DMF). By interfacial polymerization a selective polyamide active layer was coated over the cross-linked PAN using N,N′-diamino piperazine (DAP) and trimesoyl chloride (TMC) as monomers. Permeation and molecular weight cut off (MWCO) experiments using various dyes were done to evaluate the performance of the membranes. Membranes developed by such method show excellent solvent stability toward DMF with a permeance of 1.7 L/m2 h bar and a molecular weight cut-off of less than 600 Da.
Pettijohn, J. C.; Salvucci, G. D.
2008-12-01
Archived global measurements of water loss from evaporation pans constitute an important indirect measure of evaporative flux. Historical data from evaporation pans shows a decreasing trend over the last half century, but the relationship between pan evaporation and moisture-limited terrestrial evaporation is complex, leading to ambiguities in the interpretation of this data. Under energy-limited conditions, pan evaporation (Epan) and moisture-limited terrestrial evaporation (E) increase or decrease together, while in moisture- limited conditions these fluxes form a complementary relation in which increases in one rate accompany decreases in the other. This has lead to debate about the meaning of the observed trends in the context of changing climate. Here a two-dimensional numerical model of a wet pan in a drying landscape is used to demonstrate that, over a wide range of realistic atmospheric and surface conditions, the influence that changes in E have on Epan (1) are complementary and linear, (2) do not depend upon surface wind speed, and (3) are strikingly asymmetrical, in that a unit decrease in E causes approximately a five-fold increase in Epan, as found in a recent analysis of daily evaporation from US grasslands (Kahler and Brutsaert, 2006). Previous attempts to explain the CR have been based on one dimensional diffusion and energy balance arguments, leading to analytic solutions based on Penman-type bulk difference equations. But without acknowledging the spatially complex multidimensional humidity and temperature field around the pan, and specifically how these fields change as the contrast between the wet pan and the drying land surface increases, such integrated bulk difference equations are a priori incomplete (they ignore important divergence terms), and thus these explanations must be considered physically incomplete. Results of the present study improve the theoretical foundation of the CR, thus increasing the reliability with which it can be
Forest chimpanzees (Pan troglodytes verus) remember the location of numerous fruit trees.
Normand, Emmanuelle; Ban, Simone Dagui; Boesch, Christophe
2009-11-01
It is assumed that spatial memory contributes crucially to animal cognition since animals' habitats entail a large number of dispersed and unpredictable food sources. Spatial memory has been investigated under controlled conditions, with different species showing and different conditions leading to varying performance levels. However, the number of food sources investigated is very low compared to what exists under natural conditions, where food resources are so abundant that it is difficult to precisely identify what is available. By using a detailed botanical map containing over 12,499 trees known to be used by the Taï chimpanzees, we created virtual maps of all productive fruit trees to simulate potential strategies used by wild chimpanzees to reach resources without spatial memory. First, we simulated different assumptions concerning the chimpanzees' preference for a particular tree species, and, second, we varied the detection field to control for the possible use of smell to detect fruiting trees. For all these assumptions, we compared simulated distance travelled, frequencies of trees visited, and revisit rates with what we actually observed in wild chimpanzees. Our results show that chimpanzees visit rare tree species more frequently, travel shorter distances to reach them, and revisit the same trees more often than if they had no spatial memory. In addition, we demonstrate that chimpanzees travel longer distances to reach resources where they will eat for longer periods of time, and revisit resources more frequently where they ate for a long period of time during their first visit. Therefore, this study shows that forest chimpanzees possess a precise spatial memory which allows them to remember the location of numerous resources and use this information to select the most attractive resources.
The higher the farther: distance-specific referential gestures in chimpanzees (Pan troglodytes).
Gonseth, Chloe; Kawakami, Fumito; Ichino, Etsuko; Tomonaga, Masaki
2017-11-01
Referential signals, such as manual pointing or deictic words, allow individuals to efficiently locate a specific entity in the environment, using distance-specific linguistic and/or gestural units. To explore the evolutionary prerequisites of such deictic ability, the present study investigates the ability of chimpanzees to adjust their communicative signals to the distance of a referent. A food-request paradigm in which the chimpanzees had to request a close or distant piece of food on a table in the presence/absence of an experimenter was employed. Our main finding concerns the chimpanzees adjusting their requesting behaviours to the distance of the food such that higher manual gestures and larger mouth openings were used to request the distant piece of food. To the best of our knowledge, this is the first study to demonstrate that chimpanzees are able to use distance-specific gestures. © 2017 The Authors.
van Leeuwen, Edwin J C; Mulenga, Innocent Chitalu; Chidester, Diana Lisensky
2014-03-01
In a highly social species like chimpanzees, the process by which individuals become attuned to their social environment may be of vital importance to their chances of survival. Typically, this socialization process, defined by all acquisition experiences and fine-tuning efforts of social interaction patterns during ontogeny, occurs in large part through parental investment. In this study, we investigated whether maternal presence enhances the socialization process in chimpanzees by comparing the social interactions of orphaned and mother-reared individuals at the Chimfunshi Wildlife Orphanage Trust in Zambia. As response variables, we selected social interactions during which an elaborate level of fine-tuning is assumed to be necessary for sustaining the interaction and preventing escalation: social play. Comparing orphaned (n = 8) to sex- and age-matched mother-reared juvenile chimpanzees (n = 9), we hypothesized that the orphaned juveniles would play less frequently than the mother-reared and would be less equipped for fine-tuning social play (which we assayed by rates of aggression) because of the lack of a safe and facilitating social environment provided by the mother. First, contrary to our hypothesis, results showed that the orphaned juveniles engaged in social play more frequently than the mother-reared juveniles, although for significantly shorter amounts of time. Second, in support of our hypothesis, results showed that social play of the orphaned juveniles more often resulted in aggression than social play of the mother-reared juveniles. In conjunction, these results may indicate that, just like in humans, chimpanzee mothers provide their offspring with adequate social skills that might be of pivotal importance for future challenges like successful group-living and securing competitive fitness advantages.
Delay of Gratification by Chimpanzees (Pan troglodytes) in Working and Waiting Situations
Beran, Michael J.; Evans, Theodore A.
2009-01-01
We tested four chimpanzees in a self-control task in which food rewards accumulated as long as they were not eaten. In one condition, the chimpanzees had to perform a computer task that directly led to the delivery of the food rewards. In another condition, working on the computerized task was not required and any such work was not linked to the delivery of rewards. The third condition offered no computerized task (chimpanzees simply waited for food rewards to be delivered). Three of four chimpanzees showed no effect of the work scenario on delay of gratification. The one chimpanzee that showed an influence of work scenario on self-control was the overall poorest performing animal. This animal delayed gratification the longest, however, when work was required and reward delivery was directly linked to that work. Therefore, although there is little evidence linking delay of gratification to work requirements in chimpanzees, chimpanzees with lower overall self-control might benefit from having some work available if reward accumulation is contingent on performing that work. PMID:19084581
Surgical technique for ambulatory management of airsacculitis in a chimpanzee (Pan troglodytes).
Hill, L R; Lee, D R; Keeling, M E
2001-02-01
Bacterial infections of the air sac have been reported in many nonhuman primates. Approaches to the management of airsacculitis have included combinations of medical and surgical therapies. These strategies have often required repeated attempts to drain exudate from the affected air sac, as well as necessitating that the animal endure isolation or undergo intensive postoperative care before returning to its social group. A stoma was created via deliberate apposition of the air sac lining and skin to allow continuous drainage. Antibiotic therapy based on culture and antimicrobial susceptibility of the air sac contents was administered while the chimpanzee remained in its social group. We were able to attain complete resolution of the infection after a course of oral antibiotic therapy. The stoma closed gradually over a three-week period, and the chimpanzee has remained free of infection since that time. Despite the severity of the air sac infection in this chimpanzee, we were able to resolve the infection easily, using a simple surgical technique. This method allowed treatment without interfering with social standing or subjection to repeated anesthetic and treatment episodes. This method could be a simple, useful alternative for managing airsacculitis in nonhuman primates.
Hrubesch, Christine; Preuschoft, Signe; van Schaik, Carel
2009-03-01
Geographic variation in socially transmitted skills and signals, similar to human culture, has been well documented for great apes. The rules governing the adoption of novel behaviours, however, are still largely unknown. We conducted an innovation-and-transmission experiment with two groups of chimpanzees living at hopE Primate Sanctuary Gänserndorf, Austria, presenting a board on which food had to be manoeuvred around obstacles to be acquired. Most chimpanzees used sticks to acquire the food, but five adults independently invented a novel technique, rattling, which was subsequently tested by almost all group members. However, individuals who had become proficient with sticks were reluctant to switch to rattling, despite it being more efficient. Similarly, after rattling was prevented, rattle specialists kept trying to rattle and made no attempt to use the stick technique, despite their knowledge about its existence. We conclude that innovators stimulate others to experiment with the solutions they display, but that chimpanzees are nevertheless conservative; mastery of a skill inhibits further exploration, and hence adoption of alternative techniques even if these are more efficient. Consequently, conformity among group members should not be expected in great apes when individuals develop proficiency at different techniques. Conservatism thus joins conformity as a mechanism to bring about cultural uniformity and stability.
Chimpanzees (Pan troglodytes) and the question of cumulative culture: an experimental approach.
Marshall-Pescini, Sarah; Whiten, Andrew
2008-07-01
There is increasing evidence for cultural variations in behaviour among non-human species, but human societies additionally display elaborate cumulative cultural evolution, with successive generations building on earlier achievements. Evidence for cumulative culture in non-human species remains minimal and controversial. Relevant experiments are also lacking. Here we present a first experiment designed to examine chimpanzees' capacity for cumulative social learning. Eleven young chimpanzees were presented with a foraging device, which afforded both a relatively simple and a more complex tool-use technique for extracting honey. The more complex 'probing' technique incorporated the core actions of the simpler 'dipping' one and was also much more productive. In a baseline, exploration condition only two subjects discovered the dipping technique and a solitary instance of probing occurred. Demonstrations of dipping by a familiar human were followed by acquisition of this technique by the five subjects aged three years or above, whilst younger subjects showed a significant increase only in the elements of the dipping technique. By contrast, subsequent demonstrations of the probing task were not followed by acquisition of this more productive technique. Subjects stuck to their habitual dipping method despite an escalating series of demonstrations eventually exceeding 200. Supplementary tests showed this technique is within the capability of chimpanzees of this age. We therefore tentatively conclude that young chimpanzees exhibit a tendency to become 'stuck' on a technique they initially learn, inhibiting cumulative social learning and possibly constraining the species' capacity for cumulative cultural evolution.
Czech Academy of Sciences Publication Activity Database
Jirků-Pomajbíková, K.; Čepička, I.; Kalousová, B.; Jirků, M.; Stewart, F.; Levecke, B.; Modrý, D.; Piel, A. K.; Petrželková, Klára Judita
2016-01-01
Roč. 143, č. 6 (2016), s. 741-748 ISSN 0031-1820 R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:68081766 Keywords : Entamoeba * molecular diversity * great apes * chimpanzee * savannah Subject RIV: EG - Zoology Impact factor: 2.713, year: 2016
Czech Academy of Sciences Publication Activity Database
Jirků-Pomajbíková, Kateřina; Čepička, I.; Kalousová, B.; Jirků, Milan; Stewart, F.; Levecke, B.; Modrý, David; Piel, A. K.; Petrželková, Klára Judita
2016-01-01
Roč. 143, č. 6 (2016), s. 741-748 ISSN 0031-1820 R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:60077344 Keywords : Entamoeba * molecular diversity * great apes * chimpanzee * savannah Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.713, year: 2016
Present status of preparation to the Pan-Orthodox Council
Directory of Open Access Journals (Sweden)
Biskup Jerzy Pańkowski
2014-11-01
Full Text Available The article begins from explanation of the meaning (from the point of view of the Orthodox Church of the word „catholic” as one of the ontological attributes of the Church. Than the author presents the examples of the different kinds of meetings of Church hierarchs on the highest level and its titles/names.Than the article gives a short presentation of the initiative and history of the convene of Pan-Orthodox Council. The idea of that kind of meeting was born in the beginning of XX century on Ecumenical Patriarchate.The preparation to the Pan-Orthodox Council lasts many yearsand contains of many different kind of meetings. Meetings of the special commission that consists of representatives of each Autocephaly Orthodox Church concentrate on the different topics. During last meetings several important topics were discussed, as: Orthodox Diaspora, Autonomy and the methods of its granting, Autocephaly and the methods of its grantingand Diptychs. The author, who took part in some of these meeting,explains the positions of the various Churches in these matters as well asshares his opinions on them.In conclusion the author presents the opinion that despite many different problems on the way to prepare the Pan-Orthodox Council, this idea can be realized even in the near future.
gLExec Integration with the ATLAS PanDA Workload Management System
Karavakis, Edward; Campana, Simone; De, Kaushik; Di Girolamo, Alessandro; Litmaath, Maarten; Maeno, Tadashi; Medrano Llamas, Ramon; Nilsson, Paul; Wenaus, Torre
2015-01-01
ATLAS user jobs are executed on Worker Nodes (WNs) by pilots sent to sites by pilot factories. This paradigm serves to allow a high job reliability and although it has clear advantages, such as making the working environment homogeneous, the approach presents security and traceability challenges. To address these challenges, gLExec can be used to let the payloads for each user be executed under a different UNIX user id that uniquely identifies the ATLAS user. This paper describes the recent improvements and evolution of the security model within the ATLAS PanDA system, including improvements in the PanDA pilot, in the PanDA server and their integration with MyProxy, a credential caching system that entitles a person or a service to act in the name of the issuer of the credential. Finally, it presents results from ATLAS user jobs running with gLExec and describes the deployment campaign within ATLAS.
ATLAS Global Shares Implementation in the PanDA Workload Management System
Barreiro Megino, Fernando Harald; The ATLAS collaboration
2018-01-01
PanDA (Production and Distributed Analysis) is the workload management system for ATLAS across the Worldwide LHC Computing Grid. While analysis tasks are submitted to PanDA by over a thousand users following personal schedules (e.g. PhD or conference deadlines), production campaigns are scheduled by a central Physics Coordination group based on the organization’s calendar. The Physics Coordination group needs to allocate the amount of Grid resources dedicated to each activity, in order to manage sharing of CPU resources among various parallel campaigns and to make sure that results can be achieved in time for important deadlines. While dynamic and static shares on batch systems have been around for a long time, we are trying to move away from local resource partitioning and manage shares at a global level in the PanDA system. The global solution is not straightforward, given different requirements of the activities (number of cores, memory, I/O and CPU intensity), the heterogeneity of Grid resources (site/H...
Integration Of PanDA Workload Management System With Supercomputers for ATLAS
Oleynik, Danila; The ATLAS collaboration; De, Kaushik; Wenaus, Torre; Maeno, Tadashi; Barreiro Megino, Fernando Harald; Nilsson, Paul; Guan, Wen; Panitkin, Sergey
2016-01-01
The Large Hadron Collider (LHC), operating at the international CERN Laboratory in Geneva, Switzerland, is leading Big Data driven scientific explorations. Experiments at the LHC explore the fundamental nature of matter and the basic forces that shape our universe, and were recently credited for the discovery of a Higgs boson. ATLAS, one of the largest collaborations ever assembled in the sciences, is at the forefront of research at the LHC. To address an unprecedented multi-petabyte data processing challenge, the ATLAS experiment is relying on a heterogeneous distributed computational infrastructure. The ATLAS experiment uses PanDA (Production ANd Distributed Analysis system) Workload Management System for managing the workflow for all data processing on over 150 data centers. Through PanDA, ATLAS physicists see a single computing facility that enables rapid scientific breakthroughs for the experiment, even though the data centers are physically scattered all over the world. While PanDA currently uses more t...
Directory of Open Access Journals (Sweden)
Erik Benson
2004-01-01
Full Text Available During the late I920s and early 1930s, Pan American Airways became known as the U.S. “chosen instrument” for international commercial aviation. Most scholarly work about the U.S. government/Pan Am relationship presents the airline as the government’s instrument. This article challenges this traditional perspective. In certain ways Pan Am was an “instrument,” yet in others it defied such categorization. Thus, any notion that Pan Am was a “chosen instrument” merits qualification. Drawing upon the “corporatist” historical model, this study will present a more sophisticated account of this relationship, one that considers the role of business elites in shaping U.S. policy.
Directory of Open Access Journals (Sweden)
M. Ozendi
2016-10-01
The aim of this study is to investigate pan-sharpening performance of RASAT and GÖKTÜRK-2 images. For this purpose, pan-sharpened images are generated using most popular pan-sharpening methods IHS, Brovey and PCA at first. This procedure is followed by quantitative evaluation of pan-sharpened images using Correlation Coefficient (CC, Root Mean Square Error (RMSE, Relative Average Spectral Error (RASE, Spectral Angle Mapper (SAM and Erreur Relative Globale Adimensionnelle de Synthése (ERGAS metrics. For generation of pan-sharpened images and computation of metrics SharpQ tool is used which is developed with MATLAB computing language. According to metrics, PCA derived pan-sharpened image is the most similar one to multispectral image for RASAT, and Brovey derived pan-sharpened image is the most similar one to multispectral image for GÖKTÜRK-2. Finally, pan-sharpened images are evaluated qualitatively in terms of object availability and completeness for various land covers (such as urban, forest and flat areas by a group of operators who are experienced in remote sensing imagery.
PanDA: Exascale Federation of Resources for the ATLAS Experiment at the LHC
Barreiro Megino, Fernando; Caballero Bejar, Jose; De, Kaushik; Hover, John; Klimentov, Alexei; Maeno, Tadashi; Nilsson, Paul; Oleynik, Danila; Padolski, Siarhei; Panitkin, Sergey; Petrosyan, Artem; Wenaus, Torre
2016-02-01
After a scheduled maintenance and upgrade period, the world's largest and most powerful machine - the Large Hadron Collider(LHC) - is about to enter its second run at unprecedented energies. In order to exploit the scientific potential of the machine, the experiments at the LHC face computational challenges with enormous data volumes that need to be analysed by thousand of physics users and compared to simulated data. Given diverse funding constraints, the computational resources for the LHC have been deployed in a worldwide mesh of data centres, connected to each other through Grid technologies. The PanDA (Production and Distributed Analysis) system was developed in 2005 for the ATLAS experiment on top of this heterogeneous infrastructure to seamlessly integrate the computational resources and give the users the feeling of a unique system. Since its origins, PanDA has evolved together with upcoming computing paradigms in and outside HEP, such as changes in the networking model, Cloud Computing and HPC. It is currently running steadily up to 200 thousand simultaneous cores (limited by the available resources for ATLAS), up to two million aggregated jobs per day and processes over an exabyte of data per year. The success of PanDA in ATLAS is triggering the widespread adoption and testing by other experiments. In this contribution we will give an overview of the PanDA components and focus on the new features and upcoming challenges that are relevant to the next decade of distributed computing workload management using PanDA.
Advanced stabilization of PAN fibers for fabrication of carbon fibers by e-beam irradiation
International Nuclear Information System (INIS)
Jeun, Joon Pyo; Kim, Du Young; Shin, Hye Kyoung; Kang, Phil Hyun; Park, Jung Ki
2012-01-01
In recent years, the carbon fiber industry has been growing rapidly to meet the demand from efferent industries such as aerospace, military, turbine blades, light weight cylinders and pressure vessels. Generally, carbon fibers are manufactured by a controlled pyrolysis of stabilized precursor fiber such as polyacrylonitrile (PAN). In the stabilization step, the linear PAN molecules are first converted to cyclic structure. However, cyclization is a very complicated process and there are still differences of opinion on the reaction mechanisms. Photo-induced crosslinking and stabilization of PAN via ion beam, X-ray, gamma ray and UV irradiation has been reported in the literature. However, the process required a long stabilization time. In this work, a new and highly effective method of pretreatment PAN precursor fiber was described. The effect of the e-beam on the stabilization process of the fibers was investigated using differential scanning calorimeter (DSC) and X-ray diffraction (XRD) measurement
Hypoglycemia revealing arachnoidocele in infant | Jellouli | Pan ...
African Journals Online (AJOL)
The patient was treated with hydrocortisone, levothyroxine and growth hormone replacement. The outcome was favorable without recourse to neurosurgery at the lack of damage to the optic nerve and the sphenoid bone, with a decline of five years otherwise the child has a delay in psychomotor acquisitions. Pan African ...
Hamad, Ibrahim; Delaporte, Eric; Raoult, Didier; Bittar, Fadi
2014-03-27
The consumption of insects by apes has previously been reported based on direct observations and/or trail signs in feces. However, DNA-based diet analyses may have the potential to reveal trophic links for these wild species. Herein, we analyzed the insect-diet diversity of 9 feces obtained from three species of African great apes, gorilla (Gorilla gorilla gorilla), chimpanzee (Pan troglodytes) and bonobo (Pan paniscus), using two mitochondrial amplifications for arthropods. A total of 1056 clones were sequenced for Cyt-b and COI gene libraries, which contained 50 and 56 operational taxonomic units (OTUs), respectively. BLAST research revealed that the OTUs belonged to 32 families from 5 orders (Diptera, Isoptera, Lepidoptera, Coleoptera, and Orthoptera). While ants were not detected by this method, the consumption of flies, beetles, moths, mosquitoes and termites was evident in these samples. Our findings indicate that molecular techniques can be used to analyze insect food items in wild animals.
Phylogenetic relations of humans and African apes from DNA sequences in the Psi eta-globin region
Energy Technology Data Exchange (ETDEWEB)
Miyamoto, M.M.; Slightom, J.L.; Goodman, M.
1987-10-16
Sequences from the upstream and downstream flanking DNA regions of the Psi eta-globin locus in Pan troglodytes (common chimpanzee), Gorilla gorilla (gorilla), and Pongo pygmaeus (orangutan, the closest living relative to Homo, Pan, and Gorilla) provided further data for evaluating the phylogenetic relations of humans and African apes. These newly sequenced orthologs (an additional 4.9 kilobase pairs (kbp) for each species) were combined with published Psi eta-gene sequences and then compared to the same orthologous stretch (a continuous 7.1-kbp region) available for humans. Phylogenetic analysis of these nucleotide sequences by the parsimony method indicated (i) that human and chimpanzee are more closely related to each other than either is to gorilla and (ii) that the slowdown in the rate of sequence evolution evident in higher primates is especially pronounced in humans. These results indicate that features unique to African apes (but not to humans) are primitive and that even local molecular clocks should be applied with caution.
The bonobo genome compared with the chimpanzee and human genomes
Prüfer, Kay; Munch, Kasper; Hellmann, Ines; Akagi, Keiko; Miller, Jason R.; Walenz, Brian; Koren, Sergey; Sutton, Granger; Kodira, Chinnappa; Winer, Roger; Knight, James R.; Mullikin, James C.; Meader, Stephen J.; Ponting, Chris P.; Lunter, Gerton; Higashino, Saneyuki; Hobolth, Asger; Dutheil, Julien; Karakoç, Emre; Alkan, Can; Sajjadian, Saba; Catacchio, Claudia Rita; Ventura, Mario; Marques-Bonet, Tomas; Eichler, Evan E.; André, Claudine; Atencia, Rebeca; Mugisha, Lawrence; Junhold, Jörg; Patterson, Nick; Siebauer, Michael; Good, Jeffrey M.; Fischer, Anne; Ptak, Susan E.; Lachmann, Michael; Symer, David E.; Mailund, Thomas; Schierup, Mikkel H.; Andrés, Aida M.; Kelso, Janet; Pääbo, Svante
2012-01-01
Two African apes are the closest living relatives of humans: the chimpanzee (Pan troglodytes) and the bonobo (Pan paniscus). Although they are similar in many respects, bonobos and chimpanzees differ strikingly in key social and sexual behaviours1–4, and for some of these traits they show more similarity with humans than with each other. Here we report the sequencing and assembly of the bonobo genome to study its evolutionary relationship with the chimpanzee and human genomes. We find that more than three per cent of the human genome is more closely related to either the bonobo or the chimpanzee genome than these are to each other. These regions allow various aspects of the ancestry of the two ape species to be reconstructed. In addition, many of the regions that overlap genes may eventually help us understand the genetic basis of phenotypes that humans share with one of the two apes to the exclusion of the other. PMID:22722832
Pan-European management of electricity portfolios: Risks and opportunities of contract bundling
International Nuclear Information System (INIS)
Gampert, Markus; Madlener, Reinhard
2011-01-01
Due to the liberalization of energy markets in the European Union, today's European utilities not only focus on electricity supply, but also offer exchange-traded 'structured products' or portfolio management for unbundling financial and physical risk positions. Many utilities are only able to provide these services in their domestic markets. In a globalized economy, the need for a centrally organized pan-European portfolio management has arisen, as it allows a simplified commodity sourcing in combination with an optimized risk management. In this paper, we examine the challenges to be overcome for establishing a European-wide bundling of electricity contracts. For this purpose, a case study based on the business perspective of RWE Supply and Trading in Central and Eastern Europe is carried out. In a first step, we analyze general requirements for a pan-European bundling of electricity contracts. Then, RWE's situation in Europe is examined, based on which we finally propose a concept to meet customer demands in Central and Eastern Europe. - Research highlights: → Analysis of electricity market liberalization in Central and Eastern Europe. → Identification of requirements and problems for pan-European bundling of contracts. → Case study based on RWE Supply and Trading perspective in Central and Eastern Europe. → Model development for pan-European unbundling of financial/physical risk positions.
Shen, Qing; Gu, Qing-Feng; Hu, Jian-Feng; Teng, Xin-Rong; Zhu, Yun-Feng
2003-11-15
In this paper, the surface properties, e.g., the total surface free energy and the related Lifshitz-van der Waals and Lewis acid-base components, of polyacrylonitrile (PAN) precipitation polymerized in supercritical CO(2) have been characterized. Moreover, the influence of molecular weight varying has been also investigated. Results show that the surface properties of PAN resulting from supercritical CO(2) are different from those obtained by the conventional method. Of these data, one important finding is that the supercritical CO(2) PAN seems to decrease the surface free energy with the increased molecular weight. Based on previous recorded NMR spectra of this PAN and especially compared to commercial PAN, such phenomena are discussed and ascribed to an increase of the H-bonds and a reduction of the isotacticity in the supercritical CO(2) condition for PAN.
Leigh-Smith, Simon; Stevenson, Richard; Watt, Martin; Watt, Ian; McFadyen, Angus; Grant, Stan
2004-01-01
To determine whether pan diameter influences carbon monoxide (CO) concentration during heating of water to boiling point with a camping stove. The hypothesis was that increasing pan diameter increases CO concentration because of greater flame dispersal and a larger flame. This was a randomized, prospective study. A Coleman Dual Fuel 533 stove was used to heat pans of water to boiling point, with CO concentration monitored every 30 seconds for 5 minutes. The stove was inside a partially ventilated 200-L cardboard box model that was inside an environmental chamber at -6 degrees C. Water temperature, water volume, and flame characteristics were all standardized. Ten trials were performed for each of 2 pan diameters (base diameters of 165 mm [small] and 220 mm [large]). There was a significant difference (P = .002) between the pans for CO levels at each measurement interval from 60 seconds onward. These differences were markedly larger after 90 seconds, with a mean difference of 185 ppm (95% CI 115, 276 ppm) for all the results from 120 seconds onwards. This study has shown that there is significantly higher CO production with a large-diameter pan compared with a small-diameter pan. These findings were evident by using a camping stove to heat water to boiling point when a maximum blue flame was present throughout. Thus, in enclosed environments it is recommended that small-diameter pans be used in an attempt to prevent high CO levels.
Characterization of PAN/ATO nanocomposites prepared by solution ...
Indian Academy of Sciences (India)
Conducting nanocomposites of polyacrylonitrile (PAN) and antimony-doped tin oxide (ATO) were prepared by solution blending. Electrical properties of the nanocomposites were characterized by means of electrical conductivity measurements and the phase structures were investigated via scanning electron microscopy ...
JUSCELINO KUBITSCHEK AND THE PAN-AMERICAN OPERATION (1956-1961
Directory of Open Access Journals (Sweden)
Silvana Aline Soares Simon
2012-09-01
Full Text Available This article aims to analyse Juscelino Kubitschek’s period, which had the national development as an important characteristic, based on the association with foreign capital. In terms of foreign policy, the period between 1954 and 1958 was characterized by the return to autonomy and active bargaining against the United States. This situation changed at the end of this period, when there were difficulties in attracting foreign investment and there was a slowdown in growth, with the launch of Pan-American Operation. It was a multilateral initiative and showed a new phase of the Brazilian diplomacy, which would culminate in the Independent Foreign Policy. Keywords: Brazilian Foreign Policy, Juscelino Kubitschek, National Development, Pan American Operation, Relationship with the United States.
Tereszchuk, K. A.; Moore, D. P.; Harrison, J. J.; Boone, C. D.; Park, M.; Remedios, J. J.; Randel, W. J.; Bernath, P. F.
2013-06-01
Peroxyacetyl nitrate (CH3CO·O2NO2, abbreviated as PAN) is a trace molecular species present in the troposphere and lower stratosphere due primarily to pollution from fuel combustion and the pyrogenic outflows from biomass burning. In the lower troposphere, PAN has a relatively short lifetime and is principally destroyed within a few hours through thermolysis, but it can act as a reservoir and carrier of NOx in the colder temperatures of the upper troposphere, where UV photolysis becomes the dominant loss mechanism. Pyroconvective updrafts from large biomass burning events can inject PAN into the upper troposphere and lower stratosphere (UTLS), providing a means for the long-range transport of NOx. Given the extended lifetimes at these higher altitudes, PAN is readily detectable via satellite remote sensing. A new PAN data product is now available for the Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS) version 3.0 data set. We report observations of PAN in boreal biomass burning plumes recorded during the BORTAS (quantifying the impact of BOReal forest fires on Tropospheric oxidants over the Atlantic using Aircraft and Satellites) campaign (12 July to 3 August 2011). The retrieval method employed by incorporating laboratory-recorded absorption cross sections into version 3.0 of the ACE-FTS forward model and retrieval software is described in full detail. The estimated detection limit for ACE-FTS PAN is 5 pptv, and the total systematic error contribution to the ACE-FTS PAN retrieval is ~ 16%. The retrieved volume mixing ratio (VMR) profiles are compared to coincident measurements made by the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS) instrument on the European Space Agency (ESA) Environmental Satellite (ENVISAT). The MIPAS measurements demonstrated good agreement with the ACE-FTS VMR profiles for PAN, where the measured VMR values are well within the associated measurement errors for both instruments and comparative
Preuss, Johanna; Madea, Burkhard
2009-03-01
Twenty years after the Second World War the public were made aware of War Crimes committed by the German forensic pathologist, Gerhart Panning (1900-1944). From 1942 till 1944, Panning was professor at the Institute of Forensic Medicine at the University of Bonn. Panning died of tuberculosis on 22 March 1944. After the Second World War, Panning's widow tried to obtain denazification for her husband. There were no particularly serious doubts. In 1965, Konrad Graf von Moltke, the son of Helmuth James Graf von Moltke (1907-1944), presented to the court a private letter from his father to his mother. In this letter, written in 1941, Panning's experiments on Soviet prisoners are described. In the so-called Callsen trial in the court of Darmstadt from 1960 to 1968, the experiments were confirmed by witnesses. In 1941, Panning performed experiments in cooperation with the Sicherheitsstaffel (Nazi special police) in the Ukraine to prove that captured ammunition of the soviet infantry violated international law. For this purpose, different parts of the bodies of living Soviets were used as firing targets. He published the results of these experiments in a scientific journal without any evidence of the origin of these observations. In this article, Panning's life and crimes have been described.
DEFF Research Database (Denmark)
Schwartz, Camilla
2017-01-01
I løbet af de sidste ti år er det blevet svært og ikke mindst enormt kedeligt at blive voksen i nyere dansk litteratur, og det i en sådan grad, at der måske i samtidslitteraturen er tale om en nærmst epidemisk modstand mod at blive formet og modnet i voksne termer. I artiklen Peter Pan på All...
Directory of Open Access Journals (Sweden)
Jiangxiu Zhou
2014-09-01
Full Text Available The purpose of this study is to demonstrate a way of dealing with missing data in clustered randomized trials by doing multiple imputation (MI with the PAN package in R through SAS. The procedure for doing MI with PAN through SAS is demonstrated in detail in order for researchers to be able to use this procedure with their own data. An illustration of the technique with empirical data was also included. In this illustration thePAN results were compared with pairwise deletion and three types of MI: (1 Normal Model (NM-MI ignoring the cluster structure; (2 NM-MI with dummy-coded cluster variables (fixed cluster structure; and (3 a hybrid NM-MI which imputes half the time ignoring the cluster structure, and the other half including the dummy-coded cluster variables. The empirical analysis showed that using PAN and the other strategies produced comparable parameter estimates. However, the dummy-coded MI overestimated the intraclass correlation, whereas MI ignoring the cluster structure and the hybrid MI underestimated the intraclass correlation. When compared with PAN, the p-value and standard error for the treatment effect were higher with dummy-coded MI, and lower with MI ignoring the clusterstructure, the hybrid MI approach, and pairwise deletion. Previous studies have shown that NM-MI is not appropriate for handling missing data in clustered randomized trials. This approach, in addition to the pairwise deletion approach, leads to a biased intraclass correlation and faultystatistical conclusions. Imputation in clustered randomized trials should be performed with PAN. We have demonstrated an easy way for using PAN through SAS.
gLExec and MyProxy integration in the ATLAS/OSG PanDA workload management system
International Nuclear Information System (INIS)
Caballero, J; Hover, J; Maeno, T; Potekhin, M; Wenaus, T; Zhao, X; Litmaath, M; Nilsson, P
2010-01-01
Worker nodes on the grid exhibit great diversity, making it difficult to offer uniform processing resources. A pilot job architecture, which probes the environment on the remote worker node before pulling down a payload job, can help. Pilot jobs become smart wrappers, preparing an appropriate environment for job execution and providing logging and monitoring capabilities. PanDA (Production and Distributed Analysis), an ATLAS and OSG workload management system, follows this design. However, in the simplest (and most efficient) pilot submission approach of identical pilots carrying the same identifying grid proxy, end-user accounting by the site can only be done with application-level information (PanDA maintains its own end-user accounting), and end-user jobs run with the identity and privileges of the proxy carried by the pilots, which may be seen as a security risk. To address these issues, we have enabled PanDA to use gLExec, a tool provided by EGEE which runs payload jobs under an end-user's identity. End-user proxies are pre-staged in a credential caching service, MyProxy, and the information needed by the pilots to access them is stored in the PanDA DB. gLExec then extracts from the user's proxy the proper identity under which to run. We describe the deployment, installation, and configuration of gLExec, and how PanDA components have been augmented to use it. We describe how difficulties were overcome, and how security risks have been mitigated. Results are presented from OSG and EGEE Grid environments performing ATLAS analysis using PanDA and gLExec.
CO2-Philic Thin Film Composite Membranes: Synthesis and Characterization of PAN-r-PEGMA Copolymer
Directory of Open Access Journals (Sweden)
Madhavan Karunakaran
2017-07-01
Full Text Available In this work, we report the successful fabrication of CO2-philic polymer composite membranes using a polyacrylonitrile-r-poly(ethylene glycol methyl ether methacrylate (PAN-r-PEGMA copolymer. The series of PAN-r-PEGMA copolymers with various amounts of PEG content was synthesized by free radical polymerization in presence of AIBN initiator and the obtained copolymers were used for the fabrication of composite membranes. The synthesized copolymers show high molecular weights in the range of 44–56 kDa. We were able to fabricate thin film composite (TFC membranes by dip coating procedure using PAN-r-PEGMA copolymers and the porous PAN support membrane. Scanning electron microscopy (SEM and atomic force microscopy (AFM were applied to analyze the surface morphology of the composite membranes. The microscopy analysis reveals the formation of the defect free skin selective layer of PAN-r-PEGMA copolymer over the porous PAN support membrane. Selective layer thickness of the composite membranes was in the range of 1.32–1.42 μm. The resulting composite membrane has CO2 a permeance of 1.37 × 10−1 m3/m2·h·bar and an ideal CO2/N2, selectivity of 65. The TFC membranes showed increasing ideal gas pair selectivities in the order CO2/N2 > CO2/CH4 > CO2/H2. In addition, the fabricated composite membranes were tested for long-term single gas permeation measurement and these membranes have remarkable stability, proving that they are good candidates for CO2 separation.
Popic, Tony J; Davila, Yvonne C; Wardle, Glenda M
2013-01-01
Methods for sampling ecological assemblages strive to be efficient, repeatable, and representative. Unknowingly, common methods may be limited in terms of revealing species function and so of less value for comparative studies. The global decline in pollination services has stimulated surveys of flower-visiting invertebrates, using pan traps and net sampling. We explore the relative merits of these two methods in terms of species discovery, quantifying abundance, function, and composition, and responses of species to changing floral resources. Using a spatially-nested design we sampled across a 5000 km(2) area of arid grasslands, including 432 hours of net sampling and 1296 pan trap-days, between June 2010 and July 2011. Net sampling yielded 22% more species and 30% higher abundance than pan traps, and better reflected the spatio-temporal variation of floral resources. Species composition differed significantly between methods; from 436 total species, 25% were sampled by both methods, 50% only by nets, and the remaining 25% only by pans. Apart from being less comprehensive, if pan traps do not sample flower-visitors, the link to pollination is questionable. By contrast, net sampling functionally linked species to pollination through behavioural observations of flower-visitation interaction frequency. Netted specimens are also necessary for evidence of pollen transport. Benefits of net-based sampling outweighed minor differences in overall sampling effort. As pan traps and net sampling methods are not equivalent for sampling invertebrate-flower interactions, we recommend net sampling of invertebrate pollinator assemblages, especially if datasets are intended to document declines in pollination and guide measures to retain this important ecosystem service.
CO2-Philic Thin Film Composite Membranes: Synthesis and Characterization of PAN-r-PEGMA Copolymer
Karunakaran, Madhavan
2017-07-06
In this work, we report the successful fabrication of CO2-philic polymer composite membranes using a polyacrylonitrile-r-poly(ethylene glycol) methyl ether methacrylate (PAN-r-PEGMA) copolymer. The series of PAN-r-PEGMA copolymers with various amounts of PEG content was synthesized by free radical polymerization in presence of AIBN initiator and the obtained copolymers were used for the fabrication of composite membranes. The synthesized copolymers show high molecular weights in the range of 44-56 kDa. We were able to fabricate thin film composite (TFC) membranes by dip coating procedure using PAN-r-PEGMA copolymers and the porous PAN support membrane. Scanning electron microscopy (SEM) and atomic force microscopy (AFM) were applied to analyze the surface morphology of the composite membranes. The microscopy analysis reveals the formation of the defect free skin selective layer of PAN-r-PEGMA copolymer over the porous PAN support membrane. Selective layer thickness of the composite membranes was in the range of 1.32-1.42 mu m. The resulting composite membrane has CO2 a permeance of 1.37 x 10(-1) m(3)/m(2).h.bar and an ideal CO2/N-2, selectivity of 65. The TFC membranes showed increasing ideal gas pair selectivities in the order CO2/N-2 > CO2/CH4 > CO2/H-2. In addition, the fabricated composite membranes were tested for long-term single gas permeation measurement and these membranes have remarkable stability, proving that they are good candidates for CO2 separation.
Energy Technology Data Exchange (ETDEWEB)
Leonardi, Roberta [St. Jude Children' s Research Hospital, Memphis, TN (United States); Zhang, Yong-Mei [St. Jude Children' s Research Hospital, Memphis, TN (United States); Lykidis, Athanasios [DOE Joint Genome Inst., Walnut Creek, CA (United States); Rock, Charles O. [St. Jude Children' s Research Hospital, Memphis, TN (United States); Jackowski, Suzanne [St. Jude Children' s Research Hospital, Memphis, TN (United States)
2007-09-07
Coenzyme A (CoA) biosynthesis is initiated by pantothenatekinase (PanK) and CoA levels are controlled through differentialexpression and feedback regulation of PanK isoforms. PanK2 is amitochondrial protein in humans, but comparative genomics revealed thatacquisition of a mitochondrial targeting signal was limited to primates.Human and mouse PanK2 possessed similar biochemical properties, withinhibition by acetylCoA and activation by palmitoylcarnitine. Mouse PanK2localized in the cytosol, and the expression of PanK2 was higher in humanbrain compared to mouse brain. Differences in expression and subcellularlocalization should be considered in developing a mouse model for humanPanK2 deficiency.
International Nuclear Information System (INIS)
Someda, H.H.; El Zahhar, A.A.; Shehata, M.K.; El-Naggar, H.A.
2001-01-01
Transition metal ferrocyanides were supported on polyacrylonitrile (PAN) as a binding polymer and were used for removal of radiocesium. The sorption capacity were determined for each sorbent and was found to be 1.22 and 0.65 meq/gm for KZnHCF-PAN and KCuHCF-PAN respectively. Different parameters affecting the sorption process were studied as chemical nature of the active solution, presence of competing ions and flow rate of feed solution. The regeneration of the used sorbent was studied using different solutions and also reusing the regenerated sorbent in other cycle up to four cycles (authors)
Bronchiectasis: a bacteriological profile | Bopaka | Pan African ...
African Journals Online (AJOL)
Pan African Medical Journal. Journal Home · ABOUT · Advanced Search · Current Issue · Archives · Journal Home > Vol 22, No 1 (2015) >. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Download this PDF file. The PDF file you selected should load here if your ...
International Nuclear Information System (INIS)
Sanghwa Oh; Won Sik Shin; Sang-June Choi
2015-01-01
Hydrous manganese oxide-polyacrylonitrile (HMO-PAN) composite was applied for the removal of Co 2+ , Sr 2+ and Cs + from radioactive laundry wastewater. Single- and multi-solute competitive sorptions onto HMO-PAN were investigated. The maximum sorption capacity was in the order of Co 2+ (0.573) > Cs + (0.551) > Sr 2+ (0.310 mmol g -1 ). Sorption of the metals occurred via physical adsorption due to weak van der Waals force and ion exchange with Mn 2+ in HMO-PAN. Sorption behaviors were not related to the types of the surfactants. Among the tested surfactants, SDBS and SOBS remarkably increased the distribution coefficient of Co 2+ and Sr 2+ , respectively. (author)
The hydrochemistry of a semi-arid pan basin case study: Sua Pan, Makgadikgadi, Botswana
International Nuclear Information System (INIS)
Eckardt, Frank D.; Bryant, Robert G.; McCulloch, Graham; Spiro, Baruch; Wood, Warren W.
2008-01-01
This study presents results on the fluid and salt chemistry for the Makgadikgadi, a substantial continental basin in the semi-arid Kalahari. The aims of the study are to improve understanding of the hydrology of such a system and to identify the sources of the solutes and the controls on their cycling within pans. Sampling took place against the backdrop of unusually severe flooding as well as significant anthropogenic extraction of subsurface brines. This paper examines in particular the relationship between the chemistry of soil leachates, fresh stream water, salty lake water, surface salts and subsurface brines at Sua Pan, Botswana with the aim of improving the understanding of the system's hydrology. Occasionally during the short wet season (December-March) surface water enters the saline environment and precipitates mostly calcite and halite, as well as dolomite and traces of other salts associated with the desiccation of the lake. The hypersaline subsurface brine (up to TDS 190,000 mg/L) is homogenous with minor variations due to pumping by BotAsh mine (Botswana Ash (Pty) Ltd.), which extracts 2400 m 3 of brine/h from a depth of 38 m. Notable is the decrease in TDS as the pumping rate increases which may be indicative of subsurface recharge by less saline water. Isotope chemistry for Sr ( 87 Sr/ 86 Sr average 0.722087) and S (δ 34 S average 34.35) suggests subsurface brines have been subject to a lithological contribution of undetermined origin. Recharge of the subsurface brine from surface water including the Nata River appears to be negligible
Structural stability of PAN fiber under high electron beam radiation doses
International Nuclear Information System (INIS)
Pino, Eddy S.; Machado, Luci D.B.; Arruda, Clarissa P. Zelinschi de; Carvalho, Alvaro A. Silva de; Giovedi, Claudia
2009-01-01
Fiber-reinforced composite are an important class of engineering material. A relevant task of composite technology in order to produce materials for structures of high mechanical performance is to obtain the best carbon fiber. One of the main ways to produce carbon fibers of high Young's modulus and tensile strength is to use as starting material polyacrylonitrile (PAN) fibers which after a rigorous and carefully thermal process become carbon fibers. Since some chemical modifications produced in the thermal treatment can be induced by ionizing radiation, the aim of this paper is to evaluate the effect of high electron beam (EB) doses on a commercial PAN fiber in order to evaluate the use of this technology as an alternative treatment to improve the properties and characteristics of the produced carbon fiber. The doses applied were: 0.2, 0.4, 0.6, 0.8, 1.0 and 1.2 MGy. The irradiation effects induced on the PAN fiber were evaluated by Fourier transform infrared spectroscopy (FTIR), differential scanning calorimetry (DSC) and thermogravimetry (TG). FTIR obtained data have shown that the main functional groups remain practically unchanged in the non-irradiated and irradiated samples. The single DSC exothermic peak obtained for non-irradiated sample, becomes a double peak after the irradiation, presenting lower initial and higher final temperatures for exothermic DSC curves. The enthalpy involved in the chemical reaction decreases for irradiated samples as compared with the non-irradiated PAN fiber. TG data have shown that irradiated samples start a decomposition process at lower temperatures compared to the non-irradiated sample. (author)
Climate Prediction Center (CPC) U.S. Pan Evaporation Observations
National Oceanic and Atmospheric Administration, Department of Commerce — Observational reports of daily pan evaporation (1200 UTC to 1200 UTC) are made by members of the NWS Cooperative Network (COOP) or supplemental networks of NOAA's...
Pan-London tuberculosis services: a service evaluation
Directory of Open Access Journals (Sweden)
Belling Ruth
2012-07-01
Full Text Available Abstract Background London has the largest proportion of tuberculosis (TB cases of any western European capital, with almost half of new cases drug-resistant. Prevalence varies considerably between and within boroughs with research suggesting inadequate control of TB transmission in London. Economic pressures may exacerbate the already considerable challenges for service organisation and delivery within this context. This paper presents selected findings from an evaluation of London’s TB services’ organisation, delivery, professional workforce and skill mix, intended to support development of a strategic framework for a pan-London TB service. These may also interest health service professionals and managers in TB services in the UK, other European cities and countries and in services currently delivered by multiple providers operating independently. Methods Objectives were: 1 To establish how London’s TB services are structured and delivered in relation to leadership, management, organisation and delivery, coordination, staffing and support; 2 To identify tools/models for calculating skill mix as a basis for identifying skill mix requirements in delivering TB services across London; 3 To inform a strategic framework for the delivery of a pan-London TB service, which may be applicable to other European cities. The multi-method service audit evaluation comprised documentary analysis, semi-structured interviews with TB service users (n = 10, lead TB health professionals and managers (n = 13 representing London’s five sectors and focus groups with TB nurses (n = 8 and non-London network professionals (n = 2. Results Findings showed TB services to be mainly hospital-based, with fewer community-based services. Documentary analysis and professionals’ interviews suggested difficulties with early access to services, low suspicion index amongst some GPs and restricted referral routes. Interviews indicated lack of managed
Klimentov, A.; De, K.; Jha, S.; Maeno, T.; Nilsson, P.; Oleynik, D.; Panitkin, S.; Wells, J.; Wenaus, T.
2016-10-01
The.LHC, operating at CERN, is leading Big Data driven scientific explorations. Experiments at the LHC explore the fundamental nature of matter and the basic forces that shape our universe. ATLAS, one of the largest collaborations ever assembled in the sciences, is at the forefront of research at the LHC. To address an unprecedented multi-petabyte data processing challenge, the ATLAS experiment is relying on a heterogeneous distributed computational infrastructure. The ATLAS experiment uses PanDA (Production and Data Analysis) Workload Management System for managing the workflow for all data processing on over 150 data centers. Through PanDA, ATLAS physicists see a single computing facility that enables rapid scientific breakthroughs for the experiment, even though the data centers are physically scattered all over the world. While PanDA currently uses more than 250,000 cores with a peak performance of 0.3 petaFLOPS, LHC data taking runs require more resources than grid can possibly provide. To alleviate these challenges, LHC experiments are engaged in an ambitious program to expand the current computing model to include additional resources such as the opportunistic use of supercomputers. We will describe a project aimed at integration of PanDA WMS with supercomputers in United States, in particular with Titan supercomputer at Oak Ridge Leadership Computing Facility. Current approach utilizes modified PanDA pilot framework for job submission to the supercomputers batch queues and local data management, with light-weight MPI wrappers to run single threaded workloads in parallel on LCFs multi-core worker nodes. This implementation was tested with a variety of Monte-Carlo workloads on several supercomputing platforms for ALICE and ATLAS experiments and it is in full pro duction for the ATLAS since September 2015. We will present our current accomplishments with running PanDA at supercomputers and demonstrate our ability to use PanDA as a portal independent of the
GigaPan Technology to Enhance In-Class and In-Field Learning in Community College Settings
Villalobos, J. I.; Bentley, C.
2014-12-01
Community college students account for over 40% of all undergraduates in the United States as well as the majority of minority and non-traditional students attending undergraduate courses. Implementing innovative, cost effective, and formative pedagogies to the diverse backgrounds of students that typically enroll at a community is often a challenge. Interactive pedagogies in geology pose a unique challenge considering that students gain the most long-term knowledge when topics covered in a course are exposed to them in outdoor settings where they are allowed to explore and make connections. The ability to expose students to real world examples is challenging to many community college faculty considering that that many; lack funds or means for transportation of students, do not have administrative support on such endeavors, teach evening or night classes, or have a high percentage of students who are physically limited or have obligations to work and family. A joint collaborative between El Paso Community College (EPCC) and Northern Virginia Community College (NOVA) has explored the usage of GigaPan technology to create multi-layered online material to minimize these issues faced by many community college faculty and students. The primary layer of the online material is GigaPans of local geological sites that highlight large-scale structures in the El Paso, Texas region that are commonly used in local field trips and lab book material. The second layer is of Macro-GigaPans of hand samples of key outcrops from the primarily GigaPans which facilitate student learning, exploration, and ability to make connections by exploring smaller scale features of the primary layer. A third layer of online material, GigaPans of thin sections of hand samples (from secondary layers), and curriculum based on the GigaPans was then created to assist students in evaluating proposed hypotheses on the primary layers' geological origin. GigaPan cirriculum was utilized in introductory
International Nuclear Information System (INIS)
Klimentov, A; Maeno, T; Nilsson, P; Panitkin, S; Wenaus, T; De, K; Oleynik, D; Jha, S; Wells, J
2016-01-01
The.LHC, operating at CERN, is leading Big Data driven scientific explorations. Experiments at the LHC explore the fundamental nature of matter and the basic forces that shape our universe. ATLAS, one of the largest collaborations ever assembled in the sciences, is at the forefront of research at the LHC. To address an unprecedented multi-petabyte data processing challenge, the ATLAS experiment is relying on a heterogeneous distributed computational infrastructure. The ATLAS experiment uses PanDA (Production and Data Analysis) Workload Management System for managing the workflow for all data processing on over 150 data centers. Through PanDA, ATLAS physicists see a single computing facility that enables rapid scientific breakthroughs for the experiment, even though the data centers are physically scattered all over the world. While PanDA currently uses more than 250,000 cores with a peak performance of 0.3 petaFLOPS, LHC data taking runs require more resources than grid can possibly provide. To alleviate these challenges, LHC experiments are engaged in an ambitious program to expand the current computing model to include additional resources such as the opportunistic use of supercomputers. We will describe a project aimed at integration of PanDA WMS with supercomputers in United States, in particular with Titan supercomputer at Oak Ridge Leadership Computing Facility. Current approach utilizes modified PanDA pilot framework for job submission to the supercomputers batch queues and local data management, with light-weight MPI wrappers to run single threaded workloads in parallel on LCFs multi-core worker nodes. This implementation was tested with a variety of Monte-Carlo workloads on several supercomputing platforms for ALICE and ATLAS experiments and it is in full pro duction for the ATLAS since September 2015. We will present our current accomplishments with running PanDA at supercomputers and demonstrate our ability to use PanDA as a portal independent of the
Failure of pan-retinal laser photocoagulation to regress ...
African Journals Online (AJOL)
Objectives: (i) To illustrate the occurrence of failure of regression of neovascularization (NV) following adequate initial and supplemental pan-retinal laser photo- coagulation (PRP) using 3 case histories (ii) To review the literature on possible aetiogenesis and further management options. Methods: The hospital records of 3 ...
Mixing studies at low grade vacuum pan using the radiotracer method
International Nuclear Information System (INIS)
Griffith, J.M
1999-01-01
In this paper, some preliminary results achieved in the evaluation of the homogenization time at a vacuum pan for massecuite b and seed preparation , using two approaches of the radiotracer method, are presented. Practically no difference between the o n line , using small size detector and the sampling methods, in mixing studies performed at the high-grade massecuite was detected. Results achieved during the trials performed at the vacuum station show that the mechanical agitation in comparison with normal agitation improves the performance of mixing in high-grade massecuite b and in seed preparation at the vacuum pan