WorldWideScience

Sample records for paier kerli piir

  1. Redesign av Escola forlag sine skoleordbøker

    OpenAIRE

    Heggen, Inger Helene

    2007-01-01

    Rapporten består av en litteraturstudie (med begrepsavklaringer og en gjennomgang av ordboktypografiens historie – med hovedvekt på engelsk ordboktypografi), en analyse av ettspråklige ordbøker i dag (både norske og engelske), og en analyse av Escola Forlags ordbøker (bokmål og nynorsk utgave). Til slutt – en demononstrasjon av min resulterende redesign av ordbøkene (omslag og innmat). Her har det vært særlig viktig å tydeliggjøre oppslagsordene og oppslagsordenes underelementer s...

  2. Kerli ja Rulers of the Deep jahivad MTV auhinda

    Index Scriptorium Estoniae

    2008-01-01

    6. novembril toimuval MTV Euroopa muusikaauhindade galal pürgivad parima Balti artisti tiilile Kerli Kõiv ja duo Rulers of the Deep, leedust ansambel Happyendless ja laulja Jurga ning lätist ansambel Detlef Zoo (parima regionaalse artisti kategooria nominentide poolt saab hääletada kuni 2. oktoobrini veebilehel www.mtvema.com)

  3. Hypertension and sexual dysfunction | Ker | South African Family ...

    African Journals Online (AJOL)

    South African Family Practice. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 54, No 2 (2012) >. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register. Hypertension and sexual dysfunction. JA Ker. Abstract.

  4. Kerää Disney Klassikot -kampanja : Verkkokauppa hypermarketin haastajana

    OpenAIRE

    Sarajisto, Mari-Susanna

    2015-01-01

    Tämän opinnäytetyön tarkoituksena oli tutkia Disney Klassikot –keräilykampanjaa 2015, keskittyen Suomen ensimmäiseen kvartaaliin Q1. Työn toimeksiantaja toimi The Walt Disney Company Nordic Suomen toimisto. Opinnäytetyön tavoitteena oli tuottaa toimeksiantajalle tietoa kampanjatoteutuksista ja Disney-brändin vaalimisesta valituissa jakeluteissä. Ensimmäistä kertaa Disney kampanjan kohdalla jakelutiet pääsivät vaikuttamaan kampanjatoteu-tukseen. Tutkimuksen tarkoituksena oli löytää uutta tutki...

  5. Phase diagrams of KY(WO4)2-KEr(WO4)2, KGd(WO4)2-KEr(WO4)2 systems and single crystal growth for some tungstates

    International Nuclear Information System (INIS)

    Yudanova, L.I.; Pavlyuk, A.A.; Potapova, O.G.

    1992-01-01

    Phase diagrams of the KY(WO 4 ) 2 -KEr(WO 4 ) 2 , KGd(WO 4 ) 2 -KEr(WO 4 ) 2 systems were studied by differential thermal and X-ray diffraction analyses. Continuous variety of solid solutions are in the KY(WO 4 ) 2 -KEr(WO 4 ) 2 system. They occurred just as in the area of alphaso beta-modifications. Limited areas of the solid solutions based on components were in the KGd(WO 4 ) 2 -KEr(WO 4 ) 2 system. Monocrystals of potassium-yttrium and potassium-gadolinium tungstates activated by erbium were grown using modified low-gradient Czochralski method

  6. Estimating the Recreational-Use Value for Hiking in Bellenden Ker National Park, Australia

    NARCIS (Netherlands)

    Nillesen, E.E.M.; Wesseler, J.H.H.

    2005-01-01

    The recreational-use value of hiking in the Bellenden Ker National Park, Australia has been estimated using a zonal travel cost model. Multiple destination visitors have been accounted for by converting visitors' own ordinal ranking of the various sites visited to numerical weights, using an

  7. Mis mõtteid tekitab õpetaja kutsestandardi projekt? / Kerli Prass, Kalle Kalda, Loone Ots, Külli Arand

    Index Scriptorium Estoniae

    2013-01-01

    Vastasid SA Noored Kooli tuutor ja õpetajakoolituse koordinaator Kerli Prass, lastekaitse liidu president Loone Ots, Tartu haridustöötajate liidu esimees Kalle Kalda, Tallinna Saksa Gümnaasiumi klassiõpetaja Külli Arand

  8. Immunolocalization of lipoxygenase in the microspore of Gagea lutea (L. Ker.-Gaw.

    Directory of Open Access Journals (Sweden)

    Ewa Szczuka

    2012-12-01

    Full Text Available Localization of lipoxygenase (LOX in the microspore of Gagea lutea (L. Ker.-Gaw. was investigated with the immunogold labelling method. The enzyme was found in the cytoplasm, nucleus and sporoderm. The most intensive reaction was observed in the cytoplasm, where the immunogold particles were sometimes grouped into clusters of several or more and showed the highest density. The smallest amount of particles occured in the sporoderm. The role of lipoxygenase in the microspore is discussed.

  9. Kus on soojustuse piir?

    Index Scriptorium Estoniae

    2004-01-01

    Konkursil "Ehitaja aastaehitis 2003" kandideeris eramute grupis tiitlile pereelamu Tartust. Kandidaadiks pakkus selle Saint-Gobain Isover Eesti põhjendusega, et tegu on nii soojapidava hoonega, mida saab kulutusi kartmata kütta elektriga. Hoone soojustusest

  10. Estimating the Recreational-Use Value for Hiking in Bellenden Ker National Park, Australia

    OpenAIRE

    Nillesen, E.E.M.; Wesseler, J.H.H.

    2005-01-01

    The recreational-use value of hiking in the Bellenden Ker National Park, Australia has been estimated using a zonal travel cost model. Multiple destination visitors have been accounted for by converting visitors' own ordinal ranking of the various sites visited to numerical weights, using an expected-value approach. The value of hiking and camping in this national park was found to be $AUS 250,825 per year, or $AUS 144,45 per visitor per year, which is similar to findings from other studies v...

  11. Implementation and Performance of FPGA based track fitting for the Atlas Fast TracKer

    CERN Document Server

    Zou, Rui; The ATLAS collaboration

    2018-01-01

    The Fast TracKer (FTK) within the ATLAS trigger system provides global track reconstruction for all events passing the ATLAS Level 1 trigger by dividing the detector into parallel processing pipelines that implement pattern matching in custom integrated circuits and data routing, reduction, and parameter extraction in FPGAs. In this presentation we will describe the implementation of a critical component of the system which does partial track fitting using a method based on a principal component analysis at a rate of greater than 1 fit per 10 ps, system-wide, to reduce the output of the pattern matching. Firmware design, timing performance and preliminary results will be discussed.

  12. The Associative Memory Serial Link Processor for the Fast TracKer (FTK) at ATLAS

    International Nuclear Information System (INIS)

    Andreani, A; Citterio, M; Liberali, V; Annovi, A; Beretta, M; Beccherle, R; Crescioli, F; Biesuz, N; Billereau, W; Combe, J M; Cipriani, R; Citraro, S; Donati, S; Giannetti, P; Luciano, P; Colombo, A; Dimas, D; Gentsos, C; Kordas, K; Lanza, A

    2014-01-01

    The Fast TracKer (FTK) is an extremely powerful and very compact processing unit, essential for efficient Level 2 trigger selection in future high-energy physics experiments at the LHC. FTK employs Associative Memories (AM) to perform pattern recognition; input and output data are transmitted over serial links at 2 Gbit/s to reduce routing congestion at the board level. Prototypes of the AM chip and of the AM board have been manufactured and tested, in preparation of the imminent design of the final version

  13. Big Data Challenges in High Energy Physics Experiments: The ATLAS (CERN) Fast TracKer Approach

    CERN Document Server

    Sotiropoulou, Calliope Louisa; The ATLAS collaboration

    2016-01-01

    We live in the era of “Big Data” problems. Massive amounts of data are produced and captured, data that require significant amounts of filtering to be processed in a realistically useful form. An excellent example of a “Big Data” problem is the data processing flow in High Energy Physics experiments, in our case the ATLAS detector in CERN. In the Large Hadron Collider (LHC) 40 million collisions of bunches of protons take place every second, which is about 15 trillion collisions per year. For the ATLAS detector alone 1 Mbyte of data is produced for every collision or 2000 Tbytes of data per year. Therefore what is needed is a very efficient real-time trigger system to filter the collisions (events) and identify the ones that contain “interesting” physics for processing. One of the upgrades of the ATLAS Trigger system is the Fast TracKer system. The Fast TracKer is a real-time pattern matching machine able to reconstruct the tracks of the particles in the inner silicon detector of the ATLAS experim...

  14. FTK: the hardware Fast TracKer of the ATLAS experiment at CERN

    CERN Document Server

    Maznas, Ioannis; The ATLAS collaboration

    2016-01-01

    FTK: the hardware Fast TracKer of the ATLAS experiment at CERN In the ever increasing pile-up of the Large Hadron Collider environment, the trigger systems of the experiments have to be exceedingly sophisticated and fast at the same time, in order to select the relevant physics processes against the background processes. The Fast TracKer (FTK) is a track finding implementation at hardware level that is designed to deliver full-scan tracks with $p_{T}$ above 1 GeV to the ATLAS trigger system for every L1 accept (at a maximum rate of 100kHz). To accomplish this, FTK is a highly parallel system which is currently under installation in ATLAS. It will first provide the trigger system with tracks in the central region of the ATLAS detector, and next year it is expected to cover the whole detector. The system is based on pattern matching between hits coming from the silicon trackers of the ATLAS detector and 1 billion simulated patterns stored in specially designed ASIC chips (Associative memory – AM06). In a firs...

  15. Kaubamärgiõiguse rikkumisega tekitatud kahju hüvitamine / Kerli Tiik, Indrek Eelmets, Carri Ginter

    Index Scriptorium Estoniae

    Tiik, Kerli

    2012-01-01

    Hüvitise arvutamise meetoditest: hüpoteetilise litsentsitasu meetodist ja rikkumisega teenitud tulu väljanõudmise meetodist. Vastavatest Saksa, Rootsi ja Taani kohtulahenditest ning Eesti kehtivast õigusest ja kohtupraktikast. Artikkel põhineb Kerli Tiigi samanimelisel bakalaureusetööl

  16. ker lyftteknik inom akutvården : Ett produktutvecklingsarbete

    OpenAIRE

    Kullberg, Björn

    2015-01-01

    Det här examensarbetet är ett utvecklingsarbete beställt av APSLC. Examensarbetets slutprodukt är en Power Point-fil som presenterar teori om säkra lyfttekni-ker samt visar modellutföranden för grunderna i säkra lyfttekniker. Avsikten för själva examensarbetet är att producera ett självstudiematerial av så hög kvalitét att det kan användas av akutvårdslinjen vid Arcada. Målet med slutprodukten är att öka akutvårdsstuderandes kunskaper om säkra lyfttekniker, så att studerande genom propriocept...

  17. Estimating the recreational-use value for hiking in Bellenden Ker National Park, Australia.

    Science.gov (United States)

    Nillesen, Eleonora; Wesseler, Justus; Cook, Averil

    2005-08-01

    The recreational-use value of hiking in the Bellenden Ker National Park, Australia has been estimated using a zonal travel cost model. Multiple destination visitors have been accounted for by converting visitors' own ordinal ranking of the various sites visited to numerical weights, using an expected-value approach. The value of hiking and camping in this national park was found to be dollar AUS 250,825 per year, or dollar AUS 144,45 per visitor per year, which is similar to findings from other studies valuing recreational benefits. The management of the park can use these estimates when considering the introduction of a system of user pays fees. In addition, they might be important when decisions need to be made about the allocation of resources for maintenance or upgrade of tracks and facilities.

  18. FTK: The hardware Fast TracKer of the ATLAS experiment at CERN

    CERN Document Server

    AUTHOR|(INSPIRE)INSPIRE-00525014; The ATLAS collaboration

    2017-01-01

    In the ever increasing pile-up of the Large Hadron Collider environment the trigger systems of the experiments have to be exceedingly sophisticated and fast at the same time in order to increase the rate of relevant physics processes with respect to background processes. The Fast TracKer (FTK) is a track finding implementation at hardware level that is designed to deliver full-scan tracks with $p_{T}$ above 1GeV to the ATLAS trigger system for every L1 accept (at a maximum rate of 100kHz). To accomplish this, FTK is a highly parallel system which is currently under installation in ATLAS. It will first provide the trigger system with tracks in the central region of the ATLAS detector, and next year it is expected that it will cover the whole detector. The system is based on pattern matching between hits coming from the silicon trackers of the ATLAS detector and 1 billion simulated patterns stored in specially designed ASIC chips (Associative Memory – AM06). In a first stage, coarse resolution hits are matche...

  19. FTK: The hardware Fast TracKer of the ATLAS experiment at CERN

    Directory of Open Access Journals (Sweden)

    Maznas Ioannis

    2017-01-01

    Full Text Available In the ever increasing pile-up environment of the Large Hadron Collider, trigger systems of the experiments must use more sophisticated techniques in order to increase purity of signal physics processes with respect to background processes. The Fast TracKer (FTK is a track finding system implemented in custom hardware that is designed to deliver full-scan tracks with pT above 1 GeV to the ATLAS trigger system for every Level-1 (L1 accept (at a maximum rate of 100 kHz. To accomplish this, FTK is a highly parallel system which is currently being installed in ATLAS. It will first provide the trigger system with tracks in the central region of the ATLAS detector, and next year it is expected that it will cover the whole detector. The system is based on pattern matching between hits coming from the silicon trackers of the ATLAS detector and one billion simulated patterns stored in specially designed ASIC Associative Memory chips. This document will provide an overview of the FTK system architecture, its design and information about its expected performance.

  20. The Associative Memory Serial Link Processor of the ALTAS Fast TracKer Processing System

    CERN Document Server

    Sotiropoulou, Calliope Louisa; The ATLAS collaboration

    2017-01-01

    The upgraded Trigger and Data Acquisition (TDAQ) system of the ATLAS experiment at the LHC will improve the capability of the detector to select the events with the greatest scientific potential. The Fast TracKer (FTK) is one of the ATLAS TDAQ upgrades that is presently under commissioning. FTK is a custom hardware system that feeds the High Level Trigger (HLT) with charged particle tracks reconstructed from hits in silicon detectors at the rate of 105 events per second. The main processing element of FTK is the Associative Memory (AM) system that is used to perform pattern matching with a high degree of parallelism. Its implementation is called the AM Board Serial Link Processor (AMBSLP) and it is a very efficient pattern matching machine that handles in parallel massive data samples. The AMBSLP consists of two types of boards: the Little Associative Memory Board (LAMB), a mezzanine where the AM chips are mounted, and the Associative Memory Board (AMB), a 9U VME motherboard that hosts four LAMB daughter-boar...

  1. A Hardware Fast Tracker for the ATLAS Trigger: The Fast TracKer (FTK) Project.

    CERN Document Server

    Asbah, Nedaa; The ATLAS collaboration

    2015-01-01

    The trigger system of the ATLAS experiment is designed to reduce the event rate from the LHC nominal bunch crossing at 40 MHz to about 1 kHz, at the design luminosity of 10^{34} cm^{-2} s{-1}. After a successful period of data taking from 2010 to early 2013, the LHC is restarting in 2015 with much higher instantaneous luminosity and this will increase the load on High Level Trigger system, the second stage of the selection based on software algorithms. More sophisticated algorithms will be needed to achieve higher background rejection while maintaining good efficiency for interesting physics signals. The Fast TracKer is part of the ATLAS trigger upgrade project; it is a hardware processor that will provide, at every level-1 accept (100 kHz) and within 100 microseconds, full tracking information for tracks with momentum as low as 1 GeV. Providing fast extensive access to tracking information, with resolution comparable to the offline reconstruction, the Fast Tracker will for example help the High Level Trigger...

  2. Hardware-based Tracking at Trigger Level for ATLAS: The Fast TracKer (FTK) Project

    CERN Document Server

    Gramling, Johanna; The ATLAS collaboration

    2015-01-01

    Physics collisions at 13 TeV are expected at the LHC with an average of 40-50 proton-proton collisions per bunch crossing. Tracking at trigger level is an essential tool to control the rate in high-pileup conditions while maintaining a good efficiency for relevant physics processes. The Fast TracKer (FTK) is an integral part of the trigger upgrade for the ATLAS detector. For every event passing the Level 1 trigger (at a maximum rate of 100 kHz) the FTK receives data from the 80 million channels of the silicon detectors, providing tracking information to the High Level Trigger in order to ensure a selection robust against pile-up. The FTK performs a hardware- based track reconstruction, using associative memory (AM) that is based on the use of a custom chip, designed to perform pattern matching at very high speed. It finds track candidates at low resolution (roads) that seed a full-resolution track fitting done by FPGAs. Narrow roads permit a fast track fitting but need many patterns stored in the AM to ensure...

  3. Hardware-based Tracking at Trigger Level for ATLAS the Fast TracKer (FTK) Project

    CERN Document Server

    INSPIRE-00245767

    2015-01-01

    Physics collisions at 13 TeV are expected at the LHC with an average of 40-50 proton-proton collisions per bunch crossing under nominal conditions. Tracking at trigger level is an essential tool to control the rate in high-pileup conditions while maintaining a good efficiency for relevant physics processes. The Fast TracKer is an integral part of the trigger upgrade for the ATLAS detector. For every event passing the Level-1 trigger (at a maximum rate of 100 kHz) the FTK receives data from all the channels of the silicon detectors, providing tracking information to the High Level Trigger in order to ensure a selection robust against pile-up. The FTK performs a hardware-based track reconstruction, using associative memory that is based on the use of a custom chip, designed to perform pattern matching at very high speed. It finds track candidates at low resolution (roads) that seed a full-resolution track fitting done by FPGAs. An overview of the FTK system with focus on the pattern matching procedure will be p...

  4. Placement Of Cardiac PacemaKEr Trial (POCKET – rationale and design: a randomized controlled trial

    Directory of Open Access Journals (Sweden)

    Peter Magnusson

    2017-04-01

    Full Text Available Background: A pacemaker system consists of one or two leads connected to a device that is implanted into a pocket formed just below the collarbone. This pocket is typically subcutaneous, that is, located just above the pectoral fascia. Even though the size of pacemakers has decreased markedly, complications due to superficial implants do occur. An alternative technique would be intramuscular placement of the pacemaker device, but there are no randomized controlled trials (RCTs to support this approach, which is the rationale for the Placement Of Cardiac PacemaKEr Trial (POCKET. The aim is to study if intramuscular is superior to subcutaneous placement of a pacemaker pocket. Methods: In October 2016, we started to enroll 200 consecutive patients with an indication for bradycardia pacemaker implantation. Patients are randomized to random block sizes, stratified by age group (cut-off: 65 years and sex, and then randomized to either subcutaneous or intramuscular implant. A concealed allocation procedure is employed, using sequentially numbered, sealed envelopes. Pocket site is blinded to the patient and in all subsequent care. The primary endpoint is patient overall satisfaction with the pocket location at 24 months as measured using a visual analog scale (VAS 0-10. Secondary endpoints are: complications, patient-reported satisfaction at 1, 12, and 24 months (overall satisfaction, pain, discomfort, degree of unsightly appearance, movement problems, and sleep problems due to device. Conclusions: POCKET is a prospective interventional RCT designed to evaluate if intramuscular is superior to subcutaneous placement of a bradycardia pacemaker during a two-year follow-up.

  5. Placement Of Cardiac PacemaKEr Trial (POCKET – rationale and design: a randomized controlled trial

    Directory of Open Access Journals (Sweden)

    Peter Magnusson

    2017-04-01

    Full Text Available BackgroundA pacemaker system consists of one or two leads connected to a device that is implanted into a pocket formed just below the collarbone. This pocket is typically subcutaneous, that is, located just above the pectoral fascia. Even though the size of pacemakers has decreased markedly, complications due to superficial implants do occur. An alternative technique would be intramuscular placement of the pacemaker device, but there are no randomized controlled trials (RCTs to support this approach, which is the rationale for the Placement Of Cardiac PacemaKEr Trial (POCKET. The aim is to study if intramuscular is superior to subcutaneous placement of a pacemaker pocket.MethodsIn October 2016, we started to enroll 200 consecutive patients with an indication for bradycardia pacemaker implantation. Patients are randomized to random block sizes, stratified by age group (cut-off: 65 years and sex, and then randomized to either subcutaneous or intramuscular implant. A concealed allocation procedure is employed, using sequentially numbered, sealed envelopes. Pocket site is blinded to the patient and in all subsequent care. The primary endpoint is patient overall satisfaction with the pocket location at 24 months as measured using a visual analog scale (VAS 0-10. Secondary endpoints are: complications, patient-reported satisfaction at 1, 12, and 24 months (overall satisfaction, pain, discomfort, degree of unsightly appearance, movement problems, and sleep problems due to device.ConclusionsPOCKET is a prospective interventional RCT designed to evaluate if intramuscular is superior to subcutaneous placement of a bradycardia pacemaker during a two-year follow-up.

  6. Mechanical Hybrid KERS Based on Toroidal Traction Drives: An Example of Smart Tribological Design to Improve Terrestrial Vehicle Performance

    Directory of Open Access Journals (Sweden)

    Francesco Bottiglione

    2013-01-01

    Full Text Available We analyse in terms of efficiency and traction capabilities a recently patented traction drive, referred to as the double roller full-toroidal variator (DFTV. We compare its performance with the single roller full-toroidal variator (SFTV and the single roller half-toroidal variator (SHTV. Modeling of these variators involves challenging tribological issues; the traction and efficiency performances depend on tribological phenomena occurring at the interface between rollers and disks, where the lubricant undergoes very severe elastohydrodynamic lubrication regimes. Interestingly, the DFTV shows an improvement of the mechanical efficiency over a wide range of transmission ratios and in particular at the unit speed ratio as in such conditions in which the DFTV allows for zero-spin, thus strongly enhancing its traction capabilities. The very high mechanical efficiency and traction performances of the DFTV are exploited to investigate the performance of a flywheel-based Kinetic Energy Recovery System (KERS, where the efficiency of the variator plays an important role in determining the overall energy recovery performance. The energy boost capabilities and the round-trip efficiency are calculated for the three different variators considered in this study. The results suggest that the energy recovery potential of the mechanical KERS can be improved with a proper choice of the variator.

  7. Euroopa Sotsiaalfondi vahendid Eesti noortekeskustes - kasutus, tulemused ja mõju noortekeskustele ning ühiskonnale / Heidi Paabort ; kommenteerinud Kerli Kõiv, Tiina Sinijärv, Aire Pruus

    Index Scriptorium Estoniae

    Paabort, Heidi

    2013-01-01

    ESFi programmide tulemusel toimunud muutusi noorsootöös kommenteerivad Rõuge vallavalitsuse noorsootöö spetsialist Kerli Kõiv, Keila ANK ja Keila Noortekeskuse juhataja Tiina Sinijärv ja Nursi noorsootöös osaleja Aire Pruus

  8. 4C-ker: A Method to Reproducibly Identify Genome-Wide Interactions Captured by 4C-Seq Experiments.

    Science.gov (United States)

    Raviram, Ramya; Rocha, Pedro P; Müller, Christian L; Miraldi, Emily R; Badri, Sana; Fu, Yi; Swanzey, Emily; Proudhon, Charlotte; Snetkova, Valentina; Bonneau, Richard; Skok, Jane A

    2016-03-01

    4C-Seq has proven to be a powerful technique to identify genome-wide interactions with a single locus of interest (or "bait") that can be important for gene regulation. However, analysis of 4C-Seq data is complicated by the many biases inherent to the technique. An important consideration when dealing with 4C-Seq data is the differences in resolution of signal across the genome that result from differences in 3D distance separation from the bait. This leads to the highest signal in the region immediately surrounding the bait and increasingly lower signals in far-cis and trans. Another important aspect of 4C-Seq experiments is the resolution, which is greatly influenced by the choice of restriction enzyme and the frequency at which it can cut the genome. Thus, it is important that a 4C-Seq analysis method is flexible enough to analyze data generated using different enzymes and to identify interactions across the entire genome. Current methods for 4C-Seq analysis only identify interactions in regions near the bait or in regions located in far-cis and trans, but no method comprehensively analyzes 4C signals of different length scales. In addition, some methods also fail in experiments where chromatin fragments are generated using frequent cutter restriction enzymes. Here, we describe 4C-ker, a Hidden-Markov Model based pipeline that identifies regions throughout the genome that interact with the 4C bait locus. In addition, we incorporate methods for the identification of differential interactions in multiple 4C-seq datasets collected from different genotypes or experimental conditions. Adaptive window sizes are used to correct for differences in signal coverage in near-bait regions, far-cis and trans chromosomes. Using several datasets, we demonstrate that 4C-ker outperforms all existing 4C-Seq pipelines in its ability to reproducibly identify interaction domains at all genomic ranges with different resolution enzymes.

  9. Improved catalytic efficiency, thermophilicity, anti-salt and detergent tolerance of keratinase KerSMD by partially truncation of PPC domain.

    Science.gov (United States)

    Fang, Zhen; Zhang, Juan; Du, Guocheng; Chen, Jian

    2016-06-14

    The keratinase from Stenotrophomonas maltophilia (KerSMD) is known for its high activity and pH stability in keratin degradation. However, catalytic efficiency and detergent tolerability need to be improved in order to be used for industrial application. In this work, we obtained several keratinase variants with enhanced catalytic efficiency, thermophilicity, and anti-salt and detergent tolerability by partially truncating the PPC domain of KerSMD. The variants all showed improved catalytic efficiency to synthetic substrate AAPF, with the V355 variant having the highest kcat /Km value of 143.6 s(-1) mM(-1). The truncation of keratinase had little effect on alkaline stability but obviously decreased collagenase activity, developing its potential application in leather treatment. The variants V380, V370, and V355 were thermophilic, with a 1.7-fold enhancement of keratinlytic activity at 60 °C when compared to the wild type. The entire truncation of PPC domain obtained the variant V355 with improved tolerance to alkalinity, salt, chaotropic agents, and detergents. The V355 variant showed more than a 40% improvement in activity under 15% (w/v) NaCl or 4% (w/v) SDS solution, showing excellent stability under harsh washing and unhairing conditions. Our work investigated how protein engineering affects the function of PPC domain of KerSMD.

  10. 4C-ker: A Method to Reproducibly Identify Genome-Wide Interactions Captured by 4C-Seq Experiments.

    Directory of Open Access Journals (Sweden)

    Ramya Raviram

    2016-03-01

    Full Text Available 4C-Seq has proven to be a powerful technique to identify genome-wide interactions with a single locus of interest (or "bait" that can be important for gene regulation. However, analysis of 4C-Seq data is complicated by the many biases inherent to the technique. An important consideration when dealing with 4C-Seq data is the differences in resolution of signal across the genome that result from differences in 3D distance separation from the bait. This leads to the highest signal in the region immediately surrounding the bait and increasingly lower signals in far-cis and trans. Another important aspect of 4C-Seq experiments is the resolution, which is greatly influenced by the choice of restriction enzyme and the frequency at which it can cut the genome. Thus, it is important that a 4C-Seq analysis method is flexible enough to analyze data generated using different enzymes and to identify interactions across the entire genome. Current methods for 4C-Seq analysis only identify interactions in regions near the bait or in regions located in far-cis and trans, but no method comprehensively analyzes 4C signals of different length scales. In addition, some methods also fail in experiments where chromatin fragments are generated using frequent cutter restriction enzymes. Here, we describe 4C-ker, a Hidden-Markov Model based pipeline that identifies regions throughout the genome that interact with the 4C bait locus. In addition, we incorporate methods for the identification of differential interactions in multiple 4C-seq datasets collected from different genotypes or experimental conditions. Adaptive window sizes are used to correct for differences in signal coverage in near-bait regions, far-cis and trans chromosomes. Using several datasets, we demonstrate that 4C-ker outperforms all existing 4C-Seq pipelines in its ability to reproducibly identify interaction domains at all genomic ranges with different resolution enzymes.

  11. The EDRO board connected to the Associative Memory: a "Baby" FastTracKer processor for the ATLAS experiment

    CERN Document Server

    Annovi, A; Bevacqua, V; Cervigni, F; Crescioli, F; Fabbri, L; Giannetti, P; Giorgi, F; Magalotti, D; Negri, A; Piendibene, M; Roda, C; Sbarra, C; Villa, M; Vitillo, RA; Volpi, G

    2012-01-01

    The FastTracKer (FTK), a hardware dedicated processor, performs fast and precise online full track reconstruction at the ATLAS experiment, within an average latency of few dozens of microseconds. \\ It is made of two pipelined processors, the Associative Memory finding low precision tracks, and the Track Fitter refining the track quality with high precision fits. FTK has to face the Large Hadron Collider (LHC) Phase I luminosity. So, while the new processor requires the best of the available technology for tracking in high occupancy conditions, we want to use already existing prototypes to exercise soon the FTK functions in the new ATLAS environment. Few boards connected together constitute a "baby FTK" that will grow soon becoming the "vertical slice".\\ The vertical slice will cover a small projective wedge in the detector, but it will be functionally complete. It will provide a full test of the entire FTK data chain, in the laboratory first and on beam-on conditions after. It will require early development a...

  12. The EDRO board connected to the Associative Memory: a "Baby" FastTracKer processor for the ATLAS experiment

    CERN Document Server

    Annovi, A; The ATLAS collaboration; Villa, M; Bevacqua, V; Vitillo, R A; Giorgi, F; Magalotti, D; Roda, C; Cervigni, F; Giannetti, P; Negri, A; Piendibene, M; Volpi, G; Fabbri, L; Sbarra, C

    2011-01-01

    The FastTracKer (FTK) is a dedicated hardware system able to perform online fast and precise track reconstruction of the full events at the Atlas experiment, within an average latency of few dozens of microseconds. It is made of two pipelined processors: the Associative Memory (AM), finding low precision tracks called "roads", and the Track Fitter (TF), refining the track quality with high precision fits. The FTK design [1] that works well at the Large Hadron Collider (LHC) Phase I luminosity requires the best of the available technology for tracking in high occupancy conditions. While the new processor is designed for the most demanding LHC conditions, we want to use already existing prototypes, part of them developed for the SLIM5 collaboration [2], to exercise the FTK functions in the new Atlas environment. During Laboratory tests, the EDRO board (Event Dispatch and Read-Out) receives on a clustering mezzanine (able to calculate the pixel and SCT cluster centroids) "fake" detector raw data on S-links from ...

  13. A Parallel FPGA Implementation for Real-Time 2D Pixel Clustering for the ATLAS Fast TracKer Processor

    CERN Document Server

    Sotiropoulou, C-L; The ATLAS collaboration; Annovi, A; Beretta, M; Kordas, K; Nikolaidis, S; Petridou, C; Volpi, G

    2014-01-01

    The parallel 2D pixel clustering FPGA implementation used for the input system of the ATLAS Fast TracKer (FTK) processor is presented. The input system for the FTK processor will receive data from the Pixel and micro-strip detectors from inner ATLAS read out drivers (RODs) at full rate, for total of 760Gbs, as sent by the RODs after level-1 triggers. Clustering serves two purposes, the first is to reduce the high rate of the received data before further processing, the second is to determine the cluster centroid to obtain the best spatial measurement. For the pixel detectors the clustering is implemented by using a 2D-clustering algorithm that takes advantage of a moving window technique to minimize the logic required for cluster identification. The cluster detection window size can be adjusted for optimizing the cluster identification process. Additionally, the implementation can be parallelized by instantiating multiple cores to identify different clusters independently thus exploiting more FPGA resources. ...

  14. A Parallel FPGA Implementation for Real-Time 2D Pixel Clustering for the ATLAS Fast TracKer Processor

    CERN Document Server

    Sotiropoulou, C-L; The ATLAS collaboration; Annovi, A; Beretta, M; Kordas, K; Nikolaidis, S; Petridou, C; Volpi, G

    2014-01-01

    The parallel 2D pixel clustering FPGA implementation used for the input system of the ATLAS Fast TracKer (FTK) processor is presented. The input system for the FTK processor will receive data from the Pixel and micro-strip detectors from inner ATLAS read out drivers (RODs) at full rate, for total of 760Gbs, as sent by the RODs after level1 triggers. Clustering serves two purposes, the first is to reduce the high rate of the received data before further processing, the second is to determine the cluster centroid to obtain the best spatial measurement. For the pixel detectors the clustering is implemented by using a 2D-clustering algorithm that takes advantage of a moving window technique to minimize the logic required for cluster identification. The cluster detection window size can be adjusted for optimizing the cluster identification process. Additionally, the implementation can be parallelized by instantiating multiple cores to identify different clusters independently thus exploiting more FPGA resources. T...

  15. The Utilization of Canna Starch (Canna edulis Ker As A Alternative Hydrocolloid on The Manufacturing Process of Yogurt Drink

    Directory of Open Access Journals (Sweden)

    Ahmad Khoirul Umam

    2018-03-01

    Full Text Available Yogurt as a fermented dairy product has been providing several benefits for human health and appropriate for people with lactose intolerance. Recently, the consumption level of yogurt has significantly increased. Starch can be used as an alternative hydrocolloid in the manufacturing process of yogurt. Indonesian Canna edulis Ker contains 63.27% amylopectin that has the potential used as an alternative hydrocolloid. Amylopectin has a very high capability of the water holding capacity to increase the viscosity and maintain the stability of yogurt drink. The present research was to determine the additional effects of Canna starch as an alternative hydrocolloid on the physicochemical and sensory properties of the yogurt drink during storage. Concentrations of 0.1%, 0.2%, 0.3%, and 0.4% canna starch and 0.2% CMC (control were added to make yogurt. All treatments were carried out with four replications. Samples were refrigerated at 4oC for 24 hours and then analyzed for pH, titratable acidity, viscosity, syneresis, sedimentable fraction, and sensory properties. Data were analyzed by one way ANOVA, and followed by Duncan's multiple range test (DMRT. Data from the pH, titratable acidity, syneresis, sedimentable fraction, viscosity and sensory analyses obtained from the present study indicated that concentration of 0.1–0.4% (w/v Canna starch could be applicable in the manufacture of the yogurt drink. Furthermore, it was found that 0.1% (w/v of Canna starch selected as the best concentration could be used in yogurt manufacture process that resulted in similar sensory quality compared with CMC as commercial hydrocolloid.

  16. Ettevaatust, internetikasiino! / Kerli Nõu

    Index Scriptorium Estoniae

    Nõu, Kerli

    2004-01-01

    Interneti-kasiinoäriga tegelev World Games Inc. on jõudnud ka Eestisse. Firma paneb mängijate leidmiseks inimesed endale oma mängijate võrku looma, mida rohkem inimesi võrku kaasatakse, seda tulusamaks muutub äri kaasaja jaoks. Lisad: Tulukroonid; WGI äri ulatub otsapidi teemandi- ja kullakaevandamisse

  17. Umberto Eco : olemise piire kombates / Marina Grishakova

    Index Scriptorium Estoniae

    Grišakova, Marina, 1961-

    2004-01-01

    Arvustus: Eco, Umberto. Eilse päeva saar / tõlkinud Merike Pau. Tallinn : Eesti Raamat, 2003 ; Eco, Umberto. Baudolino / itaalia keelest tõlkinud [ja järelsõna:] Ülar Ploom. Tallinn : Varrak, 2003

  18. Eesti kirjandus teisel pool merd ja piire

    Index Scriptorium Estoniae

    2016-01-01

    Islandi keeles ilmus Kätlin Kaldmaa lasteraamat "Lugu Keegi Eikellegitütre isast", Arvo Valton pälvis Venemaa kirjandusauhinna Dmitri Mizgulini raamatu "Kui päike oli jumalaks" 2015. a. parima tõlke eest ja Inglise luuleajakiri "Modern Poetry in Translation" andis välja antoloogia "Centres of Cataclysm", milles on avaldatud Kristiina Ehini luuletus"Merest tulevad lehmad"

  19. Taevas ei olegi enam piir / Siim Tuksam

    Index Scriptorium Estoniae

    Tuksam, Siim, 1986-

    2015-01-01

    Artikkel tutvustab mängustuudio Hello Games poolt loodud uut videomängu "No Man`s Sky". See on seiklusmäng, kus saab lennata planeedilt planeedile, avastada kosmost, planeete, loomi, taimi, koguda maavarasid ja pidada kosmoselahinguid. Kogu see universum on protseduuriliselt genereeritud ja eksisteerib vaid koodis

  20. Kombates elu ja kunsti piire / Jaak Kangilaski

    Index Scriptorium Estoniae

    Kangilaski, Jaak, 1939-

    2011-01-01

    Serbia kunstniku Marina Abramovići loomingu näitus New Yorgi Moodsa Kunsti Muuseumis MoMa 2010. aasta kevadel. Näitus "Art Must Be Beautiful. Marina Abramovići valitud teosed" Tartu Kunstimuuseumis 13. novembrini 2011. Performance-kunsti ajaloost

  1. A High Performance Multi-Core FPGA Implementation for 2D Pixel Clustering for the ATLAS Fast TracKer (FTK) Processor

    CERN Document Server

    Sotiropoulou, C-L; The ATLAS collaboration; Beretta, M; Gkaitatzis, S; Kordas, K; Nikolaidis, S; Petridou, C; Volpi, G

    2014-01-01

    The high performance multi-core 2D pixel clustering FPGA implementation used for the input system of the ATLAS Fast TracKer (FTK) processor is presented. The input system for the FTK processor will receive data from the Pixel and micro-strip detectors read out drivers (RODs) at 760Gbps, the full rate of level 1 triggers. Clustering is required as a method to reduce the high rate of the received data before further processing, as well as to determine the cluster centroid for obtaining obtain the best spatial measurement. Our implementation targets the pixel detectors and uses a 2D-clustering algorithm that takes advantage of a moving window technique to minimize the logic required for cluster identification. The design is fully generic and the cluster detection window size can be adjusted for optimizing the cluster identification process. Τhe implementation can be parallelized by instantiating multiple cores to identify different clusters independently thus exploiting more FPGA resources. This flexibility mak...

  2. Evaluation of Costus afer Ker Gawl. in vitro anti-inflammatory activity and its chemical constituents identiifed using gas chromatography-mass spectrometry analysis

    Institute of Scientific and Technical Information of China (English)

    Godswill Nduka Anyasor; Onajobi Funmilayo; Osilesi Odutola; Adebawo Olugbenga; Efere Martins Oboutor

    2015-01-01

    Objective:To evaluate the anti-inflammatory activity of a tropical African medicinal plant, Costus afer (C. afer) Ker Gawl. in vitro and identify the chemical constituents in the most active fraction. Methods:Hexane, ethyl acetate, n-butanol and aqueous fractions obtained through successive solvent partitioning of 70%methanolic leaf or stem extracts of C. afer were subjected to in vitro anti-inflammatory screening assays viz. anti-denaturation of protein, stabilization of human red blood cell (HRBC) membrane against hypotonicity-induced hemolysis and anti-proteinase activities. Diclofenac sodium was used as a standard drug. The chemical compounds in the most active fraction were determined using quantitative phytochemical and gas chromatography-mass spectrometry (GC/MS) analytical methods, comparing the mass spectra of the GC/MS identified compounds with those of the National Institute of Standards and Technology (NIST) database library. Results:The hexane fraction of C. afer leaf (HFCAL) with an IC50 of 33.36μg/mL, 33μg/mL and 212.77 μg/mL exhibited the highest anti-denaturation of protein, stabilization of HRBC membrane and anti-proteinase activities respectively when compared with other test fractions. The GC/MS identified compounds in HFCAL known to possess anti-inflammatory property were terpenoids (naphthalene 1,6-dimethyl-; naphthalene 2,3-dimethyl-; phytol), phenol [phenol 2,4-bis(1,1-dimethylethyl)], coumaran [2(4H)-benzofuranone, 5,6,7,7a-tetrahydro-4, 4,7atrimethyl and fatty acids (pentadecanoic acid;hexadecanoic acid;n-hexadecanoic acid;9,12-octadecanoic acid-methyl ester;9,12,15 octadecatrienoic acid and cis-vaccenic acid)]. Conclusion: Therefore, HFCAL could be considered as a potential source of anti-inflammatory agents for herbal formulation or pharmaceutical drug production.

  3. The Fast TracKer

    CERN Document Server

    Potamianos, Karolos Jozef; The ATLAS collaboration

    2018-01-01

    The Fast Tracker (FTK) is a hardware upgrade to the ATLAS trigger and data acquisition system providing global track reconstruction to the High-Level Trigger (HLT) with the goal to improve pile-up rejection. The FTK processes incoming data from the Pixel and SCT detectors (part of the Inner Detector, ID) at up to 100 kHz using custom electronic boards. ID hits are matched to pre-defined track patterns stored in associative memory (AM) on custom ASICs and data routing, reduction and parameter extraction is achieved with processing on FPGAs. With 8000 AM chips and 2000 FPGAs, the FTK provides enough resources to reconstruct tracks with transverse momentum greater than 1 GeV/c in the whole tracking volume with an average latency below 100 microseconds at collisions intensities expected in Runs II and III of the LHC. The tracks will be available at the beginning of the trigger selection process, which allows development of pile-up resilient triggering strategies to identify b-quarks and tau-leptons, as well as pr...

  4. Piire ületades heaks õpetajaks / Krista Männa

    Index Scriptorium Estoniae

    Männa, Krista

    2005-01-01

    Septembris kohtusid Tallinna Ülikoolis projekti "Include me" partnerid Belgiast, Hollandist, Saksamaalt, Leedust, Hispaaniast ja Eestist. Koostööprojekti eesmärgiks on elavdada kultuuridevahelisi sidemeid, luues õpetajaks õppivatele tudengitele praktikavõimalusi

  5. Eestimaa piir tuleb sulgeda surmatõve ees / Urmas Laht

    Index Scriptorium Estoniae

    Laht, Urmas, 1955-

    2001-01-01

    Keskfraktsioon on välja pakkunud seaduseelnõud, mis takistaksid potentsiaalselt haigete loomade liha importimist ja lihakondijahu kasutamist. Autor: Keskerakond. Parlamendisaadik. Ilmunud ka: Virumaa Teataja, 16. veebr. 2001, lk. 7; Nädaline, 17. veebr. 2001, lk. 4; Sakala, 17. veebr. 2001, lk. 2; Valgamaalane, 17. veebr. 2001, lk. 2; Lääne Elu, 20. veebr. 2001, lk. 4; Võrumaa Teataja, 20. veebr. 2001, lk. 2; Meie Maa, 28. veebr. 2001, lk. 2; Koit, 27. veebr. 2001, lk. 4; Vooremaa, 27. veebr. 2001, lk. 3; Järva Teataja, 10. märts 2001, lk. 2

  6. Võimalusi piire ületada / Nele-Eva Steinfeld

    Index Scriptorium Estoniae

    Steinfeld, Nele-Eva

    2009-01-01

    20.-29. jaanuarini Eesti Muusika- ja Teatriakadeemias neljandat korda toimunud rahvusvahelisest Läänemere maade muusikakõrgkoolidele suunatud kursusest "Crossing Borders in interpretation of Classical Music und Jazz"

  7. Kataloonia kinolinal ületati piire / Toomas Järvet

    Index Scriptorium Estoniae

    Järvet, Toomas

    2007-01-01

    VII rahvusvahelisest dokumentaalfilmide festivalist "Docupolis" Barcelonas 3. - 7. oktoober 2007. Lühidalt filmidest "Welcome Europe" (rezh. Bruno Ulmer) ja "Voyage en Sol Majeur" (rezh. Georg Lazarevski)

  8. Kelmid sorivad suurfirmade rahakotis / Kerli Nõu

    Index Scriptorium Estoniae

    Nõu, Kerli

    2005-01-01

    KPMG turu-uuringud näitavad, et 75-80 protsenti tarneahela kuritegudest sooritavad suurfirma legaalsed partnerid või nende töötajad. Olukorda leevendaks infotehnoloogilise jälgimissüsteemi rakendamine. Skeem: Tehasest lõpptarbijani jõudev tooteahel. Lisa: Elcoteq varaste tule all

  9. Secondary hypertension | Ker | South African Family Practice

    African Journals Online (AJOL)

    Secondary hypertension is rare and the diagnosis may be challenging although, on occasion, there are clinical features indicative of a specific underlying cause. The more commonly encountered causes include renal parenchymal and vascular disease, phaeochromocytoma, endocrine causes, sleep apnoea and drugs.

  10. Maksumoraal maksukuulekuse mõjutajana / Kerly Lillemets

    Index Scriptorium Estoniae

    Lillemets, Kerly, 1974-

    2007-01-01

    Maksumoraali ja maksukuulekuse kujunemisest, seosest demokraatia arengu, väärtushinnangute ja haridusega, näited Euroopast ja Ameerika Ühendriikidest. Lisa: Maksudega nõustumise mõjurite klassifikatsioon

  11. Salasuhe autofirmaga toob tulu / Kerli Nõu

    Index Scriptorium Estoniae

    Nõu, Kerli

    2005-01-01

    Väidetavalt ei ole rehviäri viimasel kümnel aastal eriti suuri kasumeid toonud, sest arendustegevus on nõudnud investeeringuid. Üle poole rehvitööstuse kogukäibest on enda kätte haaranud Michelin, Bridgestone ja Goodyear. Lisa: Kes kellega käib? Tabel: Kolm suurt; Diagramm: Rehvitööstuse turuosa

  12. Õhuke piir väärikuse ja demagoogia vahel / Tiago Marques

    Index Scriptorium Estoniae

    Marques, Tiago

    2007-01-01

    Vastukaja art. Vooglaid, Varro. Ajas edasi, tsivilisatsiooniredelil tagasi // Postimees 20. veeb. 2007, lk. 15. Portugalis korraldatud rahvahääletusest abordikeelu kaotamiseks ja abordi olemuse eiramisest

  13. Miks peab lõhkuma hägustunud piire? / Reelika Reinomägi

    Index Scriptorium Estoniae

    Reinomägi, Reelika

    2007-01-01

    Kaasaegse tantsulavastuse ja teatri ühisosast, seoses festivaliga "Uus tants". Tantsuetendustest: Katrin Essensoni "Manusega mõtted", Mart Kangro "Start. Based on a True Story", Kaja Kannu "There are Laika Dogs Living in Estonia"

  14. Kallas : eurotsooni piir jääb rangeks / Kadri Bank

    Index Scriptorium Estoniae

    Bank, Kadri

    2008-01-01

    Euroopa Komisjoni asepresidendi Siim Kallase sõnul ei aita Eestit euroni ühekordsed meetmed, sest komisjon näeb need läbi ning tõlgendab neid negatiivselt. Vt. samas: Probleemid euroga; Maailmas praegu kolm kriisi korraga

  15. "Starman murrab piire" valiti mainekal PR-auhinnakonkursil finaali / Kristi Reiland

    Index Scriptorium Estoniae

    Reiland, Kristi

    2015-01-01

    Telekommunikatsioonifirma Starman tõi 2014. aastal turule teenuse TV Everywhere, mis võimaldab telepildi vaatamist ka nutiseadmest ja arvutist ajast ja asukohast sõltumata. Teenuse turule toomise kampaaniast, avaüritusest ja meediastrateegiast. Starmani teenuse TV Everywhere turule toomine valiti rahvusvahelisel PR-konkursil Exellence Awards finaalfooru

  16. Valdade ühinemine võib muuta maakondade piire / Maris S Kaasik

    Index Scriptorium Estoniae

    Kaasik, Maris S

    2004-01-01

    2. augustil saatis siseministeerium maaomavalitsuste liidule ja linnade liidule kooskõlastamiseks ühinemispiirkondade nimekirja. Kooskõlastuste tähtaeg on 16. augustil. Lisa: Põlva maakonna KOV-ide ühinemiseks pakub ühinemispiirkondade loetelu järgnevad variandid

  17. Kui sa oled mind sellisena loonud : [Patrick Shanley filmi "Kahtlus" arvustus] / Miina Piir

    Index Scriptorium Estoniae

    Piir, Miina

    2009-01-01

    Filmis "Kahtlus" puutume kokku igavese teemaga - katoliku preestrid ja kooripoisid. Katoliku preestrit homoseksuaalsuses kahtlustada on ülimalt lihtne, sest ordineeritakse reeglina vallalisi mehi, kes elavad tsölibaadis

  18. Vahetusüliõpilased Tallinnas piire ületamas / Hanneleen Pihlak

    Index Scriptorium Estoniae

    Pihlak, Hanneleen

    2008-01-01

    Jaanuarist märtsini õppis EMTA Lavakunstikoolis 16 vahetusüliõpilast Londoni teatrikoolist, Rose Brufordi kolledzhist. Näitlemisõppe lõputööna valmis neil õppejõudude Kärt Tominga ja Ingo Normeti juhendamisel Bertolt Brechti näidend "Kaukaasia kriidiring"

  19. Cardiovascular risk calculation | Ker | South African Family Practice

    African Journals Online (AJOL)

    Cardiovascular disease remains a major cause of global mortality and morbidity. Atherosclerosis is the main underlying cause in the majority of cardiovascular disease events. Traditional independent risk factors for car diovascular disease include age, abnormal lipid levels, elevated blood pressure, smoking and elevated ...

  20. FLYWHEEL BASED KINETIC ENERGY RECOVERY SYSTEMS (KERS) INTEGRATED IN VEHICLES

    OpenAIRE

    THOMAS MATHEWS; NISHANTH D

    2013-01-01

    Today, many hybrid electric vehicles have been developed in order to reduce the consumption of fossil fuels; unfortunately these vehicles require electrochemical batteries to store energy, with high costs as well as poor conversion efficiencies. By integrating flywheel hybrid systems, these drawbacks can be overcome and can potentially replace battery powered hybrid vehicles cost effectively. The paper will explain the engineering, mechanics of the flywheel system and it’s working in detail. ...

  1. Uudne materjal muutub ise põrutuskindlaks / Kerli Nõu

    Index Scriptorium Estoniae

    Nõu, Kerli

    2006-01-01

    Kaitsefunktsiooniga materjalist polümeer d30, mis muutub kukkumisel või kokkupõrkel löögikindlaks. Sõjaväe tarvis arendatud materjali kasutatakse spordi- ja vabaaja rõivaste tootmises, firma d30 Lab asutaja inglise insener Richard Palmer

  2. Illar Hallaste siirdus turismiärisse / Kerli Nõu

    Index Scriptorium Estoniae

    Nõu, Kerli

    2004-01-01

    Illar Hallaste turismifirma Seasons Travel on spetsialiseerunud individuaalsete suusareiside korraldamisele Skandinaaviasse ja mägimatkade organiseerimisele Himaalajasse. Lisad: Season Travel; Eksootilised reisid

  3. Pengaruh pati ganyong (Cannaedulis, Ker modifikasi terhadap kualitas kefir

    Directory of Open Access Journals (Sweden)

    Imam Thohari

    2014-07-01

    Full Text Available The purpose of the research was to determine the effect of using various concentration of modification starch on pH, water content, viscosity and fat content. The research material were kefir made from cow's milk with kefir grains derived from animal product technology laboratory of Animal Husbandry Brawijaya University. The research method was an experimental research with randomized block design. The treatments were the addition of canna starch modification 0% (G0, 0.2% (G1, 0.4% (G2, 0.6% (G3, 0.8% (G4 and 1.0% (G5 of the milk volume. Each treatment was replicated 3 times. The result showed that the addition of modified canna starch provided highly significant effect (p<0.01 on pH, water content, viscosity and fat content. The study concluded that addition of canna starch modification could improve the quality of kefir in terms of pH, water content, and viscosity, protein and lactic acid bacteria. The addition of 1% of canna starch modification had the best kefir quality. Keywords: Kefir, canna starch modification, STTP

  4. Konverents laste ja noorte turvalisusest Internetis / Kerli Kuusk

    Index Scriptorium Estoniae

    Kuusk, Kerli

    2008-01-01

    Teisel rahvusvahelisel konverentsil Interneti turvalisuse teemadel rõhutati: tähtis on rääkida Interneti headest külgedest ja harida avalikkust ka võimalikest ohtudest ja viisidest, kuidas neid ära hoida

  5. Kutseõppurid saavad peagi esimesed digipassid / Kerli Onno

    Index Scriptorium Estoniae

    Onno, Kerli

    2016-01-01

    Programmist Samsung DigiPass, mis lihtsustab noorte tööturule sisenemist. Programmi korraldab Samsung Electronics Baltics koostöös Tallinna ülikooli ja Eesti noorteühenduste liidu, haridus- ja teadusministeeriumi ning UNESCO-ga

  6. Management issues in hypertensive diabetics | Ker | South African ...

    African Journals Online (AJOL)

    South African Family Practice. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 53, No 2 (2011) >. Log in or Register to get access to full text downloads.

  7. The treatment of cholesterol: issues, effects and targets | Ker | South ...

    African Journals Online (AJOL)

    South African Family Practice. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 52, No 6 (2010) >. Log in or Register to get access to full text downloads.

  8. Eesti mehed leiutavad intelligentset kodu ja kontorit / Kerli Nõu

    Index Scriptorium Estoniae

    Nõu, Kerli

    2006-01-01

    Telekommunikatsiooniärimees Neeme Takis on välja töötanud intelligentse kodu kontseptsiooni, intelligentse kodu ja kontori süsteem kavatsetakse müügivalmis saada paari aasta pärast. Tabel: Yoga Intelligence. Lisa: Õige partneri otsingul

  9. Pressiteadete süntaksist: infiniittarindid ja nominalisatsioonid / Kerli Prass

    Index Scriptorium Estoniae

    Prass, Kerli

    2009-01-01

    Bakalaureusetööl põhinevas artiklis uuritakse pressiteadete süntaksit, täpsemalt infiniittarindeid ja nominalisatsioone. Eesmärk on välja selgitada, millised tunnused iseloomustavad pressiteateid kui uudistekste ning kui palju esineb pressiteadetes eri tarindeid

  10. The ATLAS Fast TracKer Processing Units

    CERN Document Server

    Krizka, Karol; The ATLAS collaboration

    2016-01-01

    The Fast Tracker is a hardware upgrade to the ATLAS trigger and data-acquisition system, with the goal of providing global track reconstruction by the start of the High Level Trigger starts. The Fast Tracker can process incoming data from the whole inner detector at full first level trigger rate, up to 100 kHz, using custom electronic boards. At the core of the system is a Processing Unit installed in a VMEbus crate, formed by two sets of boards: the Associative Memory Board and a powerful rear transition module called the Auxiliary card, while the second set is the Second Stage board. The associative memories perform the pattern matching looking for correlations within the incoming data, compatible with track candidates at coarse resolution. The pattern matching task is performed using custom application specific integrated circuits, called associative memory chips. The auxiliary card prepares the input and reject bad track candidates obtained from from the Associative Memory Board using the full precision a...

  11. Micropropagação de Griffinia hyacinthina (Ker-Gaw. Ker-Gaw., Amaryllidaceae nativa da Mata Atlântica.

    Directory of Open Access Journals (Sweden)

    Armando R. Tavares

    1999-05-01

    Full Text Available Um protocolo foi estabelecido para a micropropagação in vitro de Griffinia hvacinthina. Utilizou-se como explante escamas duplas do bulbo com parte da placa basal. Obteve-se a melhor desinfecção dos explantes utilizando-se Hipociorito de Sódio (NACIO 1,0% por 20 minutos. O estímulo à brotação foi dado pela adição de 0,2 mg.L de ANA (Ácido Naftaleno Acético e 5,0 mg.L-1 de 6-BA (6-Benzilaminopurina ao meio MS. Os bulbllhos obtidos foram reinoculados metada da concentração em meio MS adicionado de 0,3 mg.L-1 de 2,4-D (Ácido 2,4-Diclorofenoxiacético para enraizamento. Após 290 dias do início do processo, as plântulas originadas dos bulbilhos foram aclimatizadas em substrato constituído de vermiculita e terra vegetal (I: 1 e mantidas em estufa de vidro.

  12. Miks kogukondlased ei lähe maale elama? = Why don't community members move to the country? / Tõnu Laigu

    Index Scriptorium Estoniae

    Laigu, Tõnu, 1956-

    2013-01-01

    Linnakogukondadest, kogukondlaste ideedest, vaadetest, kogukondlikust eetikast. "Kus on piir oma unistuste elluviimise ning teiste linnakodanike tegevusse sekkumise vahel? Kui õhuke on piir elanike huvide eest seismise ja poliitilise hüppelaua vahel?", küsib arhitekt Tõnu Laigu

  13. Medicinal and Socio-Cultural Importance of Costus Afer (Ker Grawl ...

    African Journals Online (AJOL)

    User

    Medicinal plants play a great role in human life and have substances that are used for ... deforestation, many medicinal forest resources such as C. afer are gradually .... In Ogoniland of Rivers State, the leaf sap is used as eye drops to treat eye.

  14. Eestis on sadakond kaatrit, mis panevad pead pöörama / Kerli Nõu

    Index Scriptorium Estoniae

    Nõu, Kerli

    2005-01-01

    Peamised merekaatrite müüjad Eestis on Viktor Siilatsile kuuluv ettevõte Balti Merekaatrid ja Kaj Sarlini Baltic Boat Service. Veesõidukiärist Eestis. Lisa: Lisatasud. Kommenteerivad Jüri Uppin ja Aadu Luukas

  15. Uued Ernesto Preatonid : Itaalia ärimehed viivad mobiilparkimise maailma / Kerli Nõu

    Index Scriptorium Estoniae

    Nõu, Kerli

    2005-01-01

    Itaalia ärimeeste äritegevusest Eestis. Itaalia ärimehed tunnustavad Eesti ärireeglite lihtsust ja soodsat pinnast äri alustamiseks. Lisad: Itaallased annavad värvi; Suhted Ernesto Preatoniga jahedad

  16. Future evolution of the Fast TracKer (FTK) processing unit

    CERN Document Server

    Gentsos, C; The ATLAS collaboration; Giannetti, P; Magalotti, D; Nikolaidis, S

    2014-01-01

    The Fast Tracker (FTK) processor [1] for the ATLAS experiment has a computing core made of 128 Processing Units that reconstruct tracks in the silicon detector in a ~100 μsec deep pipeline. The track parameter resolution provided by FTK enables the HLT trigger to identify efficiently and reconstruct significant samples of fermionic Higgs decays. Data processing speed is achieved with custom VLSI pattern recognition, linearized track fitting executed inside modern FPGAs, pipelining, and parallel processing. One large FPGA executes full resolution track fitting inside low resolution candidate tracks found by a set of 16 custom Asic devices, called Associative Memories (AM chips) [2]. The FTK dual structure, based on the cooperation of VLSI dedicated AM and programmable FPGAs, is maintained to achieve further technology performance, miniaturization and integration of the current state of the art prototypes. This allows to fully exploit new applications within and outside the High Energy Physics field. We plan t...

  17. The Future Evolution of the Fast TracKer Processing Unit

    CERN Document Server

    Gentsos, Christos; The ATLAS collaboration; Magalotti, Daniel; Bertolucci, Federico; Citraro, Saverio; Kordas, Kostantinos; Nikolaidis, Spyridon

    2016-01-01

    Real time tracking is a key ingredient for online event selection at hadron colliders. The Silicon Vertex Tracker at the CDF experiment and the Fast Tracker (FTK) at ATLAS are two successful examples of the importance of dedicated hardware to reconstruct full events at hadron machines. We present the future evolution of this technology, for applications in the High Luminosity runs at the Large Hadron Collider (HL-LHC). Data processing speed is achieved with custom VLSI pattern recognition and linearized track fitting executed inside modern FPGAs, exploiting deep pipelining, extensive parallelism, and efficient use of available resources. In the current system, one large FPGA executed track fitting in full resolution inside low resolution candidate tracks found by a set of custom ASIC devices, called Associative Memories (AM chips). The FTK dual structure, based on the cooperation of VLSI AM and programmable FPGAs, is maintained, but we plan to increase the FPGA parallelism by associating one FPGA to each AM c...

  18. The Future Evolution of the Fast TracKer Processing Unit

    CERN Document Server

    Gentsos, Christos; The ATLAS collaboration; Magalotti, Daniel; Bertolucci, Federico; Citraro, Saverio; Kordas, Kostantinos; Nikolaidis, Spyridon

    2015-01-01

    Real time tracking is a key ingredient for online event selection at hadron colliders. The Silicon Vertex Tracker at the CDF experiment and the Fast Tracker (FTK) at ATLAS are two successful examples of the importance of dedicated hardware to reconstruct full events at hadron machines. We present the future evolution of this technology, for applications in the High Luminosity runs at the Large Hadron Collider (HL-LHC). Data processing speed is achieved with custom VLSI pattern recognition and linearized track fitting executed inside modern FPGAs, exploiting deep pipelining, extensive parallelism, and efficient use of available resources. In the current system, one large FPGA executed track fitting in full resolution inside low resolution candidate tracks found by a set of custom ASIC devices, called Associative Memories (AM chips). The FTK dual structure, based on the cooperation of VLSI AM and programmable FPGAs, is maintained, but we plan to increase the FPGA parallelism by associating one FPGA to each AM c...

  19. Eesti Energia tegi esimesed tehingud elektribörsil / Kerli Nõu

    Index Scriptorium Estoniae

    Nõu, Kerli

    2006-01-01

    Eesti Energia ei avalikusta NordPoolil sõlmitud tehingute mahtu ärisaladuse tõttu. NordPooli börsil hajutavad riske energia tootjad, suurtarbijad ja hulgikauplejad, kes peavad end energia hinnatõusu vastu kaitsma. Järgmise aasta tulevikutehingute hinda mõjutavatest teguritest. Lisa: NordPool

  20. Jüri Vips müüb tarkvara Hongkongi lennufirmale / Kerli Nõu

    Index Scriptorium Estoniae

    Nõu, Kerli

    2006-01-01

    Eesti tarkvarafirma Modera Consulting OÜ müüb tarkvara, mis sobib ettevõttesiseseks asjaajamiseks, kliendisuhtluseks, ka saab selle kaudu pakkuda reaalajas toimivat kliendiabi. Tabel: Modera Consulting OÜ. Lisa: Tuntud kliendid

  1. Starch conversion of ganyong (Canna edulis Ker. to bioethanol using acid hydrolysis and fermentation

    Directory of Open Access Journals (Sweden)

    LILY SURAYYA EKA PUTRI

    2008-04-01

    Full Text Available Starch of ganyong is one of the sources of ethanol which is able to be produced by acid hydrolysis and fermentation process. It had high concentration of carbohydrate that is 80%, so it could produce glucose highly within acid hydrolysis process. The result showed that the optimal amount of reducing sugar had been produced by nitrate acid 7% (dextrose equivalent, DE = 28.4. Nevertheless, type and concentration of acid had no significantly correlation to reducing sugar yielded. The total amount of glucose had correlation to amount of ethanol, in fermentation process. The optimal amount of ethanol was yielded from 4.81% of glucose and it produced about 4.84% ethanol. The more amount of glucose was yielded the more ethanol was produced. Controlling pH every 12 hours did not affected to production of ethanol significantly.

  2. Chemical constituents in n-butanol fractions of Costus afer ker Gawl leaf and stem

    Directory of Open Access Journals (Sweden)

    Godswill Nduka Anyasor

    2014-04-01

    Conclusion: The bioactive compounds identified in the n-butanol fractions of C. afer leaves and stem may explain the folkloric use of C. afer plant in the treatment of chronic inflammatory and oxidative stress related diseases. [J Intercult Ethnopharmacol 2014; 3(2.000: 78-84

  3. Mosaiigitükid vajavad uut moodi kokkupanekut / Martin Klöker ; intervjueerinud Katrin Kaugver

    Index Scriptorium Estoniae

    Klöker, Martin, 1966-

    2012-01-01

    Intervjuu kirjandus- ja kultuuriloolase Martin Klökeriga, kes viibis TLÜAR-i kutsel 2012. a märtsis Tallinnas ning pidas avaliku loengu "Ebatäielik pilt: trükitud raamat ja käsikiri kultuuride uurimises" ning kokkuvõte loengust

  4. Living.ee : mööblimüük kolib internetti / Kerli Nõu

    Index Scriptorium Estoniae

    Nõu, Kerli

    2006-01-01

    Internetis mööblit müüv Living.ee kavatseb 2008. aastaks saada müügimahu poolest sama suureks kui Mööblimaja või Aatrium, plaanis on müüa mööblit hulgi ka Skandinaavias. Tabel: OÜ Lagersen (Living.ee). Kommenteerib Arno Kütt

  5. Associative Memory Design for the Fast TracKer Processor (FTK)at ATLAS

    CERN Document Server

    Annovi, A; The ATLAS collaboration; Beretta, M; Bossini, E; Crescioli, F; Dell'Orso, M; Giannetti, P; Hoff, J; Liu, T; Liberali, V; Sacco, I; Schoening, A; Soltveit, H K; Stabile, A; Tripiccione, R

    2011-01-01

    We describe a VLSI processor for pattern recognition based on Content Addressable Memory (CAM) architecture, optimized for on-line track finding in high-energy physics experiments. A large CAM bank stores all trajectories of interest and extracts the ones compatible with a given event. This task is naturally parallelized by a CAM architecture able to output identified trajectories, recognized among a huge amount of possible combinations, in just a few 100 MHz clock cycles. We have developed this device (called the AMchip03 processor), using 180 nm technology, for the Silicon Vertex Trigger (SVT) upgrade at CDF [1] using a standard-cell VLSI design methodology. We propose a new design that introduces a full custom CAM cell and takes advantage of 65 nm technology. The customized design maximizes the pattern density, minimizes the power consumption and implements the functionalities needed for the planned Fast Tracker (FTK) [2], an ATLAS trigger upgrade project at LHC. We introduce a new variable resolution patt...

  6. Changes of E-KERS Rules to Make F1 More Relevant to Road Cars

    Directory of Open Access Journals (Sweden)

    Albert Boretti

    2018-01-01

    Full Text Available Today’s F1 hybrid cars are based on very similar power units made up of about the same internal combustion engine (ICE and energy recovery system (ERS. Because of restrictive design rules permitting too much fuel per race, the internal combustion engine is not particularly fuel efficient. The methodology is based on lap time simulations and telemetry data for a F1 H car covering one lap of the Monaco Grand Prix. The methodology is based on lap time simulations and telemetry data for a F1 H car covering one lap of the Monaco Grand Prix. The present limit of 100 kg of fuel per race is excessive. The low power energy recovery system is used strategically rather than fuel savings recovering very little braking energy. The 4 MJ of storable energy is used only when it is strategically needed. The 2 MJ of recoverable energy allowed per lap are almost never collected. To return to be technically attractive, F1 should permit much more freedom in the definition of the ICE and the ERS. As the goal of the rules should be lowering the fuel consumption while keeping technical and sporting interest high, the best solution is more freedom to achieve the fastest car within more stringent limits of fuel economy. A real limit to the total fuel consumption for a race track like Monte Carlo should be not more than 80 kg of fuel. This would translate in more energy recovery to the ERS per lap and better fuel efficiency of the ICE and will certainly help more the design of passenger cars.

  7. The Serial Link Processor for the Fast TracKer (FTK) processor at ATLAS

    CERN Document Server

    Biesuz, Nicolo Vladi; The ATLAS collaboration; Luciano, Pierluigi; Magalotti, Daniel; Rossi, Enrico

    2015-01-01

    The Associative Memory (AM) system of the Fast Tracker (FTK) processor has been designed to perform pattern matching using the hit information of the ATLAS experiment silicon tracker. The AM is the heart of FTK and is mainly based on the use of ASICs (AM chips) designed on purpose to execute pattern matching with a high degree of parallelism. It finds track candidates at low resolution that are seeds for a full resolution track fitting. To solve the very challenging data traffic problems inside FTK, multiple board and chip designs have been performed. The currently proposed solution is named the “Serial Link Processor” and is based on an extremely powerful network of 2 Gb/s serial links. This paper reports on the design of the Serial Link Processor consisting of two types of boards, the Local Associative Memory Board (LAMB), a mezzanine where the AM chips are mounted, and the Associative Memory Board (AMB), a 9U VME board which holds and exercises four LAMBs. We report on the performance of the intermedia...

  8. The Associative Memory Serial Link Processor of the ALTAS Fast TracKer Processing System

    CERN Document Server

    Sotiropoulou, Calliope Louisa; The ATLAS collaboration

    2017-01-01

    The upgraded trigger system of the ATLAS experiment at LHC will improve the capability of the detectors to select the events with the greatest scientific potential. The FastTracker (FTK) is one of the ATLAS trigger upgrade that is presently under commissioning. FTK is a hardware system that feeds the High Level Trigger with charged particle tracks reconstructed from hits in silicon detectors at the rate of 105 events per second. Once a track candidate is found, the track reconstruction proceeds by matching low resolution hits to predefined patterns. Selected hits matching the predefined pattern are used in a second processing step for a more precise track fitting algorithm. The main processing element of FTK is the Associative Memory (AM) system that is used to perform pattern matching with high degree of parallelism. Its implementation is called the AM Board Serial Link Processor (AMBSLP) and it is a very efficient pattern matching machine that handles massively parallel data. The AMB SLP consists of two typ...

  9. The Serial Link Processor for the Fast TracKer (FTK) at ATLAS

    CERN Document Server

    Annovi, A; The ATLAS collaboration; Beccherle, R; Beretta, M; Biesuz, N; Billereau, W; Combe, J M; Citterio, M; Citraro, S; Crescioli, F; Dimas, D; Donati, S; Gentsos, C; Giannetti, P; Kordas, K; Lanza, A; Liberali, V; Luciano, P; Magalotti, D; Neroutsos, P; Nikolaidis, S; Piendibene, M; Rossi, E; Sakellariou, A; Shojaii, S; Sotiropoulou, C-L; Stabile, A; Vulliez, P

    2014-01-01

    The Associative Memory (AM) system of the FTK processor has been designed to perform pattern matching using the hit information of the ATLAS silicon tracker. The AM is the heart of the FTK and it finds track candidates at low resolution that are seeds for a full resolution track fitting. To solve the very challenging data traffic problem inside the FTK, multiple designs and tests have been performed. The currently proposed solution is named the “Serial Link Processor” and is based on an extremely powerful network of 2 Gb/s serial links. This paper reports on the design of the Serial Link Processor consisting of the AM chip, an ASIC designed and optimized to perform pattern matching, and two types of boards, the Local Associative Memory Board (LAMB), a mezzanine where the AM chips are mounted, and the Associative Memory Board (AMB), a 9U VME board which holds and exercises four LAMBs. We report also on the performance of a first prototype based on the use of a min@sic AM chip, a small but complete version ...

  10. The Serial Link Processor for the Fast TracKer (FTK) processor at ATLAS

    CERN Document Server

    Andreani, A; The ATLAS collaboration; Beccherle, R; Beretta, M; Cipriani, R; Citraro, S; Citterio, M; Colombo, A; Crescioli, F; Dimas, D; Donati, S; Giannetti, P; Kordas, K; Lanza, A; Liberali, V; Luciano, P; Magalotti, D; Neroutsos, P; Nikolaidis, S; Piendibene, M; Sakellariou, A; Shojaii, S; Sotiropoulou, C-L; Stabile, A

    2014-01-01

    The Associative Memory (AM) system of the FTK processor has been designed to perform pattern matching using the hit information of the ATLAS silicon tracker. The AM is the heart of the FTK and it finds track candidates at low resolution that are seeds for a full resolution track fitting. To solve the very challenging data traffic problems inside the FTK, multiple designs and tests have been performed. The currently proposed solution is named the “Serial Link Processor” and is based on an extremely powerful network of 2 Gb/s serial links. This paper reports on the design of the Serial Link Processor consisting of the AM chip, an ASIC designed and optimized to perform pattern matching, and two types of boards, the Local Associative Memory Board (LAMB), a mezzanine where the AM chips are mounted, and the Associative Memory Board (AMB), a 9U VME board which holds and exercises four LAMBs. Special relevance will be given to the AMchip design that includes two custom cells optimized for low consumption. We repo...

  11. The Serial Link Processor for the Fast TracKer (FTK) processor at ATLAS

    CERN Document Server

    Biesuz, Nicolo Vladi; The ATLAS collaboration; Luciano, Pierluigi; Magalotti, Daniel; Rossi, Enrico

    2015-01-01

    The Associative Memory (AM) system of the Fast Tracker (FTK) processor has been designed to perform pattern matching using the hit information of the ATLAS experiment silicon tracker. The AM is the heart of FTK and is mainly based on the use of ASICs (AM chips) designed to execute pattern matching with a high degree of parallelism. The AM system finds track candidates at low resolution that are seeds for a full resolution track fitting. To solve the very challenging data traffic problems inside FTK, multiple board and chip designs have been performed. The currently proposed solution is named the “Serial Link Processor” and is based on an extremely powerful network of 828 2 Gbit/s serial links for a total in/out bandwidth of 56 Gb/s. This paper reports on the design of the Serial Link Processor consisting of two types of boards, the Local Associative Memory Board (LAMB), a mezzanine where the AM chips are mounted, and the Associative Memory Board (AMB), a 9U VME board which holds and exercises four LAMBs. ...

  12. Lipstok ja Sukles mures mudaimpeeriumi tuleviku pärast / Andres Reimer, Kerli Nõu

    Index Scriptorium Estoniae

    Reimer, Andres

    2005-01-01

    Eesti spaadeomanikega koostööd teinud Soome turismifirma Töölön Matkatoimisto läks pankrotti, Eesti kuurortide ja taastusravi liidu liikmete kogukahju tasumata arvetest võib tõusta 10 miljoni kroonini. Tabel: Soome tuntud reisibüroo pankroti mõju Eestile. Lisad: Soome oma Enron; Eestlastele tühjad pihud

  13. Software Reviews: "Pow! Zap! Ker-plunk! The Comic Book Maker" (Pelican Software).

    Science.gov (United States)

    Porter, Bernajean

    1990-01-01

    Reviews the newest addition to Pelican's Creative Writing Series of instructional software, which uses the comic book format to provide a unique writing environment for satire, symbolism, sequencing, and combining text and graphics to communicate ideas. (SR)

  14. Liitumine OECD-ga: rahvusvaheline koostöö on vajalik / Mika Keränen

    Index Scriptorium Estoniae

    Keränen, Mika, 1973-

    2010-01-01

    Eesti liitumisläbirääkimised OECD-ga lõpevad lähiajal. Välisministeeriumi juhitud ministeeriumidevahelise rühma töö on kulgenud ladusalt. Haridus- ja Teadusministeeriumi valitsemisalas on ühine töö olnud mitmel põhjusel kergem kui teistel ministeeriumidel

  15. Modelliagentuurid toodavad Carmen Kassile tasemel järglasi / Kerli Nõu

    Index Scriptorium Estoniae

    Nõu, Kerli

    2006-01-01

    Eestis tegutsevatest modelliagentuuridest Beatrice Mass Modelnet, Baltic Models OÜ ja Eesti Modelliagentuuri OÜ. Kommentaarid: Tasane algus kulisside taga, Edukad Eesti modellid (Annika Vohta), Eesti uus Carmen Kass (Claudia Meriküla)

  16. Inimesed ostavad kinnisvara asemel üha rohkem teemante / Kerli Nõu

    Index Scriptorium Estoniae

    Nõu, Kerli

    2005-01-01

    Eesti gemmoloogid Karin Eensaar ja Heli Kuulmann teemantidest kui investeeringust. Kommenteerib Karin Eensaar. Lisad: Maapõu peidab ülivanu kivikesi. Kultusehe number kaks: pärlikee; De Beers. Alrosa. BHP Billiton, Rio Tinto

  17. Structural elucidation and NMR assignments of a new pyrrolizidine alkaloid from Crotalaria vitellina Ker Gawl.

    Science.gov (United States)

    Casimiro Bezerra, Denise Aline; Fechine Tavares, Josean; dos Santos, Paula Ferreira; Castello Branco, Marianna Vieira Sobral; de Fátima Agra, Maria; Subrinho, Fernanda Lima; Braz-Filho, Raimundo; da Silva, Marcelo Sobral

    2013-08-01

    A new pyrrolizidine alkaloid, named crotavitelin, was isolated from fruits of Crotalaria vitellina, Fabaceae (Papilionoideae). The structure was established by spectroscopic techniques such as one-dimensional and two-dimensional NMR, IR, and MS. Copyright © 2013 John Wiley & Sons, Ltd.

  18. Arvutijuppidest tehtud ehted 5000 krooni eest müügiks / Kerli Nõu

    Index Scriptorium Estoniae

    Nõu, Kerli

    2005-01-01

    Ameerika neiu Liz McLean Knight meisterdab arvuti- ja elektroonikajuppidest trendikaid aksessuaare: kaela- ja randmeehted, kõrvarõngad, sõrmused, käekotid, T-särgid. Ehete kaubamärk Zelle pärineb kunstniku artistinimest muusika- ja arvutimaailmas

  19. Väljaspool Euroopa Nõukogu riikide piire toimuv relvakonflikt: riigi jurisdiktsioon ja rahvusvahelise humanitaarõiguse kohaldamine. Euroopa Inimõiguste Kohtu praktika / Maris Kuurberg

    Index Scriptorium Estoniae

    Kuurberg, Maris

    2017-01-01

    Kohtuasjadest, mis puudutavad Euroopa inimõiguste ja põhivabaduste kaitse konventsioonist (EIÕK) tulenevaid riikide kohustusi relvakonflikti olukorras, mis ei toimu ühegi konventsiooniosalise territooriumil ega konventsiooni õigusruumis

  20. Ümber mõtestades piire ja kaugust = Distance Between the Vision and the Context / Maia Tüür

    Index Scriptorium Estoniae

    Tüür, Maia

    2006-01-01

    Musee du Quai Branly Pariisis. Arhitekt Jean Nouvel, maastikuarhitekt Gilles Clement. Pargi üldskeemi kujundab teede ja pinkide võrgustik, mis põhineb kilpkonna kilbi mustril. Yann Kersale teosest pargis. Maja Seine'i-äärset fassaadi katab Patrick Blanci loodud taimevaip

  1. Äriühingu püsiv maksejõuetus ja edasiste maksete tegemine. Kus on piir keelatu ja lubatu vahel? / Triin Toom

    Index Scriptorium Estoniae

    Toom, Triin, 1990-

    2014-01-01

    Äriühingu püsiva maksejõuetuse kindlakstegemisest ning maksete tegemise piirangu sisust ja ulatusest. Eesti ja Saksamaa õigusreeglite ja kohtupraktika võrdlev analüüs. Artikkel põhineb autori magistritööl

  2. Eesti kõrgkoolilõpetajate toimetulek tööturul / Kerly Espenberg, Raul Eamets, Aivi Themas

    Index Scriptorium Estoniae

    Espenberg, Kerly, 1982-

    2011-01-01

    Tuginedes viimase vilistlasuuringu andmetele, otsitakse vastust küsimusele, miks hoolimata riigieelarveliste kohtade vähesusest on sotsiaalteaduste valdkonnas tudengite arv kõrgem kui loodus- ja täppisteadustes

  3. Design, Characterization and Test of the Associative Memory Chip AM06 for the Fast TracKer System

    CERN Document Server

    Liberali, Valentino; The ATLAS collaboration

    2016-01-01

    We present the performance of the new Associative Memory (AM) chip, designed and manufactured in 65 nm CMOS technology. The AM06 is the 6th version of a highly parallel ASIC processor for pattern recognition in high energy physics experiments. The AM06 is based on the XORAM cell architecture, which has been specifically designed to reduce power consumption and control complexity. The AM06 is a large chip, which contains memory banks that store all data of interest. The basic unit is a word of 18 bit. A group of 8 words (each of them related to a detector layer) is called a “pattern”. Each AM06 chip stores 2^17 patterns. The AM06 integrates serializer and deserializer IP blocks (working up to 2.4 GHz), to avoid routing congestion at the board level. AM06 is a complex VLSI chip, designed combining full-custom memory arrays, standard logic cells and IP blocks. It occupies a silicon area of 168 mm^2 and it contains about 421 millions transistors. The AM06 chip is able to perform a synchronous bitwise comparis...

  4. Eestlaste loodud südamestimulaator meelitas rikkad jänkid meie meditsiini juurde / Kerli Nõu

    Index Scriptorium Estoniae

    Nõu, Kerli

    2005-01-01

    Eesti teadlaste leiutis on nüüdseks mitu korda omanikku vahetanud, praegu arendatakse TTÜ Elektroonikainstituudis südamelihaste isheemiat ja infarkti ennetavat seadet edasi USA meditsiinitehnoloogia firmas St Jude Medicali lipu all. Kommenteerivad Taavi Lepmets ja Allan Martinson

  5. Anti-acetylcholinesterase and Antioxidant Activity of Essential Oils from Hedychium gardnerianum Sheppard ex Ker-Gawl

    Directory of Open Access Journals (Sweden)

    José Silvino Rosa

    2012-03-01

    Full Text Available Acetylcholinesterase inhibition, antioxidant and cytotoxic activities of Hedychium gardnerianum leaf essential oils from S. Miguel Island were determined. All the oils inhibited acetylcholinesterase, with IC50 values of approximately 1 mg/mL, showing no statistical differences between collection sites. Three oils presented mixed inhibition, whilst one was almost truly competitive. This activity can be attributed to the presence of sesquiterpenes, which constituted more than 60% of the composition of the oils. Regarding the antioxidant activity as measured by the DPPH method, all the oils presented activities similar to reference compounds, although with statistical differences between collection sites. Cytotoxicity measured using Artemia salina classified these oils as moderately toxic, with LC50 values ranging from 300 to 500 µg/mL. These results indicate a possible application of these oils in aromatherapy as coadjuvants in the treatment of cognitive diseases such as Alzheimer, since they may contribute to increase acetylcholine in cholinergic neurons and simultaneously fight deleterious oxidations responsible by neurological degeneration.

  6. AM06: the Associative Memory chip for the Fast TracKer in the upgraded ATLAS detector

    International Nuclear Information System (INIS)

    Annovi, A.; Beretta, M. M.; Calderini, G.; Crescioli, F.; Frontini, L.; Liberali, V.; Shojaii, S.R.; Stabile, A.

    2017-01-01

    This paper describes the AM06 chip, which is a highly parallel processor for pattern recognition in the ATLAS high energy physics experiment. The AM06 contains memory banks that store data organized in 18 bit words; a group of 8 words is called 'pattern'. Each AM06 chip can store up to 131 072 patterns. The AM06 is a large chip, designed in 65 nm CMOS, and it combines full-custom memory arrays, standard logic cells and serializer/deserializer IP blocks at 2 Gbit/s for input/output communication. The overall silicon area is 168 mm 2 and the chip contains about 421 million transistors. The AM06 receives the detector data for each event accepted by Level-1 trigger, up to 100 kHz, and it performs a track reconstruction based on hit information from channels of the ATLAS silicon detectors. Thanks to the design of a new associative memory cell and to the layout optimization, the AM06 consumption is only about 1 fJ/bit per comparison. The AM06 has been fabricated and successfully tested with a dedicated test system.

  7. QCD propagators and vertices from lattice QCD (in memory of Michael Müller-Preußker

    Directory of Open Access Journals (Sweden)

    Sternbeck André

    2017-01-01

    Full Text Available We review lattice calculations of the elementary Greens functions of QCD with a special emphasis on the Landau gauge. These lattice results have been of interest to continuum approaches to QCD over the past 20 years. They are used as reference for Dyson-Schwinger- and functional renormalization group equation calculations as well as for hadronic bound state equations. The lattice provides low-energy data for propagators and three-point vertices in Landau gauge at zero and finite temperature even including dynamical fermions. We summarize Michael Müller-Preußker’s important contributions to this field and put them into the perspective of his other research interests.

  8. AM06: the Associative Memory chip for the Fast TracKer in the upgraded ATLAS detector

    CERN Document Server

    Liberali, Valentino; The ATLAS collaboration

    2018-01-01

    This paper describes the AM06 chip, a highly parallel processor for pattern recognition in high energy physics. AM06 contains memory banks that store up to 2^17 patterns made up of 8x18 bit words and integrates SER/DES IP blocks for 2.4 Gb/s IO to avoid routing congestion. AM06 combines custom memory arrays, standard logic cells and IP blocks within a 168 mm^2 silicon area with 421 million transistors and can perform bitwise comparisons at 1.6 Pbit/s, consuming ~2 fJ/bit per comparison thanks to the optimized design based on the XORAM cells.

  9. Anti-acetylcholinesterase and Antioxidant Activity of Essential Oils from Hedychium gardnerianum Sheppard ex Ker-Gawl

    OpenAIRE

    Arruda, Miguel; Viana, Hugo; Rainha, Nuno; Neng, Nuno R.; Rosa, José Silvino; Nogueira, José M. F.; Barreto, Maria do Carmo

    2012-01-01

    Acetylcholinesterase inhibition, antioxidant and cytotoxic activities of Hedychium gardnerianum leaf essential oils from S. Miguel Island were determined. All the oils inhibited acetylcholinesterase, with IC50 values of approximately 1 mg/mL, showing no statistical differences between collection sites. Three oils presented mixed inhibition, whilst one was almost truly competitive. This activity can be attributed to the presence of sesquiterpenes, which constituted more than 60% of the composi...

  10. AM06: the Associative Memory chip for the Fast TracKer in the upgraded ATLAS detector

    CERN Document Server

    Annovi, Alberto; The ATLAS collaboration; Calderini, Giovanni; Crescioli, Francesco

    2016-01-01

    \\abstract{This paper describes the AM06 chip, which is a highly parallel processor for pattern recognition in high energy physics experiments. It contains memory banks that store data organized in 18 bit words; a group of 8 words is called ``pattern''. Each AM06 chip can store up to 2$^{17}$ patterns. The AM06 integrates serializer/deserializer IP blocks at 2 Gbit/s for input/output communication, to avoid routing congestion at the board level. The AM06 is a complex chip. It has been designed in 65 nm CMOS, combining full-custom memory arrays, standard logic cells and IP blocks. It occupies a silicon area of 168 mm$^2$ and contains 421 millions transistors. The AM06 can perform bitwise comparison at a rate of 100 kHz. Thanks to the XORAM cell and to the design optimization, the AM06 consumes about 1 fJ/bit per comparison. The AM06 has been fabricated and successfully tested with a dedicated test system.

  11. Kultuuripoliitika põhimõtete uuendamine ENSV Riiklikus Kultuurikomitees (välissuhete näitel) / Kerli Gutman

    Index Scriptorium Estoniae

    Gutman, Kerli, 1982-

    2009-01-01

    Kultuuripoliitikast taasiseseisvumise poerioodil. Kultuuripoliitika liberaliseerimise eeldustest. ENSV Kultuuriministeeriumi reorganiseerimisest. Välissuhtluse põhimõtetest ENSV Riiklikus Kultuurikomitees

  12. Euroraha investeerimine Eesti tööturule = EU investment in the Estonian labour market / Kerli Lorvi

    Index Scriptorium Estoniae

    Lorvi, Kerli

    2006-01-01

    Riiklikku arengukava meedet "Võrdsed võimalused tööturul" rahastatakse Euroopa Sotsiaalfondist aastatel 2004-2006 kokku 413 miljoni krooni ulatuses, programm EQUAL. Lisad: Majanduslik aktiivsus 15-64-aastaste hulgas, 1997-2005; Kõnekaid fakte

  13. Hydrologi i Ulleråker : En studie om dagvattenhantering och dess inverkan på grundvatten

    OpenAIRE

    Dahlquist, Josefin; Larsson, Martin; Rickfält, Tea

    2017-01-01

    Vattenbehovet stiger i världen till följd av ökande befolkning. Med ökad urbaniseringskapas mer hårdgjorda ytor där föreningar ackumuleras. Dagvattnet transporterar dessa föroreningar som således kan nå grundvattnet. Ett miljömål har antagits i Sverigeför att skydda grundvattentäkter och därmed säkra framtida dricksvattenförsörjning. Rullstensåsar innehåller stora grundvattenmagasin och har hög infiltrationsförmåga för vatten från markytan. Uppsala kommun tar 95 % av sitt dricksvatten från ru...

  14. Tijlozen in Nederland, wild en verwilderd: Colchicum autumnale L., C. tenorei Hort. en C. byzantinum Ker-Gawl.

    NARCIS (Netherlands)

    Londo, Ger; Londo-Eeken, Iet

    2007-01-01

    Van het geslacht Colchicum is alleen C. autumnale inheems in Nederland. Behalve deze soort wordt een aantal uitheemse Colchicum-soorten gekweekt waarvan enkele verwilderd zijn aangetroffen. Deze soorten, met name C. tenorei en C. byzantinum, kunnen tot verwarring met C. autumnale leiden, vooral door

  15. Mis on see meie oma meediaruum? / Katrin Kivimaa

    Index Scriptorium Estoniae

    Kivimaa, Katrin, 1969-

    1999-01-01

    Meediakunsti festivali 'Interstanding 3' raames toimunud konverents 'Ülalpool piire'. Kuraator Eric Kluitenbergi, peaesineja sotsioloogiaprofessor Saskia Sasseni, bulgaaria kunstniku Luchezar Boyadjievi esinemisest. Eesti ja internet

  16. "Interstanding 3" põlgab trendi ja mainstream'i

    Index Scriptorium Estoniae

    1999-01-01

    Kolmas rahvusvaheline meediakunsti festival "Interstanding 3", mille teema on "Ülalpool piire". Selle raames Kaasaegse Kunsti Eesti Keskuse 6. aastanäitus, loengud, konverents "Ülalpool piire". Esinevad Saskia Sassen Chicagost, Katrin Kivimaa, Ando Keskküla, Eric Kluitenberg Amsterdamist.

  17. Bioactivity of mangrove humic materials on Rizophora mangle and ...

    African Journals Online (AJOL)

    Bioactivity of mangrove humic materials on Rizophora mangle and Laguncularia racemosa seedlings, Brazil. Leonardo Barros Dobbss, André Luiz Paier Barroso, Alessandro Coutinho Ramos, Karla Stéphanie Nunes Torrico, Fabíola Schunk de Souza Arçari, Daniel Basílio Zandonadi ...

  18. ”I sangen møtes vi på felles grunn.” Om sang og sangbøker i norsk skole.

    Directory of Open Access Journals (Sweden)

    Ragnhild Elisabeth Lund

    2010-12-01

    Full Text Available Sangfaget har en lang og sterk tradisjon i den norske skolestua og sangboka har vært et sentralt læremiddel i mer enn 150 år. Formålet med denne artikkelen er å belyse de mange og ulike begrunnelser som er blitt knyttet til faget opp gjennom tidene og å vise hvilket innhold sangbøkene har søkt å formidle. Presentasjonen av sangfagets begrunnelser er basert på en undersøkelse av skolehistoriske tekster og læreplaner fra tidlig på 1800-tallet fram til vår tid. Jeg har også sett på forordene og forfatternes vektlegging av sangrepertoar og annet sang- og musikkfaglig innhold i de mest toneangivende sangbøkene fra samme periode. For å finne ut hvilke sanger elevene er blitt tilbudt og hvilke verdier sangene formidler, har jeg kartlagt repertoarvalget i tolv sangbokverk fra 1850 (Behrens’ Skolesangbog til 2008 (Amsrud & Bjørnstads Sang i Norge. Artikkelen viser at begrunnelsene for sangfaget favner vidt og at både de og innholdet i sangbøkene har endret seg i takt med utviklingen i utdanningssystemet og i samfunnet forøvrig. Videreformidling av sentrale sanger i norsk kulturarv har selvsagt stått sentralt. Men sangfaget har også befattet seg med opplæring i musikkteori, notelære og stemmepleie, og det har hatt som oppgave å utvikle kvalitetsbevissthet, samhold og fellesskap i tillegg til å bidra til læring og trivsel i andre fag. Når det gjelder repertoarvalg, har utviklingen gått fra en hovedvekt på sanger med et religiøst og oppdragende innhold via nasjonale sanger til en stadig økende andel ”blott-til-lyst-sanger” og sanger fra populærmusikkens område. Til tross for at repertoarvalget har endret seg, er det mange sanger som går igjen gjennom hele perioden. Med referanse til en definisjon av kanon som ”stabile forekomster” identifiserer artikkelen 34 sanger som kan sies å utgjøre en del av ”den norske sangskatten”.

  19. Kuriteoohvrite kaitse ja kohtlemise uuring : aruande kokkuvõte : [august 2017] / [Kerly Espenberg, Maie Kiisel, Maarika Lukk ... jt. ; Tartu ülikooli sotsiaalteaduslike rakendusuuringute keskus RAKE

    Index Scriptorium Estoniae

    2017-01-01

    Ohvrite direktiivi Eesti õigusse ülevõtmise analüüs, ülevaade kuriteoohvrite õigustest ja nende kasutamisest, ohvrite kohtlemisest menetluses, ohvriabist ja selle pakutavatest teenustest ning hüvitistest, lepitusmenetlusest, asutuste koostööst ja ennetustööst ohvrite kaitsel ning kuriteo mõjust ohvrite igapäevaelule

  20. PReklam? : En kvantitativ studie som undersöker vad gymnasieelever i årskurs 3 förknippar med begreppet PR

    OpenAIRE

    Pogarcic, Dajana; Moberg, Jessie

    2011-01-01

     Background and aim: Media development and digitalization has expanded the PR industry's working area. More participants are on the media market and it is becoming more and more difficult to define what PR really is and what the PR agencies/departments really do. Is PR marketing, information, event marketing or maybe propaganda? We believe that the complexity to define the term PR can lead to a loss of critical approach to the business, especially among young people. Has the PR industry manag...

  1. Production Test IP-601-D: Evaluation of crud-forming characteristics of KER loop coolant containing NH{sub 4}OH for pH control

    Energy Technology Data Exchange (ETDEWEB)

    Neidner, R.

    1963-08-06

    The objective of production test detailed in this report was to characterize the effects of NH{sub 4}OH as a pH control agent in a recirculating, high temperature and pressure water system having NPR characteristics. Of particular interest is the crud forming and decomposition characteristics of NH{sub 4}OH at potential NPR conditions.

  2. Oppdragelsessyn i endring? : En komparativ studie av populære oppdragelsesbøker utgitt i Norge i perioden 1950-2000

    OpenAIRE

    Azimeh, Malek

    2017-01-01

    Masteroppgave pedagogikk PED511 - Universitetet i Agder 2017 The topic of this assignment is to study if the view of parenting has changed in Norway. There have been many discussions about parenting and what it entails. This study is limited to popular books that have been released in Norway between 1950 and 2000. The parenting books emphasise different aspects in the children’s upbringing and how that positively affects their development. The primary research question is to examine the...

  3. heT BoeK PrediKer: een verrAssende en uiTdAgende sTem in de ...

    African Journals Online (AJOL)

    Precies in deze context moeten qohelet's bespiege lingen over de 'ijdelheid' van de dingen begrepen worden. 10 cf. delitzsch (1875:197): “Wenn das buch Koheleth altsalomonisch ware, so gäbe es keine geschichte der hebräischen sprache”. 11 voor een omstandiger bespreking van en uitgebreide bibliografie omtrent de ...

  4. Ecology of a stream from upper Paraná River basin inhabited by Aspidoras fuscoguttatus Nijssen & Isbrüker, 1976 (Siluriformes, Callichthyidae

    Directory of Open Access Journals (Sweden)

    R. B. de Araujo

    Full Text Available ABSTRACT Most information on catfishes of the genus Aspidoras has focused species kept in aquaria, in non-natural conditions. Biotic and abiotic parameters of environment inhabited by Aspidoras fuscoguttatus, associated ichthyofauna, as well as strategies involved in the successful occupation of different microhabitats in a first order stream, located in São José do Rio Preto, São Paulo State, were investigated. Data collection was monthly performed at three segments (headwaters, middle course, and mouth from August 1999 to July 2000. The greatest values of water temperature, conductivity, turbidity, alkalinity, width, depth, and current velocity were obtained in the rainy season. Dissolved oxygen levels showed significant differences among three segments in all sampling months, except for September. Substrate composition was predominantly sandy, followed by silt and clay in middle course and mouth in rainy as much as in dry seasons. In headwaters a large increase of the sandy fraction occurred in the rainy season. In the marginal and aquatic vegetation 30 species of macrophytes and 5 of macroalgae were identified. The fauna included tadpoles of Anura and macroinvertebrates (Mollusca, Crustacea, Arachnida, and 8 orders of Insecta. A. fuscoguttatus was found throughout the entire stream in sympatry with 6 fish species. In middle course, cluster analysis revealed an association between A. fuscoguttatus immatures and low depth, suggesting a probable function of depth in that stage of ontogenetic development of catfishes. The results indicate that A. fuscoguttatus present plasticity in terms of microhabitat, including air breathing behavior in hypoxic conditions, previously unknown in genus Aspidoras.

  5. Konstruktion och undersökelse, exotism och närhet i Per Olof Sundmans böker om Lofoten

    Directory of Open Access Journals (Sweden)

    Annie Bourguinon

    2007-04-01

    Full Text Available The Swedish writer Per Olof Sundman (1922-1992 wrote mostly short stories and novels, but also reportages. The paper deals with two reportages from the Lofoten islands, Människor vid hav (1966, “People by the sea” and Lofoten, sommar (1973, “Lofoten, summer” The choice of the Lofoten islands as a subject is related to a fascination Sundman felt towards northern and arctic regions, a fascination he also expressed in a number of fictional narratives and in the documentary novel Ingenjör Andrées luftfärd (1967. English title: The Flight of the Eagle A question that arises almost immediately is whether that fascination affects the way the reporter works and how it affects it. How does Sundman look at the Lofoten? What does he take notice of and tell us about? What kind of image does he give? And how does he understand his own role, his function as an investigator in an environment which is neither his own nor his postulated readers’ usual environment? Another question deals with the relationship between the reportages from the Lofoten and the author’s other works. Are the reportages easy to recognize as Sundmanian texts, can Sundman’s “signature” be traced in them? It appears that “People by the sea” and “Lofoten, summer” are not merely informative texts. They also to a rather high degree suggest an atmosphere, using among other things inherited representations and judgements to that purpose. Those reportages turn out to be strongly literary texts, in the traditional meaning of the word.

  6. Kultuuripealinn Stockholm ürituste kalender

    Index Scriptorium Estoniae

    1998-01-01

    "Opus 96 and kammeransamblen"-uue põlvkonna naisheliloojad, Stockholmi tangofestival, "Invasion 98"-laste ja noorte muusikafestival, "Gekko"-muusika ja kunsti piire purustav etnotechno festival, "Kristina from Duvemala" - endiste ABBA-laste hittmuusikal

  7. Vedel ärkamisaeg internetis / Johannes Saar

    Index Scriptorium Estoniae

    Saar, Johannes, 1965-

    1999-01-01

    Interstanding 3, näitus, konverents "Ülalpool piire", ettekanded. Graham Harwood interneti infotüranniast ja bioaktiivset kunsti viljelev Eduardo Kac saabuvast "kunstikavatsuslike olendite ajastust"

  8. Industrial parks have arrived - real estate developers run with new business idea / Paavo Kangur

    Index Scriptorium Estoniae

    Kangur, Paavo, 1966-

    2004-01-01

    Eesti tööstus- ja tehnoloogiaparkide loomisest ja tegevusest. Selgitusi jagab Tänassilma tehnoloogiapargi üks omanikke Andrus Piir. Kaart: Eesti tehnoloogiapargid. Vt. samas: Jüri tehnoloogiapark

  9. Ajalugu kui teater : pidamata jäänud loeng Juhan Viidingu teatritudengitele / David Vseviov

    Index Scriptorium Estoniae

    Vseviov, David, 1949-

    2009-01-01

    Ühiskonna hierarhiline ülesehitus ja sellega kaasnev soov sarnaneda tipus olijatega põhjustades matkimist soosib ju iseenesest teatrikunsti. Kohati on piir ajaloo ja teatri vahel peaaegu olematu. Kõige teatraalsemaks ajastuks peab autor absolutismi

  10. Eurokraadid piiravad sümfooniate ia ooperite valjust

    Index Scriptorium Estoniae

    2007-01-01

    15. veebr. 2008. aastal laieneb Brüsseli müradirektiiv tööstusvallast (piir 85 detsibelli) ka meelelahutuse valdkonnale ja kõigile sümfooniaid ja oopereid esitavatele orkestritele Euroopa Liidus

  11. The unstoppable expansion of the EU fundamental right to data protection: little shop of horrors? / Maja Brkan

    Index Scriptorium Estoniae

    Brkan, Maja

    2016-01-01

    Euroopa Liidu isikuandmete kaitse üldmäärusest, selle olulisusest ja mõjust kolmandatele riikidele. Euroopa Liidu andmekaitse laienemisest väljapoole Euroopa Liidu piire ja selle mõjust põhiõiguste kaitsele

  12. Postmodernistlikust teadusfantastikast = Postmodern science fiction / Märt Väljataga

    Index Scriptorium Estoniae

    Väljataga, Märt, 1965-

    2010-01-01

    New Yorgi ülikooli teoreetilise füüsika professor Alan Sokali 1994. aastal postmodernistlikust teadusest ilmunud paroodiaartiklist "Piire rikkudes: kvantgravitatsiooni hermeneutilise transformatsiooni poole" ja selle ümber tekkinud poleemikast

  13. Svjaz : s obshtshestvennostju ili s korruptsijei? / Virkko Lepassalu

    Index Scriptorium Estoniae

    Lepassalu, Virkko, 1971-

    2008-01-01

    Randvere tee detailplaneeringu lugu ja selle võimalik seos Tallinna abilinnapea nõuniku Ivo Parbuse korruptsioonisüüdistusega. Piir korruptsiooni ja seadusliku tegevuse vahel võib olla eristamatu. Lisa: Spravka "DD"

  14. Water Ser - areng läbi torude ja üle kraavide / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2007-01-01

    1992. aastal asutatud vee- ja kanalisatsioonitorustike paigaldamisele spetsialiseerunud perefirma AS Water Ser on kasvanud rahvusvaheliselt mainekaks kontserniks. Vt. samas: Perefirma arengu kronoloogia; Amet sai alguse teismelise eas kraavikaevamisest. Kommenteerivad Andrus Piir ja Toomas Kapp

  15. Eelnõu jätab kiirlaenu intressi suuruse kohtu otsustada / Lauri Linnamäe

    Index Scriptorium Estoniae

    Linnamäe, Lauri

    2008-01-01

    Seaduseelnõust, mis lubab kohtusse antud võlglastel taotleda ebamõistlikult suure intressi tühistamist, kuid ebamõistlikkuse piir jääb kohtu otsustada. Lisatud: kiirlaenuvõlglaste hulk kasvab kiires tempos

  16. Ajalooõpiku autor kirjutas võistluse parima romaani / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2009-01-01

    Romaanivõistluse võitjaks kuulutati romaan "Liblikad janus", autoriks ajalooharidusega Milvi Martina Piir, kelle sulest on varem ilmunud 5. klassi ajalooõpik "Inimesed ajas" ja luulekogu "Kõrkjavaas"

  17. Esmase ja teisese menetluse seosed piiriületavas pankrotimenetluses : [magistritöö] / Peeter Viirsalu ; Tartu Ülikool, õigusteaduskond ; juhendaja: Paul Varul

    Index Scriptorium Estoniae

    Viirsalu, Peeter

    2007-01-01

    Piireületav pankrotimenetlus ja selle peamised printsiibid, esmase ja teisese menetluse olemus, algatamine, lõpetamine, likvideerijad, nõuded ning otsuste tunnustamine esmases ja teiseses menetluses

  18. Preparation and Characterization of Keratin/Alginate Blend Microparticles

    OpenAIRE

    Srisuwan, Yaowalak; Srihanam, Prasong

    2018-01-01

    The water-in-oil (W/O) emulsification-diffusion method was used for construction of keratin (Ker), alginate (Alg), and Ker/Alg blend microparticles. The Ker, Alg, and Ker/Alg blend solutions were used as the water phase, while ethyl acetate was used as the oil phase. Firstly, different concentrations of Ker solution was used to find suitable content. 1.6% w/v Ker solution was blended with the same concentration of the Alg solution for further microparticle construction. Results from scanning ...

  19. Affärsmöjligheter med Smarta Elnät : En studie som undersöker möjligheter och hinder i utvecklingen av det svenska elsystemet

    OpenAIRE

    Ewing, Mikael

    2012-01-01

    Distributed, renewable generation-units and more efficient use of electric power,demands a developed electric grid. This grid is often referred to as the “Smart Grid”. This future electric system rise expectations among actors in the existing electricmarket. International organizations share visions of opportunities for electricityconsumers and new actors, ready to enter the market. At the same time, electricutility companies may question the need for some of these upcoming changes, as theyar...

  20. The gynoecium structure in Dracaena fragrans (L. Ker Gawl., Sansevieria parva N.E. Brown and S. trifasciata Prain (Asparagaceae with special emphasis on the structure of the septal nectary

    Directory of Open Access Journals (Sweden)

    Anastasiya Odintsova

    2014-01-01

    Full Text Available In the gynoecium of Dracaena fragrans, Sansevieria parva and S. trifasciata, the vertical zonality of the ovary, the structural zonality of the gynoecium following Leinfellner, and the zonality of the septal nectary were studied. The ovary structure is characterised by a high parenchymatous ovary base and ovary roof as well as a long septal nectary that can be extended in both of them and opens with secretory nectary splits. The gynoecium of these species has a short synascidiate zone, a fertile hemisynascidiate zone with a median ovule attached, a hemisymlicate zone (only in D. fragrans and an asymplicate zone (with postgenitally fused carpels that comprises the ovary roof, common style and stigma. In the septal nectary, we detected three vertical zones: the basal zone of the distinct nectary in the ovary base or/and the synascidiate zone, the zone of the common nectary (in the hemisynascidiate and hemisymlicate zones and the zone of the external nectary (the nectary splits in the asymplicate zone. The gynoecium structure in the studied species shows differences in the length of the gynoecium and septal nectary zones and also in the interrelationships of all these three types of vertical zonality.

  1. Fornøyelig Tiids-fordriv : musikk i norske notebøker fra 1700-tallet: beskrivelse, diskusjon og musikalsk presentasjon i et oppføringspraktisk perspektiv

    OpenAIRE

    Gorset, Hans Olav

    2011-01-01

    Avhandling (Ph.D.) - Norges musikkhøgskole, 2011. - Den trykte versjonen har vedlagt lydfiler (CD) som det jobbes med å få lagt ut på nettet. “The pleasurable passage of time”: A description, discussion, and musical presentation of music from 18th century Norwegian music books as seen in light of performance practice. - - This dissertation presents, in text and music, a repertoire widely disseminated and appreciated in 18th century Norway. Hand‐written music books or tune‐books contain mel...

  2. Narkootilise ja psühhotroopse aine suures koguses ebaseaduslik käitlemine suure varalise kasu saamise eesmärgil : [magistritöö] / Kerli Lepik ; Tartu Ülikool, õigusteaduskond ; juhendaja: Jaan Ginter

    Index Scriptorium Estoniae

    Lepik, Kerli, 1989-

    2013-01-01

    Suures koguses narkootilise ja psühhotroopse aine käsitlemisest, suure varalise kasu saamise eesmärgist, võrdlus teiste Euroopa riikidega (EL, Läti, Leedu, Soome, Norra, Tšehhi), suurest varalisest kasust kui koosseisutunnusest ja alternatiividest

  3. Eesti ja Venemaa vaheline riigipiir : tekkimine, muutumine, taastamine / Mart Nutt

    Index Scriptorium Estoniae

    Nutt, Mart, 1962-

    2010-01-01

    Piiriküsimuse taustast. Eesti riigipiiri küsimus tõstatus 1918. aastal 24. veebruari manifestiga, mis sisaldas ka loetelu Eesti maakondadest. Piir jäi täpselt kindlaks määramata kuni Vabadussõja lõpuni. Riigipiir demarkeeriti aastail 1920-1923. Eesti-Vene piir muudeti 1944. aastal Eesti teistkordse okupeerimise järel ühepoolselt Vene NFSV kasuks. Piiriküsimuse tõstatumisest seoses Eesti taasiseseisvumisega. Eesti ja Venemaa seisukohtadest riigipiiri küsimuses. Piiriküsimuste käsitlemisest. Piiriküsimusest Eesti liitumisel Euroopa Liidu ja NATO-ga

  4. What is the best way to enter Florida's real estate market in today's economy? : This may serve as a simple guide which offers options for a startup real estate company to enter any real estate market

    OpenAIRE

    Bryan, Paul

    2011-01-01

    P&I International real estate (PIIRE for short) is a real estate company which left the Florida real estate market in 2006. PIIRE is now seeking the best method to re-enter the Florida’s real estate market within the near future. The owners are seeking the best method to re-establish their real estate business in Florida. At this point the location in Florida has not yet been determined. The determining factors include financing options, business type entry mode, and governmental issues. ...

  5. Nelson ja Rodney - inglaste erandlikud lahingulaevad / Sander Kingsepp

    Index Scriptorium Estoniae

    Kingsepp, Sander

    2006-01-01

    1922. aastal Washingtonis alla kirjutatud mereväerelvastuse lepe läks ajalukku äpardunud katsena võidurelvastamisele piir panna. Leppega ühinenud riigid hakkasid ilmutama veidra välimusega sõjalaevu, mille seas olid aukohal Briti alused "Nelson" ja "Rodney"

  6. IBBY kongressist Londonis / Piret Raud

    Index Scriptorium Estoniae

    Raud, Piret, 1971-

    2012-01-01

    Rahvusvahelisest Noorsookirjanduse Nõukogu kongressist Londonis, mis kandis pealkirja "Ületades piire: tõlked ja ränded". Kongressil anti üle ka Hans Christian Anderseni auhinnad. Kirjanikupreemia sai María Teresa Andruetto ja parima illustraatori tiitli Peter Sís.

  7. Pornograafia, kunst ja tsensuur / Katrina Sirelpuu

    Index Scriptorium Estoniae

    Sirelpuu, Katrina

    2011-01-01

    Lõputöös uuritakse seksikultuuri, selle erinevaid tahke ja vorme ajaloos, samuti kust läheb erinevate kogukondade teadvuse piir pornograafia ja kunstina tõlgendatava vahel. Praktiline osa koosneb viiest suureformaadilisest moefotost, millel poseerivad erineva seksuaalse energia ja hoiakuga modellid

  8. Estonia beyond the edge / Eric Kluitenberg

    Index Scriptorium Estoniae

    Kluitenberg, Eric

    2004-01-01

    Festivali "Interstanding" üks initsiaatoreid arutleb 1990. aastate meedia festivalidel käsitletud teemade tähendusest eesti kultuurile ja selle identiteedile. 1999. aastal toimunud kolmanda festivali teemaks oli "Ülalpool piire - põgenemine marginaalsuse eest". Eestist saanud uute poliitilis-majanduslike ja globaalkultuuriliste võrgustike osa, olles olnud omamoodi vahetsooniks

  9. Karm tegelikkus: kuu sissetulek 1000 krooni / Dannar Leitmaa

    Index Scriptorium Estoniae

    Leitmaa, Dannar, 1982-

    2010-01-01

    Tallinna tervishoiu- ja sotsiaalameti hoolekandeosakonna peaspetsialisti Ljudmilla Leiuse hinnangul on toimetuleku piir ajale jalgu jäänud. Tallinnas on toimetulekutoetust saavate perede hulk kasvanud aastaga mitu korda. Sotsiaalminister Hanno Pevkuri sõnul on toimetulekupiiri tõstmise eelduseks eelarveliste vahendite olemasolu. Graafik, diagramm

  10. Region-building and security: The multiple borders of the Baltic Sea region after EU enlargement / Katharina Koch

    Index Scriptorium Estoniae

    Koch, Katharina

    2015-01-01

    Artikkel käsitleb Läänemere riikide (sh Eesti) piire, täpsemalt, kuidas piiride rajamine ja nende kaotamine mõjutab riikidevahelist koostööd, aluseks enam kui 20 antud teemat käsitleva dokumendi analüüs

  11. Seiklusfilme maalt ja merelt / Lauri Saaber

    Index Scriptorium Estoniae

    Saaber, Lauri

    2001-01-01

    Sõjafilm "U-571" : stsenarist ja režissöör Jonathan Mostow : Ameerika Ühendriigid 2000 ja mängufilm "Ülemine piir" ("Vertical Limit") : režissöör Martin Campbell : Ameerika Ühendriigid 2000

  12. Koputajate kaitseks! / Ivar Tallo

    Index Scriptorium Estoniae

    Tallo, Ivar, 1964-

    2003-01-01

    Politoloog Ivar Tallo arvates võiks Riigikogu välja tulla initsiatiiviga luua ühiskonna esindajate osavõtul vigade ja pettuste paljastajate kaitse seadus. Küsimusele, kust läheb politseiametniku sõnavabaduse piir vastavad Ain Seppik, Tarmo Loodus ja Jaanus Rahumägi. Indrek Sirgi juhtum

  13. Teatri moodi kunst paneb publiku uude rolli / Liina Luhats

    Index Scriptorium Estoniae

    Luhats, Liina

    2011-01-01

    Taani osalusteatri SIGNA etenduslik installatsioon "Bleier Research Inc" Tallinnas Standardi majas. Piireületavat eksperimenti mängivad avalikul konkursil Eestist valitud näitlejad. Intervjuu Signa Sørenseniga taani-austria kunstnikeduost SIGNA. Eesti teatritegijate arvamusi

  14. "Interstanding 3"

    Index Scriptorium Estoniae

    1999-01-01

    25. nov.-st Rotermanni soolalaos rahvusvaheline meediakunsti festival 'Interstanding 3' 'Beyond the Edge ئ Ülalpool piire'. Kuraator Ando Keskküla. Loetletud näitusel osalejad. Eestit esindavad Kai Kaljo, Kiwa, Marko Laimre, Mare Tralla. 26. ja 27. XI Rotermanni soolalaos toimuval konverentsil esinejad, ettekanded. Konverentsi kureerib Eric Kluitenberg Hollandist. Korraldajad: Eesti Kunstiakadeemia, Kaasaegse Kunsti Eesti Keskus.

  15. Kui naine tahab olla kangelane : kestvus-perfomance "Äng - 161 km palja rindkerega" / Fideelia-Signe Roots

    Index Scriptorium Estoniae

    Roots, Fideelia-Signe, 1976-

    2014-01-01

    Fideelia-Signe Roots oma aktsioonist tegevuskunstiürituse "Äng" raames, mille käigus kunstnik kõndis jalgsi alasti ülakehaga 161 kilomeetrit Tartust Karepale eesmärgiga testida naise kehakuvandi piire. Kangelase ja superkangelase mõistest

  16. Euroopa tõelised lood / Timothy Garton Ash

    Index Scriptorium Estoniae

    Garton Ash, Timothy, 1955-

    2007-01-01

    Autor arutleb uue Euroopa identiteedi loomise võimalusi kuue väärtuse - vabaduse, rahu, seaduste, jõukuse, mitmekesisuse ja solidaarsuse abil. Vt. samas Nigel Haywood: uued liikmesriigid - rohkem muresid või kogemusi?; Marianne Mikko: Kas Euroopa Liidu laienemisele tuleb piir ette?

  17. Kunst elada piiri peal / Eric Kluitenberg ; interv. Heie Treier

    Index Scriptorium Estoniae

    Kluitenberg, Eric

    1999-01-01

    Võrguteoreetik Eric Kluitenberg Amsterdamist valgustab 'Interstanding 3' 'Ülalpool piire' tagamaad ja seost Eestiga. Üritus toob Eestisse rahvusvahelisi tippteoreetikuid, kes analüüsivad elu piiri peal, ja kunstnikke, kes seda seisundit oma loomingus kajastavad. Osalema kutsutuid. Piiripealsuset seoses poliitika, interneti, meediaga, äärealadest.

  18. Kõik kuninganna lapsed / Ian Buruma ; tõlkinud Külli-Riin Tigasson

    Index Scriptorium Estoniae

    Buruma, Ian

    2011-01-01

    Monarhia on sageli populaarne vähemuste hulgas, Hollandi kuninganna Beatrix ei tõmba piire oma alamate seas nende rahvuse või usu põhjal. Aristokraatlik tava seista kõrgemal natsionalismi väiklusest võib olla parim argument, miks monarhia säilitamist toetada

  19. Kvaliteedijuhtimissüsteemide rakendamise kogemused majandussektorites / Tiit Hindreus

    Index Scriptorium Estoniae

    Hindreus, Tiit

    2006-01-01

    Autor on seisukohal, et iga organisatsioon peaks oma protsesse mõistuse piires standardima. Standardite kasutamise otsustab iga organisatsioon ise, reeglina on kasutamine vabatahtlik. Standardite arengust. Väljavõtteid TTÜ mehhatroonikainstituudi kvaliteeditehnika õppetooli ja EAS-i ühisuuringust "Eeluuring kvaliteediteadlikkuse programmi sihtrühmade relevantsete vajaduste leidmiseks 2005". Skeem

  20. Ando Keskküla, kas sa arvad, et 'Interstanding'u'-taolised üritused suudavad kuidagi mõjutada meie praegust tegelikkust ja kui, siis kuidas? / Ando Keskküla ; interv. Katrin Kivimaa

    Index Scriptorium Estoniae

    Keskküla, Ando, 1950-2008

    1999-01-01

    "Interstanding'u" missioon: tõestada, et infoühiskond ei ole ainult e-kaubandus ja kiire kasumi võimalus. Esimese ja teise "Interstanding'u" panus Eestile, kolmanda "Interstanding'u" 'Ülalpool piire' üleskutse.

  1. Der Peipussee/Peipsi järv Fischereiche Ostgrenze der EU / Arne von Maydell

    Index Scriptorium Estoniae

    Maydell, Arne von

    2012-01-01

    Mööda Peipsi järve kulgeb alates 1. maist 2004 Euroopa Liidu ja Venemaa vaheline piir. Suur siseeveekogu on üks suuremaid järvi Euroopas. Järv on väga kalarikas. Nii vene kui eesti kultuuris on Peipsi järvel oma koht

  2. Maamaksu tõus nuhtleb elanikke erinevalt / Andrus Karnau, Lauri Linnamäe, Kaire Uusen

    Index Scriptorium Estoniae

    Karnau, Andrus

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 3. dets. lk. 4. Maamaksu suurtest kõikumistest valdades ja valla piires. Lisa: Maamaksumäärad tõusevad paiguti. Vt. samas: Maamaks täidab kukrut isemoodi. Kommenteerivad: Martin Schwindt, Urmas Ahven, Rein Triis, Urve Tiidus

  3. Kas on oodata ka jätku? / Ülo Tedre

    Index Scriptorium Estoniae

    Tedre, Ülo, 1928-

    2011-01-01

    Arvustus: Jakob Hurda perekonna kirjavahetus aastail 1866-1917. Esimene köide, 1866-1896 / [koostanud Henno Lender]. Tartu : Ilmamaa, 2007 ; Jakob Hurda perekonna kirjavahetus aastail 1866-1917. Teine köide, 1897-1917 / [koostanud Henno Lender]. Tartu : Ilmamaa, 2007 ; Reiman, Villem. Villem Reimani ja Jakob Hurda kirjavahetus aastatel 1884–1904 / [koostanud Tarmo Piir]. Tartu : Ilmamaa, 2010

  4. Kolm festivali marginaalsusest / Anders Härm

    Index Scriptorium Estoniae

    Härm, Anders, 1977-

    1999-01-01

    Meediakunstisündmustest: festival 'Backdoor Media' ئ 'Fassaadid kodututele' (kuraator H. Soans), offline@online festival 'Media Non Grata' (kuraator R. Kelomees), 'Interstanding 3' alapealkirjaga "Ülalpool piire. Pääsemine marginaalsusest" (kuraatorid S. Helme, A. Keskküla, E. Kluitenberg, S. Kovac). Kodutus ja marginaalsus. Low Tech ja marginaalsus. 'Interstandingu' näitus.

  5. Preparation and Characterization of Keratin/Alginate Blend Microparticles

    Directory of Open Access Journals (Sweden)

    Yaowalak Srisuwan

    2018-01-01

    Full Text Available The water-in-oil (W/O emulsification-diffusion method was used for construction of keratin (Ker, alginate (Alg, and Ker/Alg blend microparticles. The Ker, Alg, and Ker/Alg blend solutions were used as the water phase, while ethyl acetate was used as the oil phase. Firstly, different concentrations of Ker solution was used to find suitable content. 1.6% w/v Ker solution was blended with the same concentration of the Alg solution for further microparticle construction. Results from scanning electron microscope analysis show that the microparticles have different shapes: spherical, bowl-like, porous, and hollow, with several sizes depending on the blend ratio. FTIR and TG analyses indicated that the secondary structure and thermal stability of the microparticles were influenced by the Ker/Alg blend ratio. The interaction between functional groups of keratin and alginate was the main factor for both β-sheet structure and Td,max values of the microparticles. The results suggested that Ker/Alg blend microparticles might be applied in many fields by varying the Ker/Alg ratio.

  6. Probing potential energy curves of C2- by translational energy spectrometry

    International Nuclear Information System (INIS)

    Gupta, A.K.; Aravind, G.; Krishnamurthy, M.

    2004-01-01

    We present studies on collision induced dissociation of C 2 - with Ar at an impact energy of 15 keV. The C - fragment ion kinetic-energy release (KER) distribution is measured and is used to compute the KER in the center of mass (c.m.) frame (KER c.m. ). We employ the reflection method to deduce an effective repulsive potential-energy curve for the molecular anion that is otherwise difficult to evaluate from quantum computational methods. The nuclear wave packet of the molecular ion in the initial ground state is computed by the semiclassical WKB method using the potential-energy curve of the 2 Σ g + ground electronic state calculated by an ab initio quantum computation method. The ground-state nuclear wave packet is reflected on a parametrized repulsive potential-energy curve where the parameters are determined by fitting the measured KER c.m. with the calculated KER distribution

  7. Applicability of rapid and on-site measured enzyme activity for surface water quality monitoring in an agricultural catchment

    Science.gov (United States)

    Stadler, Philipp; Farnleitner, Andreas H.; Sommer, Regina; Kumpan, Monika; Zessner, Matthias

    2014-05-01

    For the near real time and on-site detection of microbiological fecal pollution of water, the measurement of beta-D- Glucuronidase (GLUC) enzymatic activity has been suggested as a surrogate parameter and has been already successfully operated for water quality monitoring of ground water resources (Ryzinska-Paier et al. 2014). Due to possible short measure intervals of three hours, this method has high potential as a water quality monitoring tool. While cultivation based standard determination takes more than one working day (Cabral 2010) the potential advantage of detecting the GLUC activity is the high temporal measuring resolution. Yet, there is still a big gap of knowledge on the fecal indication capacity of GLUC (specificity, sensitivity, persistence, etc.) in relation to potential pollution sources and catchment conditions (Cabral 2010, Ryzinska-Paier et al. 2014). Furthermore surface waters are a big challenge for automated detection devices in a technical point of view due to the high sediment load during event conditions. This presentation shows results gained form two years of monitoring in an experimental catchment (HOAL) dominated by agricultural land use. Two enzymatic measurement devices are operated parallel at the catchment outlet to test the reproducibility and precision of the method. Data from continuous GLUC monitoring under both base flow and event conditions is compared with reference samples analyzed by standardized laboratory methods for fecal pollution detection (e.g. ISO 16649-1, Colilert18). It is shown that rapid enzymatic on-site GLUC determination can successfully be operated from a technical point of view for surface water quality monitoring under the observed catchment conditions. The comparison of enzyme activity with microbiological standard analytics reveals distinct differences in the dynamic of the signals during event conditions. Cabral J. P. S. (2010) "Water Microbiology. Bacterial Pathogens and Water" International Journal of

  8. Kui kõik on tsitaat, siis pole miski tsitaat : kolm case'i / Anders Härm

    Index Scriptorium Estoniae

    Härm, Anders, 1977-

    2009-01-01

    Inglise popkultuuri ja kunsti vahelistest suhetest, 1960-1970-ndate kontseptualistliku ja minimalistliku kunsti mõjutustest, Gustav Metzgerist kui autodestruktiivse kunsti loojast ja ansamblist The Who, kes teostas eelmise ideid muusikas pillide igaõhtuse purustamisega, bänd oli kui performance, kui kontseptuaalne kunstiteos, mis toimis muusikatööstuse paroodiana, testides kuulajate taluvuse piire. Samas võtmes ka ansamblitest Throbbing Gristle ja Martin Creede loodud Owadast (1994)

  9. The risks and management of telework / Maris Zernand

    Index Scriptorium Estoniae

    Zernand, Maris

    2003-01-01

    Infotehnoloogia ja telekommunikatsiooni areng võimaldab inimestel täita tööülesandeid väljaspool ettevõtte piire. Ülevaade kaugtöö kui töövormi mõistest, levikust, eelistest ning riskidest inimesele ja organisatsioonile. Autor tutvustab Eesti Kõrgemas Kommertskoolis (EBS) läbiviidud uuringut töötajate hoiakute ja valmisoleku kohta töövormi rakendamiseks

  10. Loomingu eluandev jõud / Siim Angerpikk

    Index Scriptorium Estoniae

    Angerpikk, Siim

    2015-01-01

    Maailmafilmi festivali raames linastuvatest filmidset "Gualdino üheksas elu" (rež. Filipe Araújo), Portugal-Prantsusmaa; "C-minoori eripärad (rež. Ollie Lucks, Max Bellamy), Uus-Meremaa; "Salto Mortale" (rež. Guillaume Kozakiewiez), Prantsusmaa-Šveits;"Tantsud Mariaga" (rež. Ivan Gergolet), Itaalia-Argentiina-Sloveenia. Filme ühendab loomeinimeste püüd üleatda takistusi ja piire oma igapäevatöös.

  11. Kui panga president end maha laseb... / Aarne Ruben

    Index Scriptorium Estoniae

    Ruben, Aarne, 1971-

    2008-01-01

    Autor vaatleb kriise USA majanduses alates Iseseisvussõjast ning järeldab, et USA majanduses vaheldusid depressioonid perioodilises tempos, nagu 1921. aastal väitis Lev Trotski. Autor leiab, et inimnäoline sotsialism ei ole võimalik, kui impeerium ei ava oma piire ega lase soovijaid impeeriumist välja, inimnäoline kapitalism on aga võimalik majandustõusude ja -languste hinnaga

  12. Järvamaa : Äripäev maakonnas / Merike Lees

    Index Scriptorium Estoniae

    Lees, Merike, 1976-

    2007-01-01

    Järvamaa ettevõtete TOP. Vt. samas: Mäo tehnoküla paneb Eestimaa südame tuksuma. Diagramm; Järva gasellid üle Eesti ilma ei tee; Käsitöö annab Vikingile konkurentsieelise; Paide MEK toodab metallkonstruktsioone; Ülemaailmne turg tagab kasvuvõimaluse; Mäo tehnopargil piire pole. Küsimustele vastab Toomas Agasild

  13. Mashadovit tappes kinkis Moskva tshetsheenidele märtri / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2005-01-01

    Tšetšeenia presidendi Aslan Mashadovi tapmine on seadnud Tšetšeenia iseseisvuse eest võitlejad valiku ette, kas leida uus president riigile eksiilis või anda presidendi amet Tšetšeenia piires vastupanu jätkavale võitlejale. Lisa: Varem juba kaks korda "tapetud". Vt. samas: Mashadov võidi tappa 6. märtsil, teatega oodati naistepäevani

  14. Euroopa hing / Joseph Ratzinger ; tõlk. Külli-Riin Tigasson

    Index Scriptorium Estoniae

    Ratzinger, Joseph

    2005-01-01

    Paavst Benedictus XVI sõnul võib moraalsete väärtuste purunemine viia Euroopa identiteedi enesehävitamiseni. Inimväärikusest ja inimõigustest peab kujunema tingimusteta väärtus, ka on Euroopa identiteedi jaoks keskne tähtsus abielul ja perekonnal. Sõnavabadusel peab olema piir: teise inimese au ega väärikust ei tohi haavata

  15. Aastahitt 2008. Chalice "Supervõimed". Laura "Destiny" / Kallervo Karu

    Index Scriptorium Estoniae

    Karu, Kallervo

    2009-01-01

    Aastahitt 2008 valimisest (võitis Kerli Kõivu lugu "Walking on Air") ja kontserdist ETV ja Raadio 2 koostööna Tallinnas Club von Überblingenis. Heliplaadist. Laura Põldvere esitatavast eurolaulust

  16. Sauga naised rajavad lugejale teed netikeskkonda / Silja Joon

    Index Scriptorium Estoniae

    Joon, Silja, 1966-

    2009-01-01

    Sauga raamatukogu juhataja Piia Salundi koos Šotimaal elava sõbratari Kerli Altmartiga asutasid e-raamatukogu. Abistas TTÜ teadur Andrei Errapart. Aadressil e-raamatukogu.com on üleval 72 raamatut 35 autorilt

  17. Avatud ruumi mõttekoondaja / Elen Luht

    Index Scriptorium Estoniae

    Luht, Elen

    2013-01-01

    ADM Interactive'i kontori vihmavarju meenutavad valgustid, interjööri kujundasid sisearhitektid Ahti Grünberg, Kerli Valk, Tomomi Hayashi. Rootsi disainistuudio Form Us With Love kujundatud moodulitest koosnev valgusti

  18. the reaction of patients with typhoid pever.to the administration of ...

    African Journals Online (AJOL)

    2018-05-10

    May 10, 2018 ... This reaction, characterized by a sudden fall in tempera- ture to subnormal levels ... Chloramphenicol therapy was started after blood cultures had been taken. .... Ker, F. (1939): Manual ofFevers, 4th ed., p. 230. London: Oxford.

  19. Age McCanni büroo = Offices of Age McCann

    Index Scriptorium Estoniae

    2010-01-01

    Tallinnas Rotermanni 8 asuva Age McCanni büroo sisekujundusest. Sisekujunduse autorid: sisearhitekt Kerli Valk (Kukuhaus OÜ) ja arhitekt Tomomi Hayashi (HG Arhitektuur OÜ), nende tähtsamate tööde loetelu

  20. Rutiinivabad reklaamikatlad : jänkudest, kaladest, lauajalgpallist ja golfist rääkimata / Maris Takk

    Index Scriptorium Estoniae

    Takk, Maris

    2009-01-01

    Reklaamibüroo Tank kontorist endise Baltika õmblustsehhi ruumides (sisearhitekt Tiina Teng-Tamme). Reklaamibüroo Age McCann bürooruumidest Rotermanni kvartali Jahulaos (arhitekt Tomomi Hayashi, sisearhitekt Kerli Lepp)

  1. Euroopa lemmiku nominent ja Baltikumi parim on Happyendless

    Index Scriptorium Estoniae

    2008-01-01

    6. nov. Liverpoolis toimuvale MTV Euroopa muusikaauhindade galale pürgisid parima Balti artisti tiilile Kerli Kõiv ja duo Rulers of the Deep, leedust ansambel Happyendless ja laulja Jurga ning lätist ansambel Detlef Zoo. Ansamblist Happyendless

  2. 2262-IJBCS-Article-Charles Fokunang

    African Journals Online (AJOL)

    hp

    texture using an electric blender, and kept in polyethylene bags ... was evaluated by measuring the inhibition zone of the tested ..... their foaming and lytic effect on cells (Okwu,. 2005; Okigbo ... methanol stem extracts of Costus afer Ker. Gawl.

  3. Buitenlandse bomen op 7e rassenlijst

    NARCIS (Netherlands)

    Buiteveld, J.; Vries, de S.M.G.

    2002-01-01

    Van een aantal boomsoorten is kwalitatief goed uitgangsmateriaal schaars in Nederland. Voor negen loofhoutsoorten (zwarte els, haagbeuk, es, beuk, wintereik, kers, zomereik, winterlinde, zomerlinde) heeft Alterra onderzocht of buitenlandse herkomsten ook geschikt zijn voor gebruik in ons land.

  4. Å speide etter spiritualitet. En analyse av spiritualitetsbegrepet i speiderbevegelsen

    OpenAIRE

    Holmefjord, Aina

    2015-01-01

    Denne masteroppgaven inneholder analyser av speiderbevegelsens bruk av begrepet "spiritualitet" i to bøker skrevet av bevegelsens grunnlegger; "Scouting for Boys" og "Rovering to Succes" og to dokumenter av The World Organization of he Scoutmovement . Robert Baden-Powell grunnlag speiderbevegelsen i 1908 og hans litteratur og bøker publisert på tidlig 1900-tallet setter rammeverk for mye av dagens speiderbevegelses ideologi og visjon. Speiderbevegelsen har et r...

  5. Asiakkaan datan mallinnus ja sen analysointi Business Intelligence -järjestelmässä

    OpenAIRE

    Porkka, Ville

    2017-01-01

    Opinnäytetyön tavoitteena oli toteuttaa asiakkaalle Business Intelligence -järjestelmää käyttäen ympäristö kyselytutkimuksella kerätyn datan analysointia varten. Asiakkaan analyyseille asettamien vaatimusten vuoksi aiemmin kerätty data oli muutettava Business Intelligence -järjestelmän, ja erityisesti tietovarastoinnin kannalta optimaaliseen, moniulotteiseen muotoon. Asiakkaalle luotiin uusi relaatiotietokanta moniulotteisessa mallinnuksessa yleisesti käytetyn tähtimallin pohjalta. Asiakkaan ...

  6. Photodissociation of H2+ by intense chirped pulses - beyond the effect of pulse duration and peak power

    International Nuclear Information System (INIS)

    Lev, U; Prabhudesai, V; Natan, A; Bruner, B; Diner, A; Heber, O; Strasser, D; Schwalm, D; Silberberg, Y; Zajfman, D; Ben-Itzhak, I; Hua, J J; Esry, B D

    2009-01-01

    H 2 + photodissociation, induced by intense short laser pulses, was measured by a full 3D imaging system. We have conducted a series of experiments, in which we systematically changed the linear chirp, using a pulse shaper, and observed the kinetic energy release spectra(KER). Distinct differences in the KER spectra are observed both in peak positions and angular distribution for laser pulses with similar duration and intensity but opposite chirp sign.

  7. Photodissociation of H{sub 2}{sup +} by intense chirped pulses - beyond the effect of pulse duration and peak power

    Energy Technology Data Exchange (ETDEWEB)

    Lev, U; Prabhudesai, V; Natan, A; Bruner, B; Diner, A; Heber, O; Strasser, D; Schwalm, D; Silberberg, Y; Zajfman, D [Faculty of Physics, Weizmann Institute of Science, Rehovot 76100 (Israel); Ben-Itzhak, I; Hua, J J; Esry, B D, E-mail: uri.lev@Weizmann.ac.i [Department of Physics, Kansas State University, Manhattan, KS 66506 (United States)

    2009-11-01

    H{sub 2}{sup +} photodissociation, induced by intense short laser pulses, was measured by a full 3D imaging system. We have conducted a series of experiments, in which we systematically changed the linear chirp, using a pulse shaper, and observed the kinetic energy release spectra(KER). Distinct differences in the KER spectra are observed both in peak positions and angular distribution for laser pulses with similar duration and intensity but opposite chirp sign.

  8. Fragmentation and mean kinetic energy release of the nitrogen molecule

    International Nuclear Information System (INIS)

    Santos, A.C.F.; Melo, W.S.; Sant'Anna, M.M.; Sigaud, G.M.; Montenegro, E.C.

    2007-01-01

    Ionization and fragmentation of the N 2 molecule in coincidence with the final projectile charge state have been measured for the impact of 0.188-0.875 MeV/amu He + projectiles. The average kinetic energy release (KER) of the target ionic fragments is derived from the peak widths of their time-of-flight distributions. It is shown that the KER's for singly-charged products follow scaling laws irrespectively to the collision channel

  9. Unge voksne på Tinder : en kvalitativ studie

    OpenAIRE

    Ottesen, Mathilde Dagsvik

    2015-01-01

    Denne studien undersøker Tinder som arena for selvpresentasjon. Gjennom kvalitative intervjuer med syv studenter mellom 20 og 30 år, har jeg søkt svar på hvordan en presenterer seg selv på Tinder, hvordan en vurderer andre brukeres selvpresentasjon, samt implikasjoner av Tinder. I samsvar med Bourdieu (1986), undersøker jeg Tinder som et sosi...

  10. Å forske med kunsten kollaborativt i en fortellerforestillingsproduksjon

    Directory of Open Access Journals (Sweden)

    Mette Bøe Lyngstad

    2018-03-01

    Full Text Available I denne artikkelen viser forskerne, som også er fortellere, hvordan de i utviklingen av sin egen fortellerforestilling forsket med kunsten. Artikkelforfatterne forsøker å vise en selvrefleksivitet og metodologisk bevissthet gjennom hele kunstproduksjonen. De undersøker hvordan en gjennom å forske med kunsten kollaborativt kan koble historiske fakta, fiksjonsfortelling og livsfortelling i en kunstproduksjon. Forskningsartikkelen tar for seg kunstproduksjonens ulike faser som brainstormfase, innsamlingsfase, fortellertekniske fase og utforskingsfase i scenerommet.

  11. "Man skal altid gå tilbage til en fuser"

    DEFF Research Database (Denmark)

    Larsen, Steen Nepper

    2012-01-01

    Anmeldelse af Center for Vild Analyse. Brian Benjamin Hansen, Rasmus Ugilt, Steen Thykjær, Kasper Porsgaard, Henrik Jøker Bjerre: Særklasse. Den tøvende revolution, Informations Forlag, 2012, 203 sider......Anmeldelse af Center for Vild Analyse. Brian Benjamin Hansen, Rasmus Ugilt, Steen Thykjær, Kasper Porsgaard, Henrik Jøker Bjerre: Særklasse. Den tøvende revolution, Informations Forlag, 2012, 203 sider...

  12. Supervision og de tre k´er

    DEFF Research Database (Denmark)

    Schilling, Benedicte; Jacobsen, Claus Haugaard; Nielsen, Jan

    2010-01-01

    Kontrol, kontrakt og kontekst er supervisionens tre k'er. Men hvad er supervision i det hele taget for en størrelse, der spillerså central en rolle for den psykologfaglige profession?......Kontrol, kontrakt og kontekst er supervisionens tre k'er. Men hvad er supervision i det hele taget for en størrelse, der spillerså central en rolle for den psykologfaglige profession?...

  13. Analytic vectors and irreducible representations of nilpotent Lie groups and algebras

    International Nuclear Information System (INIS)

    Arnal, D.

    1978-01-01

    Let U be a unitary irreducible locally faithful representation of a nilpotent Lie group G, V the universal enveloping algebra of G, M a simple module on V with kernel ker dU, then there exists an automorphism of V keeping ker dU invariant such that, after transport of structure, M is isomorphic to a submodule of the space of analytic vectors for U. (Auth.)

  14. CARACTERÍSTICAS DEMOGRÁFICAS, HÁBITOS DE VIDA E HISTORIA DEL CONSUMO DE TABACO DE LOS FUMADORES OCASIONALES EN ESPAÑA

    Directory of Open Access Journals (Sweden)

    Lucía Díez Gañán

    2002-01-01

    Full Text Available Back ground. This study des cribes the so cio de mo grap hic cha rac te ris tics, health-re lated li fest yle, and his tory of to bac co con sump tion of the oc casional smo kers in Spain, and exa mines whet her they show dif fe ren ces against daily smo kers. Met hods. Data were ob tai ned from the Na tional Health Sur vey of Spain, ca rried out in 1993 through hou sehold in ter - views on a sam ple re pre sen ta ti ve of the non-ins ti tu tio na li sed po pu la tion aged 16 year and ol der. Analy ses were per for med with lo gis tic re gres sion and ad justed for so cio de mo grap hic, health-sta te and life-style va ria bles. Results. Out of the 6,668 smo kers in the sur vey, oc casional smokers were 9.2%, whi le daily smo kers of £5 ci garettes and >5 cigarettes were 9.9% and 80.9%, res pectively. As com pared with daily smo kers of >5 ci garettes, oc casional smo kers were more fre - quently wo men (odds ra tio (0R:2.12; CI95%:1.72-2.61, youn ger (OR aged 25-44 ver sus 16-24 years: 0.75; 0.58-0.96, with lo wer alcohol con sumption (p for li near trend: 0.0349, and hig her lei su - re-time physi cal ac tivity (p for li near trend: 5 ci garettes. Con clu sions: Occa sio nal smo kers show so cio de mo grap hic cha rac te ris tics, health-re lated li fest yle, and his tory of to bac co con sump tion dif fe rent from daily smo kers. Such dif fe ren ces sug gest that re search and in ter ven tion pro grams spe cifically tai lo red to oc ca sio nal smo kers should be de veloped.

  15. Corneal topography with an aberrometry-topography system.

    Science.gov (United States)

    Mülhaupt, Michael; Dietzko, Sven; Wolffsohn, James; Bandlitz, Stefan

    2018-05-07

    To investigate the agreement between the central corneal radii and corneal eccentricity measurements generated by the new Wave Analyzer 700 Medica (WAV) compared to the Keratograph 4 (KER) and to test the repeatability of the instruments. 20 subjects (10 male, mean age 29.1 years, range 21-50 years) were recruited from the students and staff of the Cologne School of Optometry. Central corneal radii for the flat (r c/fl ) and steep (r c/st ) meridian as well as corneal eccentricity for the nasal (e nas ), temporal (e temp ), inferior (e inf ) and superior (e sup ) directions were measured using WAV and KER by one examiner in a randomized order. Central radii of the flat (r c/fl ) and steep (r c/st ) meridian measured with both instruments were statically significantly correlated (r = 0.945 and r = 0.951; p  0.05). Limits of agreement (LoA) indicate a better repeatability for the KER compared to WAV. Corneal topography measurements captured with the WAV were strongly correlated with the KER. However, due to the differences in measured corneal radii and eccentricities, the devices cannot be used interchangeably. For corneal topography the KER demonstrated better repeatability. Copyright © 2018 British Contact Lens Association. Published by Elsevier Ltd. All rights reserved.

  16. Transvestisuus perheessä

    OpenAIRE

    Leinonen, Eeva-Kaisa

    2005-01-01

    Tässä opinnäytetyössä tarkastellaan transvestisuuteen liittyviä näkemyksiä ja kokemuksia perheessä ja osana vanhemmuutta. Tutkimus toteutettiin laadullisin menetelmin. Aineisto kerättiin kahdessa vaiheessa. Pääaineisto koostuu kahden transvestiitin lapsena kasvaneen naisen haastatteluista. Tätä aineistoatäydennetään käyttämällä aiemmin kerättyä seitsemän itsensä transvestiitiksi määrittelevän miehen haastatteluaineistoa. Pääaineisto kerättiin avoimilla haastatteluilla ja täydentävä aineisto t...

  17. Den enes död, den andres bröd : En fallstudie i Fonus kriskommunikation

    OpenAIRE

    Orest Flavet, Sebastian

    2014-01-01

    Denna studie undersöker hur begravningsbyrån Fonus valde att bemöta en kritisk artikel, publicerad i Aftonbladet, med ett pressmeddelande som lades upp på den egna hemsidan. Uppsatsen undersöker först vilka retoriska verktyg som har använts i skapandet av detta meddelande, och sett från Benoits teori om Image Repair, vilka strategier som använts och hur användningen av dessa har sett ut. Därefter söker studien att praktiskt undersöka detta budskap genom att låta en utvald grupp respondenter t...

  18. Spelfördelar med minnesinjektion

    OpenAIRE

    Aspegren, Villiam; Persson, Kim

    2013-01-01

    Spel på internet är populärare än någonsin i dagens samhälle, det är en industri som omsätter stora summor pengar varje år. Fler och fler människor söker sig till dessa spelsajter. Hur kan du som spelare vara säker på att dina motståndare spelar på samma villkor? Arbetet som utförts på KTH undersöker hur programmet på användarens egen dator kan exploateras för att vinna fördelar i spelet. Endast minnesinjektion kommer att undersökas i detta syfte. Olika tekniker för minnesinjektion samt försl...

  19. Roseomonas aeriglobus sp. nov., isolated from an air-conditioning system.

    Science.gov (United States)

    Lee, Yunho; Jeon, Che Ok

    2018-03-01

    A novel pale pink-coloured, strictly aerobic, Gram-stain negative bacterial strain, designated strain KER25-12 T , was isolated from a laboratory air-conditioning system in South Korea. Cells were observed to be non-motile cocci showing positive catalase and oxidase reactions. Strain KER25-12 T was found to grow at 10-30 °C (optimum, 25-30 °C), at pH 4.0-9.0 (optimum, pH 6.0-7.0) and in the presence of 0-2% (w/v) NaCl (optimum, 0%). Ubiquinone-10 and spermidine were detected as the sole respiratory quinone and the predominant polyamine, respectively. The major fatty acids were identified as summed feature 8 (comprising C 18:1 ω7c and/or C 18:1 ω6c), summed feature 3 (comprising C 16:1 ω7c and/or C 16:1 ω6c), C 16:0 and C 18:0 . The genomic DNA G+C content of strain KER25-12 T was determined to be 70.0 mol%. The major polar lipids were identified as diphosphatidylglycerol, phosphatidylglycerol, phosphatidylethanolamine, phosphatidylcholine and an unidentified aminolipid. Phylogenetic analysis based on 16S rRNA gene sequence comparison revealed that strain KER25-12 T belongs to the genus Roseomonas and shows high sequence similarity to Roseomonas aerilata 5420S-30 T (98.57%), Roseomonas pecuniae N75 T (97.44%) and Roseomonas vinacea CPCC 100056 T (97.40%). Based on the morphological, physiological, chemotaxonomic and phylogenetic features, strain KER25-12 T is concluded to represent a novel species of the genus Roseomonas, for which the name Roseomonas aeriglobus sp. nov. is proposed. The type strain is KER25-12 T (= KACC 19282 T  = JCM 32049 T ).

  20. Strategic venture capital in the financial industry : A multiple-case study on autonomy and its implications

    OpenAIRE

    KONGSHÖJ, MATILDA; LJUNGQVIST, EMILIE

    2016-01-01

    Den tidigare stabila finansbranschen har snabbt blivit hotad av den digitala transformationen. Ett strategiskt verktyg som används av etablerade banker som står inför denna nya och föränderliga miljö är strategiska riskkapitalinvesteringar i det närliggande området av finansiella teknologier (FinTech). Denna studie undersöker strategiskt riskkapital i termer av organisatorisk design; närmare bestämt graden av autonomi i riskkapitalverksamhetens investeringsprocess. Studien undersöker koncepte...

  1. Naisiin kohdistuva parisuhdeväkivalta ja auttavat tahot

    OpenAIRE

    Özen, Saija; Taavitsainen, Riina

    2015-01-01

    Opinnäytetyön tarkoituksena oli kerätä tietoa naisiin kohdistuvasta parisuhdeväkivallasta Suomessa. Keskityimme parisuhdeväkivaltaan suhteissa, joissa avo- tai aviopuolisoilla ei ole lapsia ja joissa mies on pahoinpitelijän roolissa. Tarkoituksena oli kerätä tietopaketti, jossa käymme läpi parisuhdeväkivaltaa ja sen monimuotoisuutta, avun hakemisen ja saamisen vaikeutta sekä auttamisprosessia parisuhdeväkivaltatyössä. Opinnäytetyömme teoriaosuudessa käsiteltiin parisuhdeväkivaltaa ilmiö...

  2. Seinäjoen kuntosaliohjaajien koulutustaustan, ravitsemusosaamisen ja ohjaustyylin kartoittaminen

    OpenAIRE

    Kumpunen, Miia

    2016-01-01

    Tutkimuksen tavoitteena oli kartoittaa Seinäjoen kuntosaliohjaajien koulutustausta, ravitsemusosaaminen ja ohjaustyyli. Tavoitteena oli, että kuntosalit saavat tutkimuksen avulla tietoonsa mahdolliset koulutustarpeet. Kuntosaliohjaajien koulutuksen ollessa hyvällä tasolla myös asiakkaiden saama ohjaus on laadukkaampaa ja he hyötyvät tästä enemmän. Aineisto kerättiin lomakekyselynä, joka sisälsi strukturoituja ja avoimia kysymyksiä. Ensimmäinen aineisto kerättiin syksyllä 2015 kuntosaliohja...

  3. Kouvolan vesilaitoksen pohjavedenottamoiden havainnointijärjestelmän kartoittaminen ja kehittäminen

    OpenAIRE

    Kuossari, Noora

    2013-01-01

    Tämän opinnäytetyön tavoitteena oli kartoittaa Kouvolan Veden pohjavedenottamoiden havaintoputkien kunto ja toimivuus sekä tarkastella automaattimittauksen toimivuutta ja sen mahdollista laajentamista sekä kehittämistä. Työ alkoi toukokuussa 2012 keräämällä tietoja pohjaveden pinnankorkeuksista ja havaintoputkista. Pohjavesien pinnakorkeuksia kerättiin vuodelta 2012. Lainsäädäntö vaatii vesihuoltolaitoksia seuraamaan pohjaveden pinnankorkeuksia. Kesäkuussa 2012 Haukkajärven tekopohjavesilaito...

  4. Kotitalouspalvelut ikääntyneen arjen tukena

    OpenAIRE

    Hiivala, Kerttu; Linnera, Emilia

    2009-01-01

    Väestön ikääntyminen tulee olemaan yhteiskunnallemme haaste. Koska julkiset palvelut eivät pysty yksin vastaamaan kasvavaan palvelun tarpeeseen, tarvitaan kotitalouspalveluita tukemaan ikääntyneiden arjessa selviytymistä. Opinnäytetyön tarkoituksena oli kartoittaa ikääntyneiden läntisen Jyväskylän asukkaiden tarvetta kotitalouspalveluille. Lisäksi tavoitteena oli kerätä tietoa siitä, miten ikääntyneet suhtautuvat kotitalouspalveluihin. Tutkimusote oli laadullinen, ja aineisto kerättiin teemah...

  5. Yritys X Oy:n myyntijohtolankojen hallintaprosessin kehittäminen

    OpenAIRE

    Jokinen, Mika

    2014-01-01

    Tässä kehittämistehtävässä tutkittiin miten Yritys X Oy:n myyntijohtolankojen hallintaprosessia voidaan kehittää niin, että se tuottaisi enemmän ja laadukkaampia myyntijohtolankoja myynnin käsiteltäväksi. Yritys X on kansainvälisiä logistiikkapalveluja tuottava yritys ja myyntijohtolankojen avulla voidaan hankkia uusia asiakkaita ja lisämyyntiä. Tutkimuksen lähtöaineisto kerättiin kyselytutkimuksella kuljettajilta ja ajojärjestelijöiltä. Kehittämistyön tueksi aineistoa kerättiin myös myy...

  6. MARKS ON ART database

    DEFF Research Database (Denmark)

    van Vlierden, Marieke; Wadum, Jørgen; Wolters, Margreet

    2016-01-01

    Mestermærker, monogrammer og kvalitetsmærker findes ofte præget eller stemplet på kunstværker fra 1300-1700. En illustreret database med denne typer mræker er under etablering på Nederlands Kunsthistoriske Institut (RKD) i Den Haag.......Mestermærker, monogrammer og kvalitetsmærker findes ofte præget eller stemplet på kunstværker fra 1300-1700. En illustreret database med denne typer mræker er under etablering på Nederlands Kunsthistoriske Institut (RKD) i Den Haag....

  7. Friends- ohjelman arviointia : Mitä nuoret pohtivat Friends- ohjelmasta ja tunnetaidoista?

    OpenAIRE

    Santala, Marika

    2013-01-01

    Opinnäytetyön tarkoituksena on arvioida Friends- ohjelmaa kohderyhmänsä näkökulmasta. Kohderyhmä tarkoittaa tässä tapauksessa nuoria, jotka ovat osallistuneet ohjelmaan. Arviointi tapahtui kerätyn palautteen avulla, ja palautteenantoon osallistui yhteensä kuusi luokkaa: kolme 8.luokkaa Helsingissä sijaitsevassa koulussa ja Espoossa sijaitsevassa koulussa palautteen antoi kaksi 7.luokkaa ja yksi 9.luokka. Yhteensä 91 oppilasta osallistui palautteen antoon. Palaute kerättiin kyselynä ja ryhmäh...

  8. Persistent hyperplastic primary vitreous – The martini glass sign

    African Journals Online (AJOL)

    2014-06-20

    /radiographics.14.5.7991814. 2. Küker W, Ramaekers V. Persistent hyperplastic primary vitreous: MRI. Neuroradiology. 1999;41(7):520–522. PMID: 10450848. http:// · dx.doi.org/10.1007/s002340050796. 3. Sun MH, Kao LY, ...

  9. The use of simple sequence repeats markers to study genetic ...

    African Journals Online (AJOL)

    SERVER

    2007-07-18

    Jul 18, 2007 ... of varietal development (Dreher et al., 2000; Welz and. Geigerb, 2002). These techniques utilize molecular mar- kers linked to quantitative trait loci (QTLs) that confer resistance to diseases. In Kenya, gray leaf spot caused by Cercospora zeae- maydis (Theon and Daniels) results in significant yield losses of ...

  10. Chemsearch Journal Volume 4 Number 1, June, 2013

    African Journals Online (AJOL)

    Magashi

    2013-06-01

    Jun 1, 2013 ... flame dried and cooled under vacuum before use. 1H and 13C NMR spectra were measured using. CDCl3 or DMSO as solvent unless otherwise stated, on a Brüker 250 or 400 MHz machine with an automated sample changer (unless otherwise stated). Chemical shifts for carbon and hydrogen are given ...

  11. Effects of nitrogen enrichment on heavy metals content of cattle ...

    African Journals Online (AJOL)

    The research was carried out at John Ker Nigeria Organo-Mineral Company site at Ikot Ekpene, Akwa Ibom State, Nigeria, to investigate the effect of nitrogen enrichment on contents of heavy metals in cattle dung/poultry manure compost and the growth of maize. Cattle dung was mixed with poultry manure in the ratio of 3:1 ...

  12. Restoran La Bottega = La Bottega Restaurant

    Index Scriptorium Estoniae

    2009-01-01

    Eesti Sisearhitektide Liidu 2008. aasta ajaloolise interjööri preemia pälvinud Tallinnas Vene t. 4 asuva restorani La Bottega sisekujundusest. Sisearhitektid Pille Lausmäe ja Kerli Lepp. Veiniriiulid ja puhvetkapid valmisid K. Lepa jooniste järgi. Sisearhitektide tähtsamate tööde loetelu

  13. Search for Breast Cancer Biomarkers in Fractionated Serum Samples by Protein Profiling With SELDI-TOF MS

    NARCIS (Netherlands)

    Opstal - van Winden, A.W.J.; Beijnen, J.H.; de Loof, A.; van Heerde, W.L.; Vermeulen, R.; Peeters, P.H.M.; van Gils, C.H.

    2012-01-01

    BackgroundMany high-abundant acute phase reactants have been previously detected as potential breast cancer biomar-kers. However, they are unlikely to be specific for breast cancer. Cancer-specific biomarkers are thought to be among the lower abundant proteins.MethodsWe aimed to detect lower

  14. LHV teenindusbüroo = LHV Service Bureau

    Index Scriptorium Estoniae

    2012-01-01

    LHV Panga teenindusbüroo (Tallinn, Tartu mnt. 2) sisekujundusest. Sisearhitektid Kerli Lepp ja Pille Lausmäe (Pille Lausmäe SAB), loetletud nende ühiselt tehtud töid. Arhitektid Andres Alver ja Tiit Trummal

  15. Sisearhitekt annab panuse : hea disaini mõõdupuuks ratsionaalsus ja omapära / Tea Taruste ; kommenteerinud Loreida Hein

    Index Scriptorium Estoniae

    Taruste, Tea

    2011-01-01

    Tomomi Hayashi, Ahti Grünbergi ja Kerli Valgu projekteeritud ADM Interactive'i bürooruumidest. Sisearhitekt Priit Põldme nõuandeid bürooruumide ümberkujundamiseks. Loreida Heina kommentaar "Bürood uuendades pole mõtet kogu mööblit välja vahetada"

  16. Sisearhitektuuri uudised / Aino Ingrid Sepp, Aale Kask

    Index Scriptorium Estoniae

    Sepp, Aino Ingrid

    2006-01-01

    Restoran Vertigo Tallinnas, sisekujundus Janno Roos ja Andres Labi; ööklubi Tartus Ülikooli tänava kaubanduskeskuse hoones, sisekujundus Riin Pettai ja Kerli Lepp; ilusalong Medemis Tallinnas, sisekujundus Maris Kerge; tantsustuudio Stiletto endises Marati tootmishoones Tallinnas, sisekujundus Anneli Ahi

  17. Tigutorn = The Snail Tower / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2010-01-01

    Tartus Väike-Turu 5 asuva Tigutorni arhitektuursest lahendusest. Maja alumisel korrusel on äriruumid, ülemistel korrustel korterid. Arhitektid Vilen Künnapu, Ain Padrik, kaasautorid Kristiina Hussar, Kerli Koolma (AB Künnapu & Padrik). Üldruumide kujundus: Heli Eensalu, Sulev Vahtra. Žürii liikme Kalle Komissarovi hinnang kultuurkapitali aastapreemiale esitatud hoonele

  18. Theory of computational complexity

    CERN Document Server

    Du, Ding-Zhu

    2011-01-01

    DING-ZHU DU, PhD, is a professor in the Department of Computer Science at the University of Minnesota. KER-I KO, PhD, is a professor in the Department of Computer Science at the State University of New York at Stony Brook.

  19. Nad ikka said selle Kärdla vana elektrijaama tööle / Bianca Mikovitš

    Index Scriptorium Estoniae

    Mikovitš, Bianca

    2009-01-01

    Siret Paju lavastusest "Ei teki ega kao" Kärdla elektrijaamas. Näidendi autorid Kerli Adov, Jaan Aps, Liis Lukk, Hiri Müüripeal, Siim Nurklik ja Kaur Riismaa. Projekti käivitas MTÜ Arhipelaag eesotsas Ere Naadiga

  20. Kätlin Kätlini kirev luulekogu

    Index Scriptorium Estoniae

    2008-01-01

    Tutvustus: Kätlin, Kätlin, pseud. Üks pole ühtegi = One is none / Kätlin Kätlin ; [tõlkijad Mika Keränen ja Marina Tervonen ; illustratsioonid: Hanneleele Kaldmaa. Tallinn : Positive Projects], 2008. Raamatu esitlus toimus 6. nov. Haus galeriis Tallinnas

  1. In Memoriam

    Index Scriptorium Estoniae

    2011-01-01

    Endel Nurm 5. märts 1939 – 26. august 2011. Toomas Ernits 26. aprill 1951 – 7. september 2011. Valdo Täker 12. august 1935 – 30. august 2011. Ants Arro 19. veebruar 1936 – 11. september 2011. Martin Talving 18. veebruar 1983 – 30. september 2011

  2. Keerukas universum : mitmes keeles, luule omas ka / Mariliin Vassenin

    Index Scriptorium Estoniae

    Vassenin, Mariliin

    2008-01-01

    Arvustus: Kätlin, Kätlin, pseud. Üks pole ühtegi = One is none / Kätlin Kätlin ; [tõlkijad Mika Keränen ja Marina Tervonen ; illustratsioonid: Hanneleele Kaldmaa. Tallinn : Positive Projects], 2008

  3. Maakonda esindavad lõbusad klounid / Anne Põder

    Index Scriptorium Estoniae

    Põder, Anne, 1973-

    2007-01-01

    Tantsufestivali "Koolitans 2007" lõppkontserdile valisid hindajad Järvamaad esindama spordiklubi Maribel rühma Alice, kes esitab kava "Lõbusad klounid". Rühma treener ja kava kokkupanija on Kerli Graubner. Lisatud žüriiliikme Kristin Pukka kommentaar

  4. 76 FR 14068 - Notice of Inventory Completion: U.S. Department of Agriculture, Forest Service, Sequoia National...

    Science.gov (United States)

    2011-03-15

    ..., University of California at Berkeley, Berkeley, CA, for research and storage. While conducting NAGPRA... ethnographic study. Ethnographic data places the CA-KER-14 site close to the village hamlets of the Tubatulabal... in Yokut territory) compose the Tubatulabal (Smith 1978). Burial customs based on ethnographic data...

  5. Corrosion Inhibition of Aluminium by Capparis deciduas in Acidic Media

    Directory of Open Access Journals (Sweden)

    P. Arora

    2007-01-01

    Full Text Available The inhibition efficiency of ethanolic extract of different parts of Capparis deciduas (Ker in acidic medium has been evaluated by mass loss and thermometric methods. Values of inhibition efficiency obtained from the two methods are in good agreement and are dependent upon the concentration of inhibitor and acid.

  6. Corrosion Inhibition of Aluminium by Capparis deciduas in Acidic Media

    OpenAIRE

    P. Arora; S. Kumar; M. K. Sharma; S. P. Mathur

    2007-01-01

    The inhibition efficiency of ethanolic extract of different parts of Capparis deciduas (Ker) in acidic medium has been evaluated by mass loss and thermometric methods. Values of inhibition efficiency obtained from the two methods are in good agreement and are dependent upon the concentration of inhibitor and acid.

  7. "Siin me oleme!" = "Here we are!" / Hannes Praks

    Index Scriptorium Estoniae

    Praks, Hannes, 1973-

    2013-01-01

    Maarjamäe lossis avatud näituse "Siin me oleme! Eesti filmi esimene sajand" kujundusest. Autorid: Hannes Praks, Toomas Pääsuke, Helen Sarapuu. Graafiline disain: Stella Skulatšjova, Kerli Virk. Sisearhitekti ja ESLi aastapreemia žürii liikme Tea Tammelaane arvamus

  8. Hanford Laboratories Operation monthly activities report, January 1960

    Energy Technology Data Exchange (ETDEWEB)

    1960-02-15

    R and D is reported in the following: Reactor and Fuels (PRTR, Pu fabrication pilot plant, KER, NPR, materials); Chemical R and D (Pm recovery, fission products, Purex column, non-production fuels reprocessing, Salt Cycle process); Physics and Instrument R and D (PCTR, NPR, critical experiments, PRTR); and Biology (monitoring, irradiation experiments).

  9. Kino Kosmos Imax restaureerimine = Restoration of the Kino Kosmos as an Imax cinema / Pille Lausmäe

    Index Scriptorium Estoniae

    Lausmäe, Pille, 1958-

    2015-01-01

    Kino Kosmos Imax Tallinnas Pärnu mnt 45, hoone valminud 1964, restaureeritud 2014. Hoone arhitekt Ilmar Laasi, restaureerimisprojekt Urmas Lõokese Arhitektibüroo, sisearhitektid Kerli Lepp, Pille Lausmäe (Pille Lausmäe Sisearhitektuuribüroo). 2014. aasta Kultuurkapitali Arhitektuuripreemia kandidaat

  10. Kino Kosmos Imax = Kosmos Imax cinema / Pille Lausmäe ; kommenteerinud Karen Jagodin

    Index Scriptorium Estoniae

    Lausmäe, Pille, 1958-

    2015-01-01

    Kino Kosmos Imax Tallinnas Pärnu mnt 45. 1964. aastal valminud hoone arhitekt Ilmar Laasi. Renoveeritud interjööri autorid Pille Lausmäe, Kerli Lepp (Pille Lausmäe Sisearhitektuuri büroo). Projekti autorid Urmas Lõoke, Riina Poopuu (Urmas Lõokese Arhitektibüroo)

  11. Fagreferentkonferansen 2012 i Kristiansand

    Directory of Open Access Journals (Sweden)

    Therese S. Skagen

    2012-09-01

    Full Text Available Universitetet i Agder arrangerte Fagreferentkonferansen 2012 som hadde et innholdsrikt og interessant program. Ulike aspekter ved bibliotekets tjenester ble belyst, fra undervisning av studenter og styrking av informasjonskompetanse, til tjeneste for forskere og forskningsmiljøer og samlingsutvikling med brukerstyrte innkjøp av e-bøker.

  12. Viljandi Riigigümnaasium = Viljandi Upper Secondary School

    Index Scriptorium Estoniae

    2015-01-01

    Viljandi Riigigümnaasiumi uus hoone Hariduse tänav 2, valminud 2013. Arhitektuuri sihtkapitali arhitektuuripreemia 2013 ja Arhitektuuri sihtkapitali renoveerimispreemia 2013. Arhitektid Maarja Kask, Karli Luik, Ralf Lõoke, Andro Mänd, Margus Tamm (Salto Arhitektid), Eva Laarmann. Sisearhitektid Pille Lausmäe, Kristina Roots, Kerli Lepp. Muinsuskaitse eritingimused Mart Siilivask

  13. Soomes ilmusid eesti raamatud

    Index Scriptorium Estoniae

    2004-01-01

    Mehis Heinsaare "Härra Pauli kroonikad" ("Herra Paulin aikakirja"), tõlkinud Mika Keränen ; "Tallinnasta pois", eesti groteskse novelli antoloogia, autorid Olavi Ruitlane, Jüri Ehlvest, Aapo Ilves, Andrus Kivirähk, Kerttu Rakke, Peeter Sauter, Mehis Heinsaar, Matt Barker, Eeva Park, Kaur Kender, Veiko Märka, Urmas Vadi ja Ervin Õunapuu

  14. Phytochemical constituents and antioxidant activities of aqueous ...

    African Journals Online (AJOL)

    USER

    2010-08-02

    Aug 2, 2010 ... of aqueous and methanol stem extracts of Costus afer. Ker Gawl. ... 150 g of pulverized dried sample was soaked in 600 ml distilled water and ... 0.5 g of the extract was dissolved in 2 ml glacial acetic acid containing 1 drop of ...

  15. Ensretting, segmentering og unnvikende strategier

    DEFF Research Database (Denmark)

    Steinholt, Yngvar B.; Wickström, David-Emil

    2008-01-01

    Gjennom eksempler fra russisk populærmusikk, film og media, undersøker denne artikkelen sentrale aspekter ved populærkulturelle identiteter i dagens Russland. I hvilken grad inviterer det populærkulturelle feltet til deltagelse og identifikasjonsprosesser? Vore funn tyder på at det ideologiske...

  16. Bits and Pieces ehk kolumna. White Label : Bombillaz - Pumm. Kuula / DJ Pickney Tiger

    Index Scriptorium Estoniae

    DJ Pickney Tiger, pseud., 1970-

    2008-01-01

    Popmuusikauudised. Laulust. Heliplaatidest: Kris Kristofferson "This Old Road", Rulers of the Deep (M. Meri, P. Julm) "Ready To Go Overground", Ry Cooder "I, Flathead. The Songs of Kash Buk and the Klowns", Svjata Vatra "Kalyna", The Streets "Everything Is Borroved", The Offspring "Rise and Fall, Race and Grace", Kerli Kõiv "Love Is Dead", "Mamma Mia! The Movie Soundtrack"

  17. [Kätlin Kätlin. Üks pole ühtegi = One is none] / Katrin Väli

    Index Scriptorium Estoniae

    Väli, Katrin, 1956-

    2008-01-01

    Tutvustus: Kätlin, Kätlin, pseud. Üks pole ühtegi = One is none / Kätlin Kätlin ; [tõlkijad Mika Keränen ja Marina Tervonen ; illustratsioonid: Hanneleele Kaldmaa. Tallinn : Positive Projects], 2008

  18. Piduöö 5 nägu / Monica Raud

    Index Scriptorium Estoniae

    Raud, Monica, 1981-

    2007-01-01

    Viie ööklubi interjöörist. Tallinnas Club von Überblingen endises Polümeeri hoones, sisearhitekt Taavi Aunre; Club Prive, sisearhitekt Priit Roosna; Tartus Maasikas, sisekujundajad Riin Pettai ja Kerli Lepp; Club Illusion, sisekujundaja Jaanis Ilves; Pärnus klubi Str&, sisekujundajad Hannes Praks, Kristjan Holm ja Kadri Tamme

  19. Dobbeltbosætning/sekundære boliger

    DEFF Research Database (Denmark)

    Kjeldsen, Chris; Kromann, Dorthe Salling; Nielsen, Niels Christian

    hjælp af GIS programmerne ArcGIS og Mapinfo. Resultaterne af denne del er, at dobbeltbosætning potentielt omfatter omkring 10 % af den samlede boligmasse i Vejen kommune og omkring 29 % for Langelands vedkommende. Hvis man ser på landzonen isoleret og udtræk-ker de ejendomme, der har de relevante...

  20. [Handbuch des personalen Gelegenheitsschrifttums in europäischen Bibliotheken und Archiven] / Jürgen Beyer

    Index Scriptorium Estoniae

    Beyer, Jürgen, 1965-

    2007-01-01

    Arvustus: Handbuch des personalen Gelegenheitsschrifttums in europäischen Bibliotheken und Archiven. Bd. 7., Reval - Tallinn. Estnische Akademische Bibliothek - Eesti Akadeemiline Raamatukogu ; Estnisches Historisches Museum - Eesti Ajaloomuuseum ; Estnische Nationalbibliothek - Eesti Rahvusraamatukogu ; Revaler Stadtarchiv - Tallinna Linnaarhiiv / mit einer bibliotheksgeschichtlichen Einleitung und einer kommentierten Bibliographie von Martin Klöker ; herausgegeben von Sabine Beckmann... [et al.]. - Hildesheim [etc.], 2003 ; Handbuch des personalen Gelegenheitsschrifttums in europäischen Bibliotheken und Archiven. Bd. 8., Dorpat - Tartu. Universitätsbibliothek - Ülikooli Raamatukogu ; Estnisches Literaturmuseum - Eesti Kirjandusmuuseum ; Estnisches Historisches Archiv - Eesti Ajalooarhiiv / mit einer bibliotheksgeschichtlichen Einleitung und einer kommentierten Bibliographie von Martin Klöker ; herausgegeben von Klaus Garber, Sabine Beckmann... [et al.]. - Hildesheim [etc.], 2003 ; Handbuch des personalen Gelegenheitsschrifttums in europäischen Bibliotheken und Archiven. Bd. 12-15, Riga: Akademische Bibliothek Lettlands. Historisches Staatsarchiv Lettlands. Spezialbibliothek des Archivwesens. Nationalbibliothek Lettlands. Baltische Zentrale Bibliothek. T. 1-4 / mit einer bibliotheksgeschichtlichen Einleitung und einer kommentierten Bibliographie von Martin Klöker ; herausgegeben von Sabine Beckmann und Martin Klöker unter Mitarbeit von Stefan Anders. - Hildesheim [etc.], 2004

  1. Sphingomonas frigidaeris sp. nov., isolated from an air conditioning system.

    Science.gov (United States)

    Lee, Yunho; Jeon, Che Ok

    2017-10-01

    A strictly aerobic Gram-stain-negative bacterium, designated strain KER25-10 T , was isolated from a laboratory air conditioning system in South Korea. Cells were yellow-pigmented, non-motile rods showing catalase- and oxidase-positive reactions. The strain grew at pH 4.0-9.0 (optimum, pH 6.0-7.0) and 10-40 °C (optimum, 30 °C) and in the presence of 0-3 % (w/v) NaCl (optimum, 0 %). The G+C content of the genomic DNA was 65.1 mol%. Strain KER25-10 T contained ubiquinone-10 (Q-10) as the predominant isoprenoid quinone and C16 : 0, C17 : 1ω6c, summed feature 3 (comprising C16 : 1ω7c and/or C16 : 1ω6c) and summed feature 8 (comprising C18 : 1ω7c and/or C18 : 1ω6c) as the major fatty acids. The major polar lipids were sphingoglycolipid, diphosphatidylglycerol, phosphatidylglycerol, phosphatidylethanolamine and phosphatidylcholine. Only spermidine was detected as the polyamine. Phylogenetic analysis based on 16S rRNA sequences indicated that strain KER25-10 T formed a distinct phylogenetic lineage within the genus Sphingomonas of the family Sphingomonadaceae and the strain was most closely related to Sphingomonas kyeonggiense THG-DT81 T with a 96.8 % 16S rRNA gene sequence similarity. On the basis of phenotypic, chemotaxonomic and molecular features, strain KER25-10 T clearly represents a novel species of the genus Sphingomonas, for which the name Sphingomonas frigidaeris sp. nov. is proposed. The type strain is KER25-10 T (=KACC 19285 T =JCM 32053 T ).

  2. Word Frequency Analysis. MOS: 05B. Skill Levels 1 & 2.

    Science.gov (United States)

    1981-05-01

    UJMIII 1 r1 I1 P 11 rtiall 11 t _7r rI rs r1 ivr A’s1I I i -?Lq/rp-na I %flfTf’a 11 ( Pi*Ir 11 r 1% it ;Nc14 It Pt F’tAP𔃻 I[ T(P’tfPE(t I if Porn ...CCNTROL ?5 ST AI ION 21 FIRM 73 LInCA TI ON ?2 CIENERATnp 7t f!CS 70 Al, m 7 0 GRnUP _NT-wiAY 7𔄁 NtT ( 20 SITE 20 SUPPORT 14 AT 14 P le OPERATOR#S 19

  3. Kahe keelekasutusvariandi võrdlus: morfoloogilised klassid ja klastrid

    Directory of Open Access Journals (Sweden)

    Pille Eslon

    2013-10-01

    Full Text Available Kasutuspõhise keelekirjelduse väärtus grammatika jaoks seisneb võimaluses avada keelesüsteemi funktsionaalne potentsiaal, kirjeldades näiteks keelestruktuuride hierarhiat, võrreldes keelekasutusvariantide morfosüntaktilisi mustreid, keelesüsteemist ja keelekasutaja valikutest tulenevaid semantilisi ja grammatilisi kitsendusi, keelekasutuse leksikaalse ja grammatilise varieeruvuse piire. Nende esiletoomine vajab meetodeid, mis annaksid võimalikult usaldusväärseid tulemusi. Siinses uurimuses on kasutatud klasteranalüüsi. Võrreldud on eesti ilukirjandus- ja õppijakeele tekstide verbist vasakule jääva konteksti keelekasutust. Leitud on kõik kolmest üksusest koosnevad konstruktsioonid, rühmitatud need morfosüntaktilise samalaadsuse ja sageduse alusel ning kirjeldatud morfoloogiliste klastrite ja klasside hierarhiana. Klassid näitavad keelekasutuse üldiseid morfoloogilisi mustreid, klastrite alusel saab kirjeldada klasside morfoloogilise varieeruvuse piire. Konkreetsed konstruktsioonid toovad esile piiranguid klastrite leksikaalgrammatilisele varieeruvusele. Eesti ilukirjandustekstide ja keeleõppija loomingulist laadi esseede võrdlusest peaks selguma, kuidas kasutavad keelesüsteemi funktsionaalset potentsiaali emakeelekõneleja ja õppija. Analüüsi tulemused näitavad, et emakeelekõnelejad teevad optimaalseid valikuid, mis hõlmavad nii morfosüntaktilist lihtsust kui ka keerukust, nii sõnavara rikkust kui ka kinnistunud korduvkasutust. Selles osas on õppija keelekasutus nihkes, emakeelekõneleja keeletunnetuse põhjal kuidagi ebaharilik. Samas ei tähenda see, et tegu oleks vigadega. Ühelt poolt näitavad õppija kasutatud keelestruktuurid ilukirjanduskeelest avaramat varieeruvust. Teisalt tuleb selgelt esile stereotüüpsetele keelestruktuuridele tuginev lihtsustamine, morfoloogiliste klasside ja klastrite üle- ning alakasutus, sõnavara kesisus.

  4. Ship-borne measurements of microbial enzymatic activity: A rapid biochemical indicator for microbial water quality monitoring

    Science.gov (United States)

    Stadler, Philipp; Loken, Luke; Crawford, John; Schramm, Paul; Sorsa, Kirsti; Kuhn, Catherine; Savio, Domenico; Striegl, Rob; Butman, David; Stanley, Emily; Farnleitner, Andreas H.; Zessner, Matthias

    2017-04-01

    Contamination of aquatic ecosystems by human and animal wastes is a global concern for water quality. Disclosing fate and transport processes of fecal indicator organism (FIO) in large water bodies is a big challenge due to material intensive and time consuming methods used in microbiological water quality monitoring. In respect of utilization of large surface water resources there is a dearth of rapid microbiological methods that allow a near-real time health related water quality monitoring to be implemented into early warning systems. The detection of enzymatic activities has been proposed as a rapid surrogate for microbiological pollution monitoring of water and water resources (Cabral, 2010; Farnleitner et al., 2001, 2002). Methods such as the beta-D-Glucuronidase assay (GLUC), targeting FIO such as E. coli, were established. New automated enzymatic assays have been implemented during the last years into on-site monitoring stations, ranging from ground- to surface waters (Ryzinska-Paier et al., 2014; Stadler et al., 2017, 2016). While these automated enzymatic methods cannot completely replace assays for culture-based FIO enumeration, they yielded significant information on pollution events and temporal dynamics on a catchment specific basis, but were restricted to stationary measurements. For the first time we conducted ship-borne and automated measurements of enzymatic GLUC activity on large fresh water bodies, including the Columbia River, the Mississippi River and Lake Mendota. Not only are automated enzymatic assays technically feasible from a mobile vessel, but also can be used to localize point sources of potential microbial fecal contamination, such as tributaries or storm drainages. Spatial and temporal patterns of enzymatic activity were disclosed and the habitat specific correlation with microbiological standard assays for FIO determined due to reference samples. The integration of rapid and automated enzymatic assays into well-established systems

  5. Single-photon Coulomb explosion of methanol using broad bandwidth ultrafast EUV pulses.

    Science.gov (United States)

    Luzon, Itamar; Jagtap, Krishna; Livshits, Ester; Lioubashevski, Oleg; Baer, Roi; Strasser, Daniel

    2017-05-31

    Single-photon Coulomb explosion of methanol is instigated using the broad bandwidth pulse achieved through high-order harmonics generation. Using 3D coincidence fragment imaging of one molecule at a time, the kinetic energy release (KER) and angular distributions of the products are measured in different Coulomb explosion (CE) channels. Two-body CE channels breaking either the C-O or the C-H bonds are described as well as a proton migration channel forming H 2 O + , which is shown to exhibit higher KER. The results are compared to intense-field Coulomb explosion measurements in the literature. The interpretation of broad bandwidth single-photon CE data is discussed and supported by ab initio calculations of the predominant C-O bond breaking CE channel. We discuss the importance of these findings for achieving time resolved imaging of ultrafast dynamics.

  6. Victor Davis Hansons, John Heath: Who killed Homer? The demise of classical education and the recovery of Greek wisdom (review

    Directory of Open Access Journals (Sweden)

    David Movrin

    2000-07-01

    Full Text Available Knjigo, o katerije govora, bi težko označili kot znanstveno. Ne zato, ker bi strokovnih kvalifikacij manjkalo kateremu od obeh avtorjev, saj je vsak od njiju habilitiran na svoji kalifornijski univerzi in to na oddelku, ki po ameriški kategorizaciji ustreza naši klasični filologiji. Ravno tu je kleč; ker sta oba avtorja po naravi in po stavi filologa, sta pri zgornjem naslovu po definiciji obsojena na pisanje de damo sua. In takoj na prvih straneh se pokaže, da je takšno pisanje vse kaj drugega kot pa neobremenjen in suh tekst, ki bi se ga avtorja lotila sine studio, kmalu potem pa postane jasno, da besedilo ni napisano niti sine ira. Ravno nasprotno; če že iščemo primerno vzporednico, je to kvečjemu Juvenal, ki mu facit indignatio versum.

  7. Dynamic modification of the fragmentation of COq+ excited states generated with high-order harmonics

    International Nuclear Information System (INIS)

    Cao, W.; De, S.; Singh, K. P.; Chen, S.; Laurent, G.; Ray, D.; Ben-Itzhak, I.; Cocke, C. L.; Schoeffler, M. S.; Belkacem, A.; Osipov, T.; Rescigno, T.; Alnaser, A. S.; Bocharova, I. A.; Zherebtsov, S.; Kling, M. F.; Litvinyuk, I. V.

    2010-01-01

    The dynamic process of fragmentation of CO q+ excited states is investigated using a pump-probe approach. EUV radiation (32-48 eV) generated by high-order harmonics was used to ionize and excite CO molecules and a time-delayed infrared (IR) pulse (800 nm) was used to influence the evolution of the dissociating multichannel wave packet. Two groups of states, separable experimentally by their kinetic-energy release (KER), are populated by the EUV and lead to C + -O + fragmentation: direct double ionization of the neutral molecule and fragmentation of the cation leading to C + -O*, followed by autoionization of O*. The IR pulse was found to modify the KER of the latter group in a delay-dependent way which is explained with a model calculation.

  8. Dissociation and ionization of molecular ions by ultra-short intense laser pulses probed by coincidence 3D momentum imaging

    International Nuclear Information System (INIS)

    Ben-Itzhak, Itzik; Wang, Pengqian; Xia, Jiangfan; Max Sayler, A.; Smith, Mark A.; Maseberg, J.W.; Carnes, Kevin D.; Esry, Brett D.

    2005-01-01

    We have experimentally explored laser-induced dissociation and ionization of diatomic molecular ions using coincidence 3D momentum imaging. The vibrationally excited molecular ion beam (4-8 keV) is crossed by an ultrafast intense laser beam (28-200 fs, 10 13 -10 14 W/cm 2 ). The resulting fragments are recorded in coincidence by a time and position-sensitive detector. Complete angular distributions and kinetic energy release maps are reconstructed from the measured dissociation-momentum vectors. The angular distribution of the H + + H fragments was found to be strongly correlated to their kinetic energy release upon dissociation. Low KER was associated with very narrow angular distributions and high KER with distributions peaking away from the laser polarization. Ionization was found to be smaller than dissociation and increased with laser intensity. The H + + H + fragments have a very narrow angular distribution along the laser polarization

  9. Effect of linear chirp on strong field photodissociation of H+2

    International Nuclear Information System (INIS)

    Prabhudesai, Vaibhav; Natan, Adi; Bruner, Barry; Silberberg, Yaron; Lev, Uri; Heber, Oded; Strasser, Daniel; Schwalm, Dirk; Zajfman, Daniel; Ben-Itzhak, Itzik

    2011-01-01

    We report the experimental findings of a systematic study of the effect of linear chirp on strong field photodissociation of H + 2 . For vibrational levels around or above the one photon crossing, the effect manifests itself in terms of a shift in the kinetic energy release (KER) peaks. The peaks shift up for negative chirp whereas they shift down for positive chirp. The measurements are carried out by varying two of the three laser pulse characteristics, energy, pulse peak intensity and linear chirp, while keeping the third constant. The shifts in the KER peaks are found to be intensity dependent for a given value of chirp. However, in the last two cases (i.e., fixed pulsed energy and fixed pulse peak intensity), they are found to be independent of the chirp magnitude. The results are understood on the basis of saturation of photodissociation probabilities for these levels.

  10. Effect of linear chirp on strong field photodissociation of H{sup +}{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Prabhudesai, Vaibhav; Natan, Adi; Bruner, Barry; Silberberg, Yaron; Lev, Uri; Heber, Oded; Strasser, Daniel; Schwalm, Dirk; Zajfman, Daniel [Weizmann Institute of Science, 76100 (Israel); Ben-Itzhak, Itzik [Kansas State University, Kansas (United States)

    2011-10-15

    We report the experimental findings of a systematic study of the effect of linear chirp on strong field photodissociation of H{sup +}{sub 2}. For vibrational levels around or above the one photon crossing, the effect manifests itself in terms of a shift in the kinetic energy release (KER) peaks. The peaks shift up for negative chirp whereas they shift down for positive chirp. The measurements are carried out by varying two of the three laser pulse characteristics, energy, pulse peak intensity and linear chirp, while keeping the third constant. The shifts in the KER peaks are found to be intensity dependent for a given value of chirp. However, in the last two cases (i.e., fixed pulsed energy and fixed pulse peak intensity), they are found to be independent of the chirp magnitude. The results are understood on the basis of saturation of photodissociation probabilities for these levels.

  11. Laget före jaget? : En kvalitativ studie om hur svenska sportorganisationer kommunicerar under en spelares individuella kris

    OpenAIRE

    Bjerkland, Albin; Edman, Benjamin

    2018-01-01

    Idrottsskandaler blir ofta uppmärksammade i nyhetsmedier och aktörerna i krisen behöver därför uttala sig offentligt. Denna studie undersöker hur svenska sportorganisationer, Malmö FF, IF Björklöven, Gefle IF och Pixbo Wallenstam, hanterar en kris som uppstått från ett individuellt övertramp. Mer specifikt försöker studien att ta reda på hur och till vilken grad laget skyddar sin organisation, respektive den anklagade spelaren i den externa kommunikationen. För att kunna svara på de frågestäl...

  12. Describing terminologies and discussing records: More discoveries of facultative vivipary in the genus Hedychium J.Koenig (Zingiberaceae) from Northeast India.

    Science.gov (United States)

    Ashokan, Ajith; Gowda, Vinita

    2018-01-01

    The authors introduce the term facultative vivipary for the first time in gingers and elaborate on this reproductive strategy. Four new observations of facultative vivipary are reported in the genus Hedychium which were discovered during botanical explorations by the authors in Northeast India (NE India) over the past three years. The viviparous taxa are H. marginatum C.B.Clarke, H. speciosum var. gardnerianum (Ker Gawl.) Sanoj & M.Sabu (previously, H. gardnerianum Sheppard ex Ker Gawl.), H. thyrsiforme Buch.-Ham. ex Sm. and H. urophyllum G.Lodd. The authors also attempt to summarise the occurrence of vivipary in the family Zingiberaceae from published reports and to clarify a taxonomic misidentification in a previously known report of vivipary in Hedychium elatum .

  13. Describing terminologies and discussing records: More discoveries of facultative vivipary in the genus Hedychium J.Koenig (Zingiberaceae from Northeast India

    Directory of Open Access Journals (Sweden)

    Ajith Ashokan

    2018-03-01

    Full Text Available The authors introduce the term facultative vivipary for the first time in gingers and elaborate on this reproductive strategy. Four new observations of facultative vivipary are reported in the genus Hedychium which were discovered during botanical explorations by the authors in Northeast India (NE India over the past three years. The viviparous taxa are H. marginatum C.B.Clarke, H. speciosum var. gardnerianum (Ker Gawl. Sanoj & M.Sabu (previously, H. gardnerianum Sheppard ex Ker Gawl., H. thyrsiforme Buch.-Ham. ex Sm. and H. urophyllum G.Lodd. The authors also attempt to summarise the occurrence of vivipary in the family Zingiberaceae from published reports and to clarify a taxonomic misidentification in a previously known report of vivipary in Hedychium elatum.

  14. Logiikkaohjelmien kirjaston luominen STEP 7 -ympäristöön

    OpenAIRE

    Perälä, Toni

    2013-01-01

    Tämän opinnäytetyön toimeksiantajana toimi PLC-Automation Oy. Työn tavoitteena oli luoda yrityksen yhteiseen käyttöön logiikkaohjelmien kirjasto STEP 7 -ympäristöön. Työhön kuului myös käyttöohjeiden kirjoittaminen kerätyille ohjelmille. Päämääränä oli luoda yrityksen käyttöön mahdollisimman kattava logiikkaohjelmien kirjasto. Kirjaston materiaali kerättiin yrityksessä STEP 7:n parissa työskenteleviltä työntekijöiltä sekä itsenäisesti yrityksen projekteista. Kirjaston sisältö rakennettiin yr...

  15. ZADOVOLJSTVO GOSTOV S POMURSKIMI GOSTILNAMI

    OpenAIRE

    Stanko, Renata

    2011-01-01

    Ljudje smo različni. Različno vrednotimo in ocenjujemo iste stvari. Imamo različne okuse, različne zahteve, obenem pa imamo svoja pričakovanja. Od gostincev in pri njih zaposlenih pričakujemo, da bodo poznali naše zahteve in pričakovanja ter jih brezhibno zadovoljili. Še posebej, ker so nas k njim napotili naši prijatelji oz. družina, ki so bili zelo zadovoljni ali zato, ker je od naše prisotnosti v gostilni odvisen naš družbeni položaj. Prenos informacij med prijatelji in družinskim...

  16. High-throughput microarray mapping of cell wall polymers in roots and tubers during the viscosity-reducing process

    DEFF Research Database (Denmark)

    Huang, Yuhong; Willats, William George Tycho; Lange, Lene

    2016-01-01

    the viscosity-reducing process are poorly characterized. Comprehensive microarray polymer profiling, which is a high-throughput microarray, was used for the first time to map changes in the cell wall polymers of sweet potato (Ipomoea batatas), cassava (Manihot esculenta), and Canna edulis Ker. over the entire...... viscosity-reducing process. The results indicated that the composition of cell wall polymers among these three roots and tubers was markedly different. The gel-like matrix and glycoprotein network in the C. edulis Ker. cell wall caused difficulty in viscosity reduction. The obvious viscosity reduction......Viscosity reduction has a great impact on the efficiency of ethanol production when using roots and tubers as feedstock. Plant cell wall-degrading enzymes have been successfully applied to overcome the challenges posed by high viscosity. However, the changes in cell wall polymers during...

  17. ECOCURE BLUE – NEW COLD BOX SYSTEM WITH ULTRA-HIGH EFFICIENCY AND AS LOW AS POSSIBLE EMISSIONS

    Directory of Open Access Journals (Sweden)

    P. N. Vacelet

    2018-01-01

    Full Text Available By omitting materials subject to the labeling requirement in part 1 cold-box resin, Düker GmbH from Laufach can achieve an impressive reduction in emissions.Emission and workplace exposure limit values represent major challenges for foundries, and are becoming increasingly important due to every stricter statutory regulations. In particular, compliance with emission guidelines is essential in safeguarding company sites, and is now of equal significance as technical and economic issues. Modern foundries such as Düker GmbH from Laufachpursue a sustainable corporate policy in which the three pillars of cost-effectiveness, social responsibility and environmental protection are accorded equal importance. Düker’s example shows how the use of the new ECOCURE BLUE technology supports environmental protection and occupational health and safety, while also facilitating efficient, highly productive core production. 

  18. Algevekstpotensialmålinger i Frognerbekken og Hoffselva mars 1985

    OpenAIRE

    Källqvist, T.

    1985-01-01

    Algevekstpotensialet i vannprøver fra forskjellige stasjoner i vassdragene ble undersøkt med og uten tilsetning av vekstmedium. Vekstpotensialet var lavt i den øvre delen av vassdragene, men øker i byområdet som følge av tilførsel av plantenæringsstoffer. Klar hemming av algeveksten ble påvist i Skådalsbekken øverst i Hoffselvvassdraget. Oslo kommune

  19. Short outlines of books by Estonian authors : [annotations] / Rutt Hinrikus, Janika Kronberg

    Index Scriptorium Estoniae

    Hinrikus, Rutt, 1946-

    1999-01-01

    Madis Kõiv. Kähri ker'ko man Pekril; Hannes Varblane. Avalikult halb : valik; Andrus Kivirähk. Liblikas; Juhan Paju. Vanaema mõis; Henn Mikelsaar. Ristiratast; Asta Põldmäe. Viini plika; Ellen Niit. Paekivi laul; Toomas Raudam. Elus enesetapja; Andrus Kivirähk. Pagari piparkook; Oskar Kruus. Hella Wuolijoki; Hasso Krull. Jazz : nelikümmend luuletust; Mart Kivastik. Varblane; Jüri Ehlvest. Elli lend

  20. Maahanmuuttajanaisten kokemuksia kotoutumisesta ja näkökulmia Vaasassa tehtävään kotouttamistyöhön

    OpenAIRE

    Ratinen, Marianne; Puska, Heidi

    2015-01-01

    Tutkimuksen tavoitteena oli kartoittaa maahanmuuttajanaisten kokemuksia kotoutumisesta ja näkökulmia Vaasassa tehtävään kotouttamistyöhön. Tutkimuksessa haluttiin selvittää, millaisia haasteita maahanmuuttajanainen kohtaa kotoutuessaan Suomeen. Tämän lisäksi haluttiin kerätä asiakaspalautetta monikulttuuriseen kohtaamispaikka Helmeen. Tutkimuksen kautta nostettiin esille vaasalaisten maahanmuuttajanaisten asema suomalaisessa yhteiskunnassa. Tutkimuksen teoreettinen viitekehys koostuu maaha...

  1. Final Evaluation of MIPS M/500

    Science.gov (United States)

    1987-11-01

    recognizing common subexpressions by changing the code to read: acke (n,m) If (, - 0) return *+I; return a ker(n-1, 0 ? 1 aaker (n,.-1)); I the total code...INSTITUTE JPO PTTTSBURCH. PA 15213 N/A N/A N/O 11 TITLE (Inciude Security Class.iication) Final Evaluation of MIPS M/500 12. PERSONAL AUTHOR(S) Daniel V

  2. Tehokkuutta B&B Purola Farmin digitaaliseen markkinointiviestintään

    OpenAIRE

    Luoma-aho, Lilli

    2016-01-01

    Opinnäytetyön tarkoituksena oli selvittää, miten B&B Purola Farmin markkinointia saadaan tehostettua ja kohdennettua digitaalisen markkinointiviestinnän keinoin, yleisesti ja keskittyen hollantilaisiin, sveitsiläisiin ja luxemburgilaisiin matkailijoihin. Tavoitteena oli syventää ymmärrystä siitä, miten digitaalista markkinointiviestintää tulee toteuttaa toivottujen kohderyhmien tavoittamiseksi. Opinnäytetyöhön tietoa kerättiin aiheesta kertovasta kirjallisuudesta ja asiantuntijablogeista. ...

  3. Kahdeksasluokkalaisten kokemukset omasta puhelimen käytöstään

    OpenAIRE

    Nygård, Jessica

    2016-01-01

    Tutkimuksen tarkoituksena oli selvittää kahdeksasluokkalaisten kokemuksia omasta puhelimen käytöstään ja tutkia, kokivatko he puhelinriippuvuutta. Tavoitteena oli saada ajankohtaista tietoa nuorten mielipiteistä. Tutkimus suoritettiin kvalitatiivisena eli laadullisena tutkimuksena. Tutkimusaineisto kerättiin vaasalaisen yläasteen kahdeksasluokkalaisilta nuorilta toukokuussa 2016, ja kyselyyn osallistui kymmenen nuorta. Tutkimuksen aineistonkeruumenetelmänä käytettiin kyselytutkimusta. Tut...

  4. ANALYSE AV SAMVARIASJON MELLOM MÅLT ARBEIDSBELASTNING (NAS) OG DEN SUBJEKTIVE OPPLEVELSEN AV ARBEIDSBELASTNINGEN (NASA-TLX) VED INTENSIVAVDELINGER

    OpenAIRE

    Graarud, Vibeke

    2015-01-01

    SAMMENDRAG Sykehus generelt og intensivavdelinger spesielt er under økende press for å kunne drive god og riktig ressursforvaltning. Dermed øker også behov for å kunne dokumentere intensiv-avdelingenes aktivitet og ressursbehov. Nursing Activities Score (NAS) blir ved flere av landets intensivavdelinger brukt som scoringsverktøy for arbeidsbelastning. Det er et verktøy som har til hensikt å kartlegge behovet for antall sykepleiere per pasient. Det er i Norge flere sykepleiere per intensivpasi...

  5. Büroo ADM Interactive = Office ADM Interactive

    Index Scriptorium Estoniae

    2011-01-01

    Eesti Sisearhitektide Liidu 2010. a. ühiskondliku interjööri preemia pälvinud ADM Interactive'i büroost Tallinnas Rotermanni 8. Sisekujunduse autorid: arhitekt Tomomi Hayashi (HG Arhitektuur), sisearhitektid Ahti Grünberg (CadStudio OÜ) ja Kerli Valk (Kukuhaus OÜ), loetletud nende töid. Laelambid valmisid sisekujundajate jooniste järgi Hansanovas

  6. Add Audio and Video to Your Site

    CERN Document Server

    MacDonald, Matthew

    2010-01-01

    Nothing spices up websites like cool sound effects (think ker-thunk as visitors press a button) or embedded videos. Think you need a programmer to add sizzle to your site? Think again. This hands-on guide gives you the techniques you need to add video, music, animated GIFs, and sound effects to your site. This Mini Missing Manual is excerpted from Creating a Web Site: The Missing Manual.

  7. Genomic Analysis of Caldithrix abyssi, the Thermophilic Anaerobic Bacterium of the Novel Bacterial Phylum Calditrichaeota

    OpenAIRE

    Kublanov, Ilya V.; Sigalova, Olga M.; Gavrilov, Sergey N.; Lebedinsky, Alexander V.; Rinke, Christian; Kovaleva, Olga; Chernyh, Nikolai A.; Ivanova, Natalia; Daum, Chris; Reddy, T.B.K.; Klenk, Hans-Peter; Spring, Stefan; G?ker, Markus; Reva, Oleg N.; Miroshnichenko, Margarita L.

    2017-01-01

    © 2017 Kublanov, Sigalova, Gavrilov, Lebedinsky, Rinke, Kovaleva, Chernyh, Ivanova, Daum, Reddy, Klenk, Spring, Göker, Reva, Miroshnichenko, Kyrpides, Woyke, Gelfand, Bonch-Osmolovskaya. The genome of Caldithrix abyssi, the first cultivated representative of a phylum-level bacterial lineage, was sequenced within the framework of Genomic Encyclopedia of Bacteria and Archaea (GEBA) project. The genomic analysis revealed mechanisms allowing this anaerobic bacterium to ferment peptides or to impl...

  8. Better Steganalysis (BEST) - Reduction of Interfering Influence of Image Content on Steganalysis

    Science.gov (United States)

    2009-10-08

    LSB embedding, let us consider greyscale images with pixel values in the range 0. . . 255 as carrier medium. LSB steganography replaces the least...Detecting LSB steganography in color and grayscale images . IEEE Multimedia, 8(4):22–28, 2001. [9] Jessica Fridrich, Miroslav Goljan, and Dorin Hogea...January, 19–22 2004. [13] Andrew D. Ker. Improved detection of LSB steganography in grayscale images . In Jessica Fridrich, editor, Information Hiding

  9. A Data Formatter for the ATLAS Fast Tracker

    CERN Document Server

    Olsen, J; The ATLAS collaboration; Liu, Ted; Okumura, Y; Penning, B

    2012-01-01

    The Fast TracKer (FTK) is an upgrade to the ATLAS level-2 trigger. The FTK system will reconstruct tracks using data from the inner Pixel and SCT silicon detector modules at trigger rates up to 100 kHz. We present an overview of the Data Formatter system, which is designed to remap, share and reformat the Pixel and SCT module data to match the geometry of the FTK trigger towers.

  10. Nomenclature Changes for Some Dicots of Taiwan

    Directory of Open Access Journals (Sweden)

    Yuen-Po Yang

    2002-06-01

    Full Text Available In the preparation of the Manual of Taiwan Vascular Plants, name changes for 7 dicots are needed. Four new names are given: Melastoma scaberrima (Hayata Yuen-Po Yang & Ho-Yih Liu, Medinilla taiwaniana Yuen-Po Yang & Ho-Yih Liu, Rhaphiolepis indica (L. Lindley ex Ker var. shilanensis Yuen-Po Yang & Ho-Yih Liu, and Helwingia japonica (Thunb. Dietr. ssp. taiwaniana Yuen-Po Yang & Ho-Yih Liu.

  11. Détermination structurale de triterpenoïdes isolés des feuilles de ...

    African Journals Online (AJOL)

    un appareil de 600 MHz, sonde TCI Avance. III, marque Brüker. Les spectres de masse mode ionisation .... 14. 27. 15. 16. 17. 28. 22. 21. 19. 20. 29. 30. 6. 7. 8. 26. 13. 18. Figure 1: Structure du bétulinol 1, du bétulonal 2, de l'acide bétulonique 3 et de la cabraleone 4. Tableau 1 : Résultats de la chromatographie sur gel de ...

  12. Etikk i anvendt idrettspsykologi: en kvalitativ studie av idrettspsykologiske rådgiveres etiske utfordringer i anvendt idrettspsykologi, og håndtering av disse

    OpenAIRE

    Ulltang, Espen

    2015-01-01

    Masteroppgave - Norges idrettshøgskole, 2015 Idrettspsykologi er et fag som arbeider for å utvikle mentale ferdigheter hos utøvere og trenere. De som arbeider med anvendt idrettspsykologi møter en rekke etiske utfordringer i sin praksis, men kunnskap om dette synes mangelfullt i Norge. Internasjonalt er det publisert en rekke essays, artikler, og bøker om etiske utfordringer i anvendelsen av faget, men ingen studier viser hvordan norske idrettspsykologiske rådgivere opplever sl...

  13. Ilusalt lugemine ehk võistulausumine Linnateatris / Riin Aljas

    Index Scriptorium Estoniae

    Aljas, Riin

    2008-01-01

    Vabariiklikust etlejate konkursist. 4.-6. klasside arvestuses võitis Grand Prix' Markkus Pulk, laureaatideks tulid Maria Pihlak, Kenneth Norden ja Laura Elisabeth Konsand. 7.-9. klasside arvestuses võitis Grand Prix' Anna Talvi, laureaatideks tulid Liisa Saaremäel, Karmen Kozma, Riko Osila. 10.-12. klasside arvestuses võitis Grand Prix' Doris Tääker, laureaatideks tulid Jörgen Liik, Virgo Ernits ja Ilja Massalov

  14. Röntgenhoitajien muutoskokemuksia natiivikuvantamisen digitalisoitumisesta.

    OpenAIRE

    Kinnunen, Piia

    2012-01-01

    Opinnäytetyöni tarkoitus on dokumentoida neljän uransa eri vaiheessa olevan röntgenhoitajan natiivikuvantamisessa digitalisoitumisen myötä tapahtuneen kehityksen kautta koettuja muutoskokemuksia. Tavoitteenani oli pohtia yksilöllisen urapolun varrella koettujen muutokseen ja oppimistilanteisiin liittyvien kokemusten hyödynnettävyyttä myöhempien muutoskokemusten käsittelyssä. Valitsin tutkimusmenetelmäksi kvalitatiivisen tutkimuksen. Aineisto kerättiin teemahaastattelujen muodossa yksil...

  15. Riittääkö rahat? – Korkeakouluopiskelijoiden näkemyksiä välttämättömästä kulutuksesta pääkaupunkiseudulla

    OpenAIRE

    Nurminen, Hanna

    2015-01-01

    Tutkielmassa tarkastellaan korkeakouluopiskelijoiden välttämätöntä kulutusta pääkaupunkiseudulla. Tutkimuksessa on hyödynnetty konsensuaalisella eli kuluttajalähtöisellä menetelmällä rakennettuja viitebudjetteja, joissa opiskelijat osallistuvat viitebudjettien laadintaan. Tutkimusaineisto on kerätty neljässä ryhmähaastattelussa, joihin osallistui yhteensä 19 korkeakouluopiskelijaa. Ryhmähaastatteluiden pohjalta olen rakentanut korkeakouluopiskelijoille kohtuullisen minimin mukaisen viitebudje...

  16. An Analysis of Shelf Space Allocation at the Wright-Patterson Air Force Base Commissary.

    Science.gov (United States)

    1987-09-01

    Company performed a major shelf space allocation study involving 59 of their stores. The study involved planning and executing a shelf by shelf reset...Betty Crocker Chocolate .a9 2 Betty CrocKer Yellow .93 3 Betty Crocker Devils Food .92 4 Betty Crocker Choc . Choc . Chip .94 5 Betty Crocker German...Headquarters Air Force Commissary Services. ACOS Executive Summary. 28 January 19d6. 12. deadquarters Air Force Commissary Services. Store _Layout

  17. CLT-koetalon rakennusfysikaaliset tutkimukset

    OpenAIRE

    Tytti, Ahoranta; Tuomas, Alakunnas; Juha, Autioniemi; Antti, Niemelä; Kari, Peisa; Valtteri, Pirttinen; Mikko, Vatanen

    2016-01-01

    CLT-pientalon kokeellisessa rakennushankkeessa testattiin CLT-rakenteiden toimivuutta, kerättiin tietoja ja esiteltiin CLT-rakentamista. Koetalossa tehdyt tutkimukset osoittivat, että CLT-rakenteinen pientalo soveltuu hyvin suomalaisiin olosuhteisiin. Hankkeen aikana tuotettiin paljon lisätietoa CLT-rakentamisesta. CLT-koetalo-hanke oli luonteeltaan investointi- ja kehittämishanke. Se toteutettiin 1.4.2013–30.4.2015. Hanke oli Euroopan aluekehitysrahaston osittain rahoittama, rahoittajavi...

  18. Toimitila-, palo- ja pelastusturvallisuus majoitusyrityksessä

    OpenAIRE

    Pajunen, Touko

    2010-01-01

    Opinnäytetyö tehtiin erään Etelä-Savossa sijaitsevan hotellin hotellipäällikön toimeksiannosta. Työn tavoitteena oli kerätä tietoperusta toimitila-, palo- ja pelastusturvallisuudesta, ja laatia sen pohjalta turvallisuuskatsaus kyseisessä hotellissa. Turvallisuuskatsauksen tavoitteena oli nostaa esiin mahdollisia toimitila-, palo- ja pelastusturvallisuuteen liittyviä epäkohtia ja ehdottaa niihin ratkaisuja. Turvallisuuskatsaus koostui kahdesta tutkimuksesta. Ensimmäisessä arvioitiin toimit...

  19. Prescribing quality for older people in Norwegian nursing homes and home nursing services using multidose dispensed drugs

    OpenAIRE

    Halvorsen, Kjell H.; Granås, Anne Gerd; Engeland, Anders; Ruths, Sabine

    2012-01-01

    Tverrsnittstudie, undersøker og sammenligner forskrivningskvaliteten hos eldre som bor i sykehjem og hjemme. Purpose: to examine and compare the quality of drug prescribing for older patients in nursing homes and home nursing services. Methods: Cross-sectional study comprising 11 254 patients aged ≥65 years in nursing homes (n = 2986) and home nursing services (n = 8268). Potentially inappropriate medications were identified by using the Norwegian General Practice criteria and drug–drug in...

  20. Round-table discussion at Tallinn City Council (March 8, 2010). Part one : The European Union strategy for the Baltic Sea Region - a challenge for cooperation on local and regional levels

    Index Scriptorium Estoniae

    2010-01-01

    Konverentsi ümarlaual võtsid sõna Erik Terk, Toomas Vitsut, Thomas Johansson, Katrin Savomägi, Jasmin Etelämäki, Edvins Karnitis, Ulf Johansson, Per Gudmund Lindencrona, Mika Keränen, Uno Aldegren, Georg Sootla, Heikki Telakivi, Piret Hedin, Mart Repnau, Jüri Riives, Madis Kanarbik, Enn Saar, Tiiu Evert, Galina Gribanova, Keijo Sahrman, Linda Talve

  1. Terveydenhoitaja yrittäjänä liikunta- ja hyvinvointikeskuksessa : markkinakysely asiakkaille

    OpenAIRE

    Pyylampi, Reija

    2010-01-01

    Opinnäytetyössä tutkittiin terveydenhoitajan mahdollisuuksia toimia yrittäjänä liikunta- ja hyvinvointikeskuksessa. Opinnäytetyön tarkoituksena oli kartoittaa terveydenhoitajan palvelujen tarvetta liikunta- ja hyvinvointikeskuksen yhteydessä. Tutkimus toteutettiin markkinatutkimuksen keinoin. Kvantitatiivinen kyselytutkimusaineisto kerättiin tätä tutkimusta varten ja käsiteltiin Tixel-tietojenkäsittelyohjelmalla. Tutkimuksen perusjoukko muodostuu liikunta- ja hyvinvointikeskus ELIXIA:n jä...

  2. Kampen om kanon : en drøftelse av Bart D. Ehrmans forståelse av kanon, med utgangspunkt i boken Lost Christianities

    OpenAIRE

    Christensen, Christen

    2013-01-01

    Det nye testamentet innehar en enorm innvirkningskraft for mennesker over hele verden som kaller seg kristne. Det nye testamentets fortellinger har gjennomsyret land og kulturer, og har preget og forandret verden i snart 2000 år. Det nye testamentet inneholder tjuesyv bøker som i stor grad varierer i form og innhold. Det er evangelier, brev, gjerningsfortellinger og apokalypser, som beskriver hendelser fra kristendommens opprinnelse og tidlige historie. I boken Lost Christ...

  3. Kulka kroonis aasta kümme sulesangarit / Kaarel Kressa

    Index Scriptorium Estoniae

    Kressa, Kaarel, 1983-

    2010-01-01

    Eesti Kultuurkapital kirjanduse sihtkapitali aastaauhinnad: parim ilukirjanduslik proosateos Kalev Kesküla "Elu sumedusest", parim luulekogu Hasso Krull "Neli korda neli", esseistika kogumik Jaan Kaplinski "Paralleele ja parallelisme", vabaauhind Jaan Unduski koostatud Friedebert Tuglase teoste kogumik "Valik proosat", parim lasteraamat Mika Keränen "Peidetud hõbedane aardelaegas", parimad tõlked: Piret Salurilt (Mika Waltari "Sinuhe"), Jean Pascal Ollivry Tammsaare tõlked (Veritee et Justice : La Collin-du-Voleur ; Indrek)

  4. Aasta parimad teosed Krullilt ja Keskülalt / Heili Sibrits

    Index Scriptorium Estoniae

    Sibrits, Heili, 1977-

    2010-01-01

    Eesti Kultuurkapital kirjanduse sihtkapitali aastaauhinnad: parim ilukirjanduslik proosateos Kalev Kesküla "Elu sumedusest", parim luulekogu Hasso Krull "Neli korda neli", esseistika kogumik Jaan Kaplinski "Paralleele ja parallelisme", vabaauhind Jaan Unduski koostatud Friedebert Tuglase teoste kogumik "Valik proosat", parim lasteraamat Mika Keränen "Peidetud hõbedane aardelaegas", parimad tõlked: Piret Salurilt (Mika Waltari "Sinuhe"), Jean Pascal Ollivry Tammsaare tõlked (Veritee et Justice : La Collin-du-Voleur ; Indrek)

  5. Sosiaalisen median markkinoinnin vuosikello Weecos Oy:lle

    OpenAIRE

    Heinämäki, Lotta; Huuskonen, Leena

    2015-01-01

    Opinnäytetyön tarkoitus oli luoda kokonaisvaltainen ja selkeä suunnitelma Weecos Oy:n markkinointitoimenpiteille valituissa sosiaalisen median kanavissa. Weecos on vuonna 2012 perustettu ekologisia yrityksiä yhteen keräävä verkkokauppa-alusta. Pienestä koostaan johtuen se ei ole pystynyt toteuttamaan sosiaalisen median markkinointia toivomallaan tavalla ja markkinoinnin suunnittelu ja toteutus on ollut epäsäännöllistä. Markkinointisuunnitelman tavoitteena oli helpottaa yrityksen markkinoi...

  6. Facebook lanseerauksen työkaluna : Case: Flypark

    OpenAIRE

    Rautio, Hanna

    2015-01-01

    Opinnäytetyön tarkoituksena on tuoda esille nykyajan tuomaa muutosta markkinointiin ja sosiaalisen median mahdollisuuksia mainonnan välineenä. Työssä tutustutaan viime vuosina tapahtuneeseen markkinoinnin kehitykseen ja rahallisten panostusten muutoksiin Suomessa. Esimerkkinä työssä toimii viime syksynä toimintansa aloittanut pysäköintiyritys Flypark, joka toteutti lanseerauskampanjan Facebookissa tavoitteena kasvattaa tunnettuutta, sekä kerätä potentiaalisia asiakkaita sosiaalisen median avu...

  7. Projektin hankintatoimiston dokumenttihallinta

    OpenAIRE

    Kokko, Sari

    2007-01-01

    Opinnäytetyössä tutkittiin investointiprojektin hankintatoimiston dokumenttihallintaa. Tutkimuksessa tehtiin selvitys hankintatoimiston nykytilasta, jonka perusteella tehtiin päätelmiä dokumenttihallinnan jatkotoimenpiteistä. Työhön liittyy kirjallisuustutkimus, jonka avulla selvitettiin työn aihepiirin yleistä perustaa. Oman luvun muodostaa työn kohteessa noudatettavan dokumenttihallinnan ohjeiston kuvaus. Aineisto hankintatoimiston nykytilasta kerättiin kyselylomakkeiden avulla ja haastatte...

  8. Dgroup: DG00325 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ne hydrochloride (JAN) ... Cardiovascular agent ... DG01928 ... Dihydropyridine calcium channel blocker Other ... DG01575 ... Calcium channel bloc...ker ... DG01496 ... Calcium channel L type blocker Cyp substrate ... DG01633 ... CYP3A substra...te ATC code: C08CA12 Dihydropyridine calcium channel blocker CACNA1-L [HSA:775 776 778 779] [KO:K04850 K04851 K04853 K04857] Enzyme: CYP3A4 [HSA:1576] ...

  9. Trust-Management, Intrusion-Tolerance, Accountability, and Reconstitution Architecture (TIARA)

    Science.gov (United States)

    2009-12-01

    Tainting, tagged, metadata, architecture, hardware, processor, microkernel , zero-kernel, co-design 16. SECURITY CLASSIFICATION OF: 17. LIMITATION OF... microkernels (e.g., [27]) embraced the idea that it was beneficial to reduce the ker- nel, separating out services as separate processes isolated from...limited adoption. More recently Tanenbaum [72] notes the security virtues of microkernels and suggests the modern importance of security makes it

  10. ”Har du ikke en bra feed på Insta, så har du ikke orden på livet ditt!” Unge jenter sin opplevelse av andres selvrepresentasjon i bildedelingstjenester.

    OpenAIRE

    Magnussen, Andrea Bergum

    2017-01-01

    Mastergradsoppgave i digital kommunikasjon og kultur, Avdeling for lærerutdanning og naturvitenskap, Høgskolen i Innlandet, 2017 Norsk: Denne oppgaven undersøker unge jenters opplevelse av selvrepresentasjonen på bildedelingstjenestene Instagram og Snapchat. Funnene er basert på individuelle intervjuer og et fokusgruppeintervju av fem jenter på 14 år. Intervjupersonene har i hovedsak uttrykt seg om deres opplevelse knyttet til kjendiser og influencers sin selvrepresentasjon. Oppgaven ta...

  11. Physical Layer Ethernet Clock Synchronization

    Science.gov (United States)

    2010-11-01

    42 nd Annual Precise Time and Time Interval (PTTI) Meeting 77 PHYSICAL LAYER ETHERNET CLOCK SYNCHRONIZATION Reinhard Exel, Georg...oeaw.ac.at Nikolaus Kerö Oregano Systems, Mohsgasse 1, 1030 Wien, Austria E-mail: nikolaus.keroe@oregano.at Abstract Clock synchronization ...is a service widely used in distributed networks to coordinate data acquisition and actions. As the requirement to achieve tighter synchronization

  12. Carrier-envelope phase effect on the asymmetric H2^+ dissociation in an ultrashort pulse using Floquet theory

    Science.gov (United States)

    Zeng, Shuo; Esry, B. D.

    2010-03-01

    The tilted structure of the asymmetry pattern of H2^+dissociation as a function of carrier-envelope phase (CEP) and nuclear kinetic energy release (KER) at low energies (0 ˜3eV) has been seen both theoretically [1] and experimentally [2, 3]. We present a method to interpret this tilted structure using a Floquet-like theory [1]. In this formalism, it is convenient to rewrite the contribution of a given Floquet channel n to the KER spectrum in polar form with phase δn(E) , where E is the KER, which enables us to explain the tilt as a result of the interference between different channels. Our calculations demonstrate the dependence of the asymmetry pattern on wavelength, duration and CEP.[4pt] [1] J.J.Hua et al., J. Phys. B 42 085601 (2009)[0pt] [2] Manuel Kremer et al., Phys. Rev. Lett. 103.213003 (2009)[0pt] [3] M.F.Kling et al., Mol. Phys. (2008)

  13. Anatomical Features and Early Outcomes of Endovascular Repair of Abdominal Aortic Aneurysm from a Korean Multicenter Registry.

    Science.gov (United States)

    Kwon, Hyunwook; Lee, Do Yun; Choi, Soo Jin Na; Park, Ki Hyuk; Min, Seung-Kee; Chang, Jeong-Hwan; Huh, Seung; Jeon, Yong Sun; Won, Jehwan; Byun, Seung Jae; Park, Sang Jun; Jang, Lee Chan; Kwon, Tae-Won

    2015-09-01

    To introduce a nation-based endovascular aneurysm repair (EVAR) registry in South Korea and to analyze the anatomical features and early clinical outcomes of abdominal aortic aneurysms (AAA) in patients who underwent EVAR. The Korean EVAR registry (KER) was a template-based online registry developed and established in 2009. The KER recruited 389 patients who underwent EVAR from 13 medical centers in South Korea from January 2010 to June 2010. We retrospectively reviewed the anatomic features and 30-day clinical outcomes. Initial deployment without open conversion was achieved in all cases and procedure-related 30-day mortality rate was 1.9%. Anatomic features showed the following variables: proximal aortic neck angle 48.8±25.7° (mean±standard deviation), vertical neck length 35.0±17.2 mm, aneurysmal sac diameter 57.2±14.2 mm, common iliac artery (CIA) involvement in 218 (56.3%) patients, and median right CIA length 34.9 mm. Two hundred and nineteen (56.3%) patients showed neck calcification, 98 patients (25.2%) had neck thrombus, and the inferior mesenteric arteries of 91 patients (23.4%) were occluded. Anatomical features of AAA in patients from the KER were characterized as having angulated proximal neck, tortuous iliac artery, and a higher rate of CIA involvement. Long-term follow-up and ongoing studies are required.

  14. Low-rank extremal positive-partial-transpose states and unextendible product bases

    International Nuclear Information System (INIS)

    Leinaas, Jon Magne; Sollid, Per Oyvind; Myrheim, Jan

    2010-01-01

    It is known how to construct, in a bipartite quantum system, a unique low-rank entangled mixed state with positive partial transpose (a PPT state) from an unextendible product basis (UPB), defined as an unextendible set of orthogonal product vectors. We point out that a state constructed in this way belongs to a continuous family of entangled PPT states of the same rank, all related by nonsingular unitary or nonunitary product transformations. The characteristic property of a state ρ in such a family is that its kernel Ker ρ has a generalized UPB, a basis of product vectors, not necessarily orthogonal, with no product vector in Im ρ, the orthogonal complement of Ker ρ. The generalized UPB in Ker ρ has the special property that it can be transformed to orthogonal form by a product transformation. In the case of a system of dimension 3x3, we give a complete parametrization of orthogonal UPBs. This is then a parametrization of families of rank 4 entangled (and extremal) PPT states, and we present strong numerical evidence that it is a complete classification of such states. We speculate that the lowest rank entangled and extremal PPT states also in higher dimensions are related to generalized, nonorthogonal UPBs in similar ways.

  15. Molecular Dications in Planetary Atmospheric Escape

    Directory of Open Access Journals (Sweden)

    Stefano Falcinelli

    2016-08-01

    Full Text Available Fundamental properties of multiply charged molecular ions, such as energetics, structure, stability, lifetime and fragmentation dynamics, are relevant to understand and model the behavior of gaseous plasmas as well as ionosphere and astrophysical environments. Experimental determinations of the Kinetic Energy Released (KER for ions originating from dissociations reactions, induced by Coulomb explosion of doubly charged molecular ions (molecular dications produced by double photoionization of CO2, N2O and C2H2 molecules of interest in planetary atmospheres, are reported. The KER measurement as a function of the ultraviolet (UV photon energy in the range of 28–65 eV was extracted from the electron-ion-ion coincidence spectra obtained by using tunable synchrotron radiation coupled with ion imaging techniques at the ELETTRA Synchrotron Light Laboratory Trieste, Italy. These experiments, coupled with a computational analysis based on a Monte Carlo trajectory simulation, allow assessing the probability of escape for simple ionic species in the upper atmosphere of Mars, Venus and Titan. The measured KER in the case of H+, C+, CH+, CH2+, N+, O+, CO+, N2+ and NO+ fragment ions range between 1.0 and 5.5 eV, being large enough to allow these ionic species to participate in the atmospheric escape from such planets into space. In the case of Mars, we suggest a possible explanation for the observed behavior of the O+ and CO22+ ion density profiles.

  16. Auger decay of 1σg and 1σu hole states of the N2 molecule. II. Young-type interference of Auger electrons and its dependence on internuclear distance

    International Nuclear Information System (INIS)

    Cherepkov, N. A.; Semenov, S. K.; Schoeffler, M. S.; Titze, J.; Petridis, N.; Jahnke, T.; Cole, K.; Schmidt, L. Ph. H.; Czasch, A.; Jagutzki, O.; Schmidt-Boecking, H.; Doerner, R.; Akoury, D.; Williams, J. B.; Landers, A. L.; Osipov, T.; Lee, S.; Prior, M. H.; Belkacem, A.; Weber, Th.

    2010-01-01

    Theoretical two-center interference patterns produced (i) by the K-shell photoionization process of the N 2 molecule and (ii) by the Auger decay process of the K-shell hole state of the N 2 molecule are compared for the case of equal photo- and Auger-electron energies of about 360 eV. The comparison shows that both the angular distribution of the photoelectrons and the angular distribution of the Auger electrons of equal energy in the molecular frame are primarily defined by the Young interference. The experimental data for the angular resolved K-shell Auger electrons as a function of the kinetic-energy release (KER) obtained earlier [Phys. Rev. A 81, 043426 (2010)] have been renormalized in order to visualize the angular variation in the regions of low Auger-electron intensities. That renormalized data are compared with the corresponding theoretical results. From the known behavior of the potential energy curves, the connection between the KER and the internuclear distance can be established. Since the Young interference pattern is sensitive to the internuclear distance in the molecule, from the measured KER dependence of the Young interference pattern one can trace the behavior of the Auger-electron angular distribution for different molecular terms as a function of internuclear distance. The results of that analysis are in a good agreement with the corresponding theoretical predictions.

  17. Performance of a Real-time Multipurpose 2-Dimensional Clustering Algorithm Developed for the ATLAS Experiment

    CERN Document Server

    AUTHOR|(INSPIRE)INSPIRE-00372074; The ATLAS collaboration; Sotiropoulou, Calliope Louisa; Annovi, Alberto; Kordas, Kostantinos

    2016-01-01

    In this paper the performance of the 2D pixel clustering algorithm developed for the Input Mezzanine card of the ATLAS Fast TracKer system is presented. Fast TracKer is an approved ATLAS upgrade that has the goal to provide a complete list of tracks to the ATLAS High Level Trigger for each level-1 accepted event, at up to 100 kHz event rate with a very small latency, in the order of 100µs. The Input Mezzanine card is the input stage of the Fast TracKer system. Its role is to receive data from the silicon detector and perform real time clustering, thus to reduce the amount of data propagated to the subsequent processing levels with minimal information loss. We focus on the most challenging component on the Input Mezzanine card, the 2D clustering algorithm executed on the pixel data. We compare two different implementations of the algorithm. The first is one called the ideal one which searches clusters of pixels in the whole silicon module at once and calculates the cluster centroids exploiting the whole avail...

  18. Performance of a Real-time Multipurpose 2-Dimensional Clustering Algorithm Developed for the ATLAS Experiment

    CERN Document Server

    Gkaitatzis, Stamatios; The ATLAS collaboration

    2016-01-01

    In this paper the performance of the 2D pixel clustering algorithm developed for the Input Mezzanine card of the ATLAS Fast TracKer system is presented. Fast TracKer is an approved ATLAS upgrade that has the goal to provide a complete list of tracks to the ATLAS High Level Trigger for each level-1 accepted event, at up to 100 kHz event rate with a very small latency, in the order of 100 µs. The Input Mezzanine card is the input stage of the Fast TracKer system. Its role is to receive data from the silicon detector and perform real time clustering, thus to reduce the amount of data propagated to the subsequent processing levels with minimal information loss. We focus on the most challenging component on the Input Mezzanine card, the 2D clustering algorithm executed on the pixel data. We compare two different implementations of the algorithm. The first is one called the ideal one which searches clusters of pixels in the whole silicon module at once and calculates the cluster centroids exploiting the whole avai...

  19. States and Measures on Hyper BCK-Algebras

    Directory of Open Access Journals (Sweden)

    Xiao-Long Xin

    2014-01-01

    Full Text Available We define the notions of Bosbach states and inf-Bosbach states on a bounded hyper BCK-algebra (H,∘,0,e and derive some basic properties of them. We construct a quotient hyper BCK-algebra via a regular congruence relation. We also define a ∘-compatibled regular congruence relation θ and a θ-compatibled inf-Bosbach state s on (H,∘,0,e. By inducing an inf-Bosbach state s^ on the quotient structure H/[0]θ, we show that H/[0]θ is a bounded commutative BCK-algebra which is categorically equivalent to an MV-algebra. In addition, we introduce the notions of hyper measures (states/measure morphisms/state morphisms on hyper BCK-algebras, and present a relation between hyper state-morphisms and Bosbach states. Then we construct a quotient hyper BCK-algebra H/Ker(m by a reflexive hyper BCK-ideal Ker(m. Further, we prove that H/Ker(m is a bounded commutative BCK-algebra.

  20. Distribution of Barley yellow dwarf virus-PAV in the Sub-Antarctic Kerguelen Islands and Characterization of Two New Luteovirus Species.

    Directory of Open Access Journals (Sweden)

    Laurence Svanella-Dumas

    Full Text Available A systematic search for viral infection was performed in the isolated Kerguelen Islands, using a range of polyvalent genus-specific PCR assays. Barley yellow dwarf virus (BYDV was detected in both introduced and native grasses such as Poa cookii. The geographical distribution of BYDV and its prevalence in P. cookii were analyzed using samples collected from various sites of the archipelago. We estimate the average prevalence of BYDV to be 24.9% in P. cookii, with significant variability between sites. BYDV genetic diversity was assessed using sequence information from two genomic regions: the P3 open reading frame (ORF (encoding the coat protein and the hypervariable P6 ORF region. The phylogenetic analysis in the P3 region showed that BYDV sequences segregate into three major lineages, the most frequent of which (Ker-I cluster showed close homology with BYDV-PAV-I isolates and had very low intra-lineage diversity (0.6%. A similarly low diversity was also recorded in the hypervariable P6 region, suggesting that Ker-I isolates derive from the recent introduction of BYDV-PAV-I. Divergence time estimation suggests that BYDV-PAV-I was likely introduced in the Kerguelen environment at the same time frame as its aphid vector, Rhopalosiphum padi, whose distribution shows good overlap with that of BYDV-Ker-I. The two other lineages show more than 22% amino acid divergence in the P3 region with other known species in the BYDV species complex, indicating that they represent distinct BYDV species. Using species-specific amplification primers, the distribution of these novel species was analyzed. The high prevalence of BYDV on native Poaceae and the presence of the vector R. padi, raises the question of its impact on the vulnerable plant communities of this remote ecosystem.

  1. Å LESE MEDIETEKSTER PÅ IPADEN. Observasjoner av en medievant fireårings bruk av iPad i hjemmet

    Directory of Open Access Journals (Sweden)

    Henriette Jæger

    2016-06-01

    Full Text Available Artikkelen tar utgangspunkt i tre observasjoner av en gutt på fire år som bruker iPad på fritiden. Den søker å synliggjøre de strategiene dette barnet velger for å skaffe seg tilgang til ulike medietekster, hvordan han leser og tolker dem, og den undersøker eventuelle spor av kritisk refleksjon hos barnet over disse tekstene. Teoretisk sett hviler den på en forståelse av mediekompetanse som en parallell prosess til utvikling av lese- og skrivekyndighet (literacy, og medieopplevelsene omtales som viktige møter med tekst. Artikkelen undersøker hvordan å lese medietekster kan legge et grunnlag for å utvikle en utvidet tekstkompetanse eller mediekompetanse. Konklusjonen legger vekt på motivasjon og lekenhet som barns primære inngang til medietekstene og som et grunnlag for å utvikle mediekompetanse (media literacy. The article is based on three observations of a four-year-old boy who uses the iPad in his spare time. It demonstrates the strategies that this boy applies to gain access to various media texts, and how he reads and interprets them. It also seeks to examine traces of critical reflection that he may demonstrate in relation to these texts. Theoretically, it rests on an understanding of media literacy as a parallel process to the development of literacy, and it seeks to demonstrate how reading media texts can create an important starting point for the development of media literacy. The Kindergarten practitioner’s role and opportunities to develop children's media literacy within a kindergarten context is a focus towards the end of the article. In conclusion, I argue that motivation and playfulness are important approaches to media texts and create an important foundation for the development of media literacy

  2. Barnehagestyreres opplevelser av forholdet til skolen i spørsmål om barns læring

    Directory of Open Access Journals (Sweden)

    Kari Hoås Moen

    2017-03-01

    Full Text Available This study draws attention to what extent directors of private and municipal Early Childhood Centers (ECCs experience disagreement with school concerning questions about children’s learning in ECCs and the content of this disagreement. Furthermore, it focuses to what extent the directors of these two center categories try to influence school in such questions, and how they possibly may do this. The material derives from a nationwide survey (1310 directors and an interview study (16 directors. The directors experience disagreements to a small extent and least in private centers. However, some disagree about to which extent the adults should lead children’s learning. This study reveals a great variety in how much the directors try to influence school. The municipal directors are most active. Artikkelen retter søkelys på i hvilken grad styrere i kommunale og private barnehager opplever uenighet med skolen i spørsmål om barns læring i barnehagen og eventuelt hva slik uenighet kan handle om. Videre ser den på i hvilken grad styrere i de to barnehagetypene forsøker å påvirke skolen i spørsmål om barns læring og eventuelt på hvilke måter. Datamaterialet kommer fra en landsdekkende survey (1310 styrere og intervjuundersøkelse (16 styrere. Styrerne opplever liten grad av uenighet med skolen og minst i private barnehager. Et tema det kan være uenighet om, er grad av voksenstyring i læringsaktivitetene. Det er stor spredning på i hvilken grad styrerne forsøker å påvirke skolen. Styrere i kommunale barnehager er klart mest aktive. Styrerne forsøker å påvirke skolen på ulike måter.

  3. 圣经《箴言》中的贫富观探析%The Wealth Ethics in Bible "Proberbs"

    Institute of Scientific and Technical Information of China (English)

    王影杰

    2014-01-01

    圣经《箴言》作为犹太民族智慧的结晶,流露出明显的否定贫穷、崇尚财富的实利态度,但犹太人对财富的认知并没有陷入片面化,而是散发着辩证、理性的光芒。《箴言》在教导民众追求财富的同时,也积极引导社会怜悯并救济穷人,由此形成犹太民族崇尚财富但不盲目拜金的美德,这对于当下经济大发展时的中国具有启迪意义。%Bible " Priverbs" as a crystallizatiin if wisdim if the Jewish natiin,shiwing a kind utilitarian attitude if rejecting piverty and wirshiping wealth. Hiwever,the Jews cignitiin in wealth did nit fall inti ine - side,but exuded a dialectical and ratiinal light. Besides," Priverbs" tild peiple ti pursue wealth,as well as ti pity and relieve the piir. Thus,the Jews held the virtue if pursuing wealth but nit wirshiping blindly,which has inspired significance fir Chinese ecinimic develipment during the miment.

  4. Det «overbestemte» livet?: Balansering av arbeid og familieliv i IT-bransjen i Norge, Malaysia og California

    OpenAIRE

    Singstad, Birgit Nestvold

    2011-01-01

    Det “overbestemte” livet? Balansering av arbeid og familieliv i IT-bransjen i Norge, Malaysia og California. Denne avhandlingen undersøker hvordan ansatte i IT-bransjen balanserer arbeid og familieliv i Norge, Malaysia og California. Jeg har valgt å undersøke dette i en gruppe høyt utdannede arbeidstakere, og har spurt: Er det slik at et interessant, morsomt og fleksibelt, men krevende arbeidsliv skaper tidsklemmer og balanseproblemer? Eller er det vårt senmoderne samfunn som skaper for m...

  5. Hybridiautojen tekniikkaa ja päästömittaus määräaikaiskatsastuksessa

    OpenAIRE

    Rintala, Tomi

    2013-01-01

    Tämän opinnäytetyn tarkoituksena oli selvittää mitä täytyy ottaa huomioon hybridiautoa katsastettaessa, lähinnä päästömittauksen osalta. Pääsääntöisesti hybridiautot katsastetaan kuten perinteisetkin autot, mutta jotkin hybridimallit vaativat erityistoimenpiteitä, jotta päästömittaus voidaan suorittaa. Tavoitteena oli kerätä merkki- ja mallikohtaiset ohjeistukset. Tarkoituksena oli myös käsitellä hybridiautojen turvallisuusohjeistusta, koska hybridiautojen korkeajännitepiiri lisää auton turva...

  6. Conceptual metaphors in slang: a study on the words shit, piss, and blood

    OpenAIRE

    Turunen, Max

    2016-01-01

    Pro gradu -tutkielmassa selvitetään, minkälaisia käsitteellisiä metaforia ilmenee slangi-ilmaisuissa, joissa esiintyy sanat shit, piss ja blood. Myös käsitteellisten metaforien eroavuudet ovat tutkimuksen mielenkiinnon kohteena. Tutkimusaineisto on kerätty viidestä eri slangisanakirjasta, mutta vain sellaiset ilmaisut tutkittiin, joissa sanoilla shit, piss, ja blood on metaforinen merkitys. Tällaisia ilmaisuja havaittiin olevan 423. Tutkimuksen viitekehyksenä käytetään käsitteellisen met...

  7. Ongelmajätepalveluiden toiminnanohjauskäsikirja

    OpenAIRE

    Helminen, Tapio

    2011-01-01

    Tässä opinnäytetyössä on pyritty luomaan toimiva ja käytännöllinen toiminnanohjauskäsikirja Lassila & Tikanoja Oyj:n Maalahden ongelmajätepalvelutoimipisteeseen. Tarkoituksena oli selvittää ja kerätä yleisimpien ongelmajätelajien käsittely ja tunnistamisohjeet yhteen, jotta kaikki ohjeet olisivat yhdessä paikassa ja helposti saatavilla. Työn teoriaosassa on perehdytty ongelmajätteen määrittelyyn, luokitteluun ja velvollisuuksiin ongelmajätteiden käsittelyprosessissa. Valtaosa ongelmajättei...

  8. Mag ‘slegs blankes!’ hier aanbid?

    Directory of Open Access Journals (Sweden)

    P. van Staden

    1994-01-01

    Full Text Available May ‘whites only!’ worship here? This is the first of a two-part study in which an assessment is made of the arguments prohibiting people of colour from attending regular Sunday services in the Nederduitsch Hervormde KerL Under the present heading the historical background that gave rise to the exclusivist measures is investigated and the arguments for maintaining these measures in the present are evaluated. The study argues that Jesus’ instruction to proclaim the message of God’s saving grace to the world may not be curtailed by measures excluding anybody from the opportunity to hear that message whenever it is preached.

  9. Tiedustelu avoimista lähteistä metatiedon avulla

    OpenAIRE

    Glad, Timo

    2013-01-01

    Tämän opinnäytetyön tarkoituksena on selvittää avoimiin lähteisiin perustuvaa tiedustelua ja sen hyödyntämistä organisaatioiden julkaisemien dokumenttien metatiedon analysoinnissa. Tutkimuksen menetelmänä on dokumenttianalyysi. Avoimiin lähteisiin pohjautuvan tieduste- luprosessin lähteenä käytetään NATO:n sekä YK:n julkaisemia ohjeistuksia. Työ toteutettiin valitsemalla viisi yritystä joiden julkaisemat, ja Google-hakupalvelun indek- soimat, dokumentit kerättiin ja analysoitiin metatiedo...

  10. Elisa Live -palvelu : Laajentuminen Ison-Britannian markkinoilla

    OpenAIRE

    Heimolinna, Rami

    2016-01-01

    Tämän opinnäytetyön tarkoituksena oli tuottaa Elisan liiketoimintatiimille tietoa, joka liittyy Elisa Live -palvelun vuonna 2015 alkaneeseen kansainväliseen laajentumiseen. Työn tavoitteita olivat asiakasymmärryksen lisääminen ja tiedon kerääminen Elisan kilpailijoista valitussa myyntikanavassa Amazon-verkkokaupassa. Teoriaosuudessa selvitettiin kilpailutekijöitä, markkinointiviestintää ja kansainvälistymistä. Nykytilanneanalyysissä tutkittiin Isoa-Britanniaa markkina-alueena ja Amazon-ve...

  11. Lasten ulkovaatteiden kevät-kesämalliston seinäesillepano-ohje : case: Reima Oy

    OpenAIRE

    Järvenoja, Annika

    2014-01-01

    Opinnäytetyö tehtiin Reima Oy:lle. Työn tavoitteena oli kerätä asiakkaiden mielipiteitä lasten ulkovaatteiden seinäesillepanoista. Tutkimuksen pohjalta tehtiin seinäesillepano-ohje kevät-kesämallistolle. Reiman omat myymälät sijaitsevat pääosin Kiinassa, Suomessa ja Venäjällä. Kevät-kesämalliston tuotteiden vaihtelevuus välikausivaatteista ohuisiin aurinkosuojavaatteisiin koettiin myymälässä haasteelliseksi. Tavoitteena on tutkia lisäksi, mistä maiden kulttuurien eroavaisuudet johtuvat, ja mi...

  12. ORGANIZACIJA OGLAŠEVANJA V ČASOPISNI HIŠI DNEVNIK

    OpenAIRE

    Kodrič, Jure

    2010-01-01

    Diplomska naloga se osredotoča na osrednja vprašanja sodobnega marketinškega upravljanja časopisne hiše Dnevnik. Ker je s tem tematskim področjem povezana cela vrsta problemov, ki sodijo tako na področje strateškega managementa kot tudi marketinga, so v nalogi izsledki obeh disciplin smiselno povezani. Namen diplomske naloge je predstavitev časopisne hiše Dnevnik, njihovih edicij in se seznaniti z oglaševanjem kot elementom tržnega komuniciranja in pokazati njegovo pomembnost v podjetju. ...

  13. Uvajanje CRM rešitev na primeru podjetja Aksel d.o.o.

    OpenAIRE

    Skaza, Gašper

    2016-01-01

    Z novejšimi tehnologijami prihaja potreba po tem, da se podjetja posvečajo prenovi zastarelih informacijskih sistemov, ki so v veliko primerih nekompatibilni z novejšo tehnologijo. Kratica CRM (angl. Customer Relationship Management) v slovenskem prevodu pomeni sisteme za upravljanje odnosov s strankami. CRM je rešitev, ki pomaga konkurenčnost podjetja dvigniti na višjo raven, saj je dandanes ključno, da se posvetimo stranki na sodobne načine. Ker je zadovoljstvo stranke ključno za zvestobo,...

  14. Ohjelmistot sisälogistiikan johtamisessa : Software Products for leading Inbound Logistics

    OpenAIRE

    Virtanen, Ismo

    2015-01-01

    Opinnäytetyön toimeksiantaja oli Jyväskylän ammattikorkeakoulu. Työtehtävänä oli tutustua ohjelmistoihin, joita käytetään sisälogistiikassa. Työn tavoitteena oli laatia selkeä opas sisälogistiikan ohjelmistoista logistiikkajohtajalle. Työn viitekehyksessä kuvataan Suomen sisälogistiikan nykytilannetta sekä tutustutaan varastonhallintajärjestelmän toimintoihin, tyyppeihin ja rakenteisiin. Ohjelmistotietoja kerättiin yrityksiltä, ohjelmistovalmistajilta ja markkinoijilta. Työstä rajattii...

  15. Kvantifisering av overvann: Case Brøset

    OpenAIRE

    Huurnink, Jon Egenberg

    2012-01-01

    Oppgaven forsøker å vise den systemresponsen som er særegen for konvensjonelle tiltak og blå-grønne tiltak. Dette er aktuelt på Brøset bydel som en del av Fremtiden byer prosjektet og skal bygges om til boligområde. MIKE URBAN og MIKE 21 er benyttet til å lage en konseptuell modell.Ved å sammenligne sommer- og vinterforhold, i tillegg til ulike gjentaksintervaller (1, 20 og 100år), vil kurver for videreført vannmengde gi et inntrykk av tiltakenes effekt. Dette gir beslutningsstøtte for Komm...

  16. ATCA-based ATLAS FTK input interface system

    Energy Technology Data Exchange (ETDEWEB)

    Okumura, Yasuyuki [Chicago U., EFI; Liu, Tiehui Ted [Fermilab; Olsen, Jamieson [Fermilab; Iizawa, Tomoya [Waseda U.; Mitani, Takashi [Waseda U.; Korikawa, Tomohiro [Waseda U.; Yorita, Kohei [Waseda U.; Annovi, Alberto [Frascati; Beretta, Matteo [Frascati; Gatta, Maurizio [Frascati; Sotiropoulou, C-L. [Aristotle U., Thessaloniki; Gkaitatzis, Stamatios [Aristotle U., Thessaloniki; Kordas, Konstantinos [Aristotle U., Thessaloniki; Kimura, Naoki [Aristotle U., Thessaloniki; Cremonesi, Matteo [Chicago U., EFI; Yin, Hang [Fermilab; Xu, Zijun [Peking U.

    2015-04-27

    The first stage of the ATLAS Fast TracKer (FTK) is an ATCA-based input interface system, where hits from the entire silicon tracker are clustered and organized into overlapping eta-phi trigger towers before being sent to the tracking engines. First, FTK Input Mezzanine cards receive hit data and perform clustering to reduce data volume. Then, the ATCA-based Data Formatter system will organize the trigger tower data, sharing data among boards over full mesh backplanes and optic fibers. The board and system level design concepts and implementation details, as well as the operation experiences from the FTK full-chain testing, will be presented.

  17. Asiakaskokemuksen kehittämistä tukeva asiakaspalautejärjestelmä julkisen sektorin organisaatiossa

    OpenAIRE

    Salovaara, Anu

    2017-01-01

    Opinnäytetyön tavoitteena on lisätä julkisen sektorin organisaatioiden valmiuksia asiakaskokemuksen kehittämiseen asiakaspalautteen avulla. Opinnäytetyössä kehitettiin julkiselle organisaatiolle asiakaspalautejärjestelmä, joka tukee sekä yhteiskehittämistä asiakkaan kanssa että asiakaskokemuksen kehittämistä. Useassa julkisessa organisaatiossa asiakaslähtöisyys on keskeisessä asemassa strategiassa. Keräämällä asiakaspalautetta systemaattisesti asiakaskohtaamisista ja kehittämällä asiakask...

  18. Asiakastyytyväisyys ja asiakaspalautejärjestelmän kehittäminen Case: Ravintola Road House

    OpenAIRE

    Matthias, Elena

    2009-01-01

    Opinnäytetyön aiheena on asiakastyytyväisyys ja asiakaspalautejärjestelmän kehittäminen Ravintola ”Road Houselle”. Työn tavoitteena on kehittää toimiva asiakaspalautejärjestelmä, jolla hankitaan asiakkailta palautetta ravintolapalvelujen laadusta. Asiakaspalautteen keräämisen ja hyödyntämisen kehittämiseksi tutkimuksessa myös selvitetään asiakkaiden tyytyväisyyttä. Toimivalla asiakaspalautejärjestelmällä ravintola ”Road House” pystyy kehittämään omaa toimintaansa entistä paremmin asiakkaiden ...

  19. Nuoret aikuiset Suvimäen Klubitalolla : ”Tää ei oo mitään ikärasismia, vaan nuoret haluu kohdata nuoria!”

    OpenAIRE

    Mäkinen, Sanni

    2009-01-01

    Opinnäytetyön tavoitteena oli kerätä tietoa nuorten aikuisten mielenterveyskuntoutujien toiminnan kehittämiseen Suvimäen Klubitalolla. Tutkimuksessa selvitettiin Suvimäen Klubitalon nuorten aikuis-ten jäsenten kokemuksia klubitalotoiminnasta sekä heidän ideoitaan toiminnan kehittämiseen. Lisäksi tutkittiin, miten nuoret aikuiset on huomioitu Klubitaloilla ulkomailla, sekä mitä paikalliset mielenterveysalan toimijat ajattelevat nuorten aikuisten mielenterveyskuntoutumisesta. Tutkimus tot...

  20. UPRAVLJANJE IN OBVLADOVANJE KREDITNEGA TVEGANJA V BANKI

    OpenAIRE

    Coklin, Tanja

    2010-01-01

    Banke se pri svojem poslovanju srečujejo s številnimi tveganji. Ker je ena od njihovih osnovnih dejavnosti dajanje kreditov, so najbolj izpostavljene kreditnemu tveganju. Kreditno tveganje je tveganje nastanka izgube zaradi neizpolnitve obveznosti dolžnika do banke. Kreditnemu tveganju se ni mogoče izogniti, ga pa je mogoče zmanjšati. S tem namenom banke upravljajo in obvladujejo kreditno tveganje, ki so mu izpostavljene. Pri tem so omejene z zakonskimi predpisi. Oba procesa morata poteka...

  1. VPLIV ODNOSA S STARŠI NA SAMOPOŠKODOVALNO VEDENJE MLADOSTNIKOV

    OpenAIRE

    Majhen, Maša

    2016-01-01

    Samopoškodovalno vedenje se najpogosteje pojavlja med mladostniki. Ker pa je družina eden izmed najpomembnejših socialnih sistemov v mladostnikovem življenju, smo želeli ugotoviti ali obstaja kakšna povezanost med mladostnikovim odnosom s starši in omenjenim pojavom. Ugotoviti smo želeli ali obstajajo znotraj družinskih odnosov in procesov dejavniki, ki vplivajo na verjetnost pojava samopoškodovalnega vedenja pri mladostnikih. Na podlagi preučene literature smo predvidevali, da zanemarjanje ...

  2. ”Olen juuri niin tiedostava, kuin minun on varaa olla” – Saksalais- ja suomalaisnuorten suhde kodin sisustamiseen ja puuhuonekaluihin

    OpenAIRE

    Hakala, Inkeri

    2014-01-01

    Tutkielma tarkastelee nuorten kuluttajien kodinsisustukseen ja puuhuonekaluihin liittämiä merkityksiä saksalaisessa ja suomalaisessa kontekstissa. Aihetta lähestytään maun ja elämäntyylin sekä kuluttajien tavarasuhteen näkökulmasta. Tutkimuksen aineisto koostuu Saksassa ja Suomessa huonekaluliikkeissä ja -messuilla kerätystä havainnoin-timateriaalista sekä 23–34 -vuotiaille kuluttajille tehdystä 22 teemahaastattelusta. Havainnointiaineistoa on käytetty tutkimuskontekstin hahmottamisessa. Haas...

  3. Barns opplevelse av postoperativ smerte og smertebehandling

    OpenAIRE

    Næss, Torgun

    2016-01-01

    Master i intensivsykepleie Bakgrunn: Postoperativ smerte hos barn er underbehandlet til tross for mye smerteforskning. Ulike studier har vist at barn opplever moderat til sterk smerte postoperativt. Ubehandlet smerte kan skape unødvendig lidelse for barn og øker risiko for komplikasjoner. Hensikt: Det finnes ingen forskning på norske barns opplevelse av postoperativ smerte og smertebehandling. Studiens hensikt er å få en større forståelse for hvordan barn opplever postoperativ smerte og sm...

  4. Kolme Valttia : Korusuunnittelua tarotkorttien pohjalta

    OpenAIRE

    Vento, Anna

    2015-01-01

    Opinnäyteyön aiheena olivat tarotkortit, joita käytettiin korumalliston pohjana. Tarotpakan 78 kortista valittiin kolme korttia, joiden kuvallista ja sanallista symboliikkaa hyödyntäen suunniteltiin kolme korua, yksi jokaiselle kortille. Suunnittelutyöhön tarkoitetut kolme korttia valittiin tarotpakan Isosta Arkanasta. Nämä kolme korttia olivat nimeltään Erakko, Voima ja Kohtuus. Opinnäytetyöhön kerättiin informaatiota kirjallisuudesta, sekä haastatteluista, joita saatiin kolmelta tarottu...

  5. ATLAS FTK Fast Track Trigger

    CERN Document Server

    Iizawa, T; The ATLAS collaboration

    2014-01-01

    The Fast TracKer (FTK) will perform global track reconstruction after each Level-1 trigger accept signal to enable the software-based higher level trigger to have early access to tracking information. FTK is a dedicated processor based on a mixture of advanced technologies. Modern, powerful Field Programmable Gate Arrays (FPGAs) form an important part of the system architecture, and the large level of computing power required for pattern recognition is provided by incorporating standard-cell ASICs named Associative Memory (AM). Motivation and the architecture of the FTK system will be presented, and the status of hardware and simulation will be following.

  6. Tallinna Pedagoogikaülikooli magistreid 2004 / Katrin Aava, Toomas Liiv, Helle Metslang

    Index Scriptorium Estoniae

    Aava, Katrin, 1963-

    2005-01-01

    Eesti keele, soome keele ja kommunikatsiooni eriala magistritöödest. Ka viis kirjandusteaduslikku tööd: Kerli Linnati "The vision of history of E. L. Doctorow in English and in Estonian: a comarative study of "Ragtime" and "Look Lake" and their translations", Anneli Niitsoo "Postmodern play with power and masculinity in Jeanette Winterson's Novels", Pille Riismaa "Gümnaasiumi kirjandusõpik "Eelmise sajandi eesti kirjandus"", Anneli Kõvamehe "Baltisakslased Jaan Krossi "Kolmandates mägedes", "Keisri hullus" ja Rakvere romaanis"", Jaak Urmeti "Kultuuri eest ja religiooni vastu. Max Laossoni usuvastasest paljastustööst ajakirjas "Ratsionalist" (1932-1933)"

  7. IZDELAVA SPLETNEGA PORTALA ZA PODJETJE OGLEDALO D.O.O.

    OpenAIRE

    Turk, Marko

    2010-01-01

    V današnjem času si ne predstavljamo življenja brez informacijskih tehnologij. Internet je postal pomemben dejavnik na področju marketinga in poslovanja podjetij. Prav zato ima danes vsako uspešno podjetje svojo spletno stran, kjer se predstavi, posluje, trži izdelke in reklame. Ker pa so potrebe po spletnih straneh vedno večje, so se le te razvile v dinamične strani, ki ponujajo vedno večjo interakcijo med podjetjem in uporabnikom. Poleg tega se je s strani podjetij pojavila potreba p...

  8. Jaksetaan, jookos? : Päiväkodin johtajien kokemuksia psykososiaalisesta työhyvinvoinnista

    OpenAIRE

    Puranen, Tiina

    2011-01-01

    Opinnäytetyön tarkoituksena on kuvata päiväkodin johtajien psykososiaalista työhyvinvointia: kuin-ka päiväkodin johtajat jaksavat työssään ja työyhteisössä. Kysely suunnattiin Kuopion kaupungin, Siiliset- peruspalvelukeskuksen, Suonenjoen kaupungin, Rautalammin kunnan sekä muutamien yksityisten päiväkotien johtajille (N=56). Vastausprosentti oli 59 % (n=33). Tutkimusaineisto kerättiin kyselylomakkeella maalis-huhtikuun aikana vuonna 2011. Kyselylomakkeessa käytettiin pääosin yleistä pohjoi...

  9. Verkligt värde vid första redovisningstillfället?

    DEFF Research Database (Denmark)

    Thinggaard, Frank; Nilsson, Sven-Arne

    2007-01-01

    I en första artikel av två diskuterar Frank Thinggaard och Sven-Arne Nilsson en rapport från IASB som föreslår verkligt värde istället för anskaffningsvärde vid första redovisningstillfället. Där rapporten står för nytänkande undersöker de om denär i linje med en rapport om förbättrad föreställni...

  10. Nuoruudessa koetun seksuaalisen kaltoinkohtelun muodot ja ilmitulo

    OpenAIRE

    Kangas, Ilona; Tolonen, Emmi

    2009-01-01

    Nuorten kokema seksuaalinen häirintä ja väkivalta on vaiettu, mutta valitettavan yleinen ongelma. Kotimaista tutkimusta nuorten kokemasta seksuaalisesta kaltoinkohtelusta on tehty vähän. Opinnäytetyön tarkoituksena oli selvittää nuoruudessa koetun seksuaalisen kaltoinkohtelun muotoja ja ilmituloa kirjallisuuden ja Väestöliiton internetissä keräämän kyselyaineiston avulla. Työ on osa Terveys- ja hoitoalan klusterin projektia Nuorten seksuaaliterveyden edistämisen toteutuminen koulu- ja opiskel...

  11. Bonton v zdravstveni negi

    OpenAIRE

    Vrtič, Tea

    2014-01-01

    Ko govorimo o bontonu mislimo na družbeno spremenljivo vedenje, ki ga določata etika in morala. Pravila lepega vedenja so vedno obstajala in bodo tudi v prihodnje, čeprav se malo spreminjajo, ker so izraz duha časa razmerij moči in socialne strukture. Pravila lepega vedenja nam morajo pomagati pri povezovanju in nas ne smejo ovirati. Pomembno pa je, da krepijo medsebojno razumevanje, strpnost in izkazujejo pripravljenost pomagati. Vsakdo ima svojo osebnost, dostojanstvo zaradi česar uporablj...

  12. Opiskelijoita ohjaavien sairaanhoitajien kokemuksia organisaation tuesta opiskelijaohjauksessa

    OpenAIRE

    Heinilä, Päivi; Penttinen, Nina; Sillman, Outi

    2014-01-01

    Tämän opinnäytetyön tarkoituksena oli kuvailla, minkälaisia kokemuksia opiskelijoita ohjaavilla sairaanhoitajilla oli organisaatiolta saamastaan tuesta opiskelijaohjauksessa. Tavoitteena on, että saatua tietoa hyödynnetään opiskelijoita ohjaavien sairaanhoitajien tukemiseen. Opinnäytetyö toteutettiin laadullisena tutkimuksena. Aineisto kerättiin toukokuussa 2014 ryhmähaastattelulla käyttämällä teemahaastattelun menetelmää. Haastatteluihin osallistui yhteensä yhdeksän sairaanhoitajaa HUS/H...

  13. User’s trust in Biometric Authentication Systems – Do not take the end-users for granted

    OpenAIRE

    Gravnås, Henning

    2005-01-01

    NORSK: I de senere årene har mediefokuset vært rettet mot sikkerhet. Et av kravene innenfor sikkerhet, er økt behov for korrekt autentisering av en person. Det er mulig å autentisere seg ved å fremlegge bevis på noe du vet (for eksempel et passord), noe du har (for eksempel et ID-kort) eller noe du er (for eksempel biometri). Denne undersøkelsen forsøker å finne ut av i hvilken grad mulige brukere av biometriske autentiseringssystemer har tillit til et slikt system. Deltakerne ...

  14. Nintendo Wii-pelikonsolin käyttö ikääntyneiden tasapainon tukemisessa

    OpenAIRE

    Pere, Olli; Suihkonen, Juho; Kärkkäinen, Taneli

    2017-01-01

    Opinnäytetyömme tavoitteena oli lisätä tietoa Nintendo Wii-pelikonsolin käytöstä ikääntyneiden tasapainoharjoittelussa. Opinnäytetyössämme teimme kirjallisuuskatsauksen kokoamalla aiemmin tutkittua tietoa aiheesta. Selvittääksemme ikääntyneiden käyttökokemuksia tasapainoharjoittelusta Nintendo Wiipelikonsolilla, teimme palvelutalo Karpalokodilla aiheesta tapaustutkimuksen. Tapaustutkimukseen osallistui kolme 80-89-vuotiasta henkilöä. Aineiston tapaustutkimukseen keräsimme haastattelulla. ...

  15. Riskuppfattningar om preventivmedel för män och kvinnor : altruism, riskbenägenhet och traditionella könsroller

    OpenAIRE

    Nilsson Gauffin, Rebecka

    2017-01-01

    Preventivmedel för kvinnor innefattar en betydande andel biverkningar. Hittills har män inte upplevt några allvarliga biverkningar av de testade preventivmedlen för män, trots detta är det biverkningarna som stoppat preventivmedel för män från att lanseras på marknaden. I denna studie argumenteras för att en möjlig förklaring till detta ligger i skilda riskuppfattningar om preventivmedel för män och kvinnor. Studien undersöker riskuppfattningar om preventivmedel samt hur individers egenskaper...

  16. Big data -teknologian perusteet ja mahdollisuudet

    OpenAIRE

    Juurinen, Susanna

    2013-01-01

    Työn tarkoituksena oli tutkia tiedonhallintaa ja big data -ratkaisujen käytännön toteutusta, mahdollisuuksia, haasteita ja hyötyjä. Työssä kuvataan tiedon määrän kehitystä, keräysprosesseja ja -menetelmiä sekä pohditaan tiedonhallinnan vaatimuksia ja tietoturvallisuutta. Työn tarkoitus oli selvittää tiedonhallinnan ja analytiikan uusimman trendin, big datan, vaikutusmahdollisuuksia organisaatioiden toimintaan. Tiedon analytiikkaa voidaan valjastaa liiketoiminnan tai muiden toimialueiden t...

  17. PRIMERJAVA POROČIL ZA VODENJE INFORMATIKE COBIT 4.1 IN COBIT 5

    OpenAIRE

    Štagar, Darja

    2012-01-01

    V diplomskem delu smo predstavili področja upravljanja informatike, ki jih je za uspešno poslovanje potrebno upravljati organizirano. Priporočljiva je uporaba različnih standardov in priporočil, zato smo v delu predstavili nekatere standarde in priporočila, ki to omogočajo. Glavna tema te naloge so priporočila za vodenje informatike CobIT, ki smo jih tudi podrobneje predstavili. Obravnavali smo zadnji dve različici, CobIT 4.1 in CobIT 5. Ker sta si med seboj bistveno različni, smo ju primerja...

  18. The Finnish subtitling of neologisms in the science fiction television series Stargate SG-1

    OpenAIRE

    Kurki, Riikka

    2012-01-01

    Tämä pro gradu -tutkielma käsittelee kanadalais–amerikkalaisen tieteissarjan Stargate SG-1 (tunnettu Suomessa myös nimellä Tähtiportti) neologismien eli uudissanojen tekstitystä englannista suomeksi. Uudissana on sana, joka ei ole virallisissa sanakirjoissa tai jolla on sanakirjoissa eri merkitys kuin sen uudessa käyttömuodossa. Tutkimusta varten on kerätty kaikki uudissanat Stargate SG-1 -sarjan seitsemännen tuotantokauden DVD-julkaisulta ja analysoitu, millaisia käännöstekniikoita sarjan ka...

  19. Tosi-TV:n leikkaaminen : Erityispiirteet ja ajan tiivistäminen

    OpenAIRE

    Rinkinen, Joonas

    2013-01-01

    Opinnäytetyö tarkastelee tosi-tv:n historiaa, sen leikkaamisen erityispiirteitä ja ajan tiivistämistä. Työ on suunnattu pääsiassa leikkausorientoituneille alan opiskelijoille. Työn pääasiallisena tarkoituksena on tuoda esille tosi-tv:n leikkaamiselle ominaisia työtapoja ja erityispiirteitä sekä esitellä leikkauksellisia keinoja katsojan aikakokemuksen tiivistämiseksi. Opinnäytetyöni tutkimusaineisto koostuu ammattilaishaastatteluista, omista työssä kerätyistä kokemuksistani sekä kirjallis...

  20. Dicty_cDB: SFL482 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFL482 (Link to dictyBase) - - - Contig-U15494-1 SFL482P (Link... to Original site) SFL482F 434 SFL482Z 394 SFL482P 828 - - Show SFL482 Library SF (Link to library) Clone ID SFL482 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15494-1 Original site URL http://dict...cftclww*qmcqmcp*qnrscfln*rtknr*nclqeatkrfkt ker*EIIQINVVININHFLLIKKK--- ---ICTHIEKMVQRLTYRRRLSYRTTSNATKIVKTP...KQQK DLKQKKDKKSSK*m Translated Amino Acid sequence (All Frames) Frame A: icthiekmvqrltyrrrlsyrttsnatkivktpgg

  1. NOVOSTI OBDAVČITVE SAMOSTOJNIH PODJETNIKOV

    OpenAIRE

    Sakelšek, Maruša

    2015-01-01

    Čeprav se v Sloveniji in tudi nekaterih drugih državah Evropske Unije že nekaj let soočamo z gospodarsko krizo, je porast novoustanovljenih podjetij vse večji. Cilj vsakega podjetnika je kljub temu uspešno poslovanje, zato je pred ustanovitvijo podjetja pomembno, da preuči vse možnosti – katero vrsto podjetja ustanoviti in katero vrsto obdavčitve izbrati. To je pomembno predvsem zato, ker mnogo novoustanovljenih podjetij propade ravno zaradi nepravilnega in pomanjkljivega planiranja začetka s...

  2. La ciencia de la política.

    OpenAIRE

    Bolívar Meza, Rosendo

    2007-01-01

    Presentación. Ramos Jiménez, Alfredo Los círculos bolivarianos. El mito de la unidad del pueblo. Arenas, Nelly y Gómez Calcaño, Luis Lo massmediático y las sociedades contemporáneas. Un acercamiento a la relación medios-democracia. Briceño Romero, Ysabel La economía ambiental y la política ambiental. Caraballo, Leonardo Javier Veinte años de democracia en la Argentina. ¿Qué democracia? Kers, Mercedes y Leiras, Santiago C. La ciencia de la política. Bolívar ...

  3. Sobrado, Miguel y Rojas Herrera, Juan José: América Latina: crisis del estado clientelista y la construcción de repúblicas ciudadanas.

    OpenAIRE

    García S., Francisco R.

    2007-01-01

    Presentación. Ramos Jiménez, Alfredo Los círculos bolivarianos. El mito de la unidad del pueblo. Arenas, Nelly y Gómez Calcaño, Luis Lo massmediático y las sociedades contemporáneas. Un acercamiento a la relación medios-democracia. Briceño Romero, Ysabel La economía ambiental y la política ambiental. Caraballo, Leonardo Javier Veinte años de democracia en la Argentina. ¿Qué democracia? Kers, Mercedes y Leiras, Santiago C. La ciencia de la política. Bolívar ...

  4. La economía ambiental y la política ambiental.

    OpenAIRE

    Caraballo, Leonardo Javier

    2007-01-01

    Presentación. Ramos Jiménez, Alfredo Los círculos bolivarianos. El mito de la unidad del pueblo. Arenas, Nelly y Gómez Calcaño, Luis Lo massmediático y las sociedades contemporáneas. Un acercamiento a la relación medios-democracia. Briceño Romero, Ysabel La economía ambiental y la política ambiental. Caraballo, Leonardo Javier Veinte años de democracia en la Argentina. ¿Qué democracia? Kers, Mercedes y Leiras, Santiago C. La ciencia de la política. Bolívar ...

  5. Teoría de la organización y administración pública. Revisión crítica de la perspectiva weberiana de la burocracia.

    OpenAIRE

    Grimaldo Lorente, Jaime

    2007-01-01

    Presentación. Ramos Jiménez, Alfredo Los círculos bolivarianos. El mito de la unidad del pueblo. Arenas, Nelly y Gómez Calcaño, Luis Lo massmediático y las sociedades contemporáneas. Un acercamiento a la relación medios-democracia. Briceño Romero, Ysabel La economía ambiental y la política ambiental. Caraballo, Leonardo Javier Veinte años de democracia en la Argentina. ¿Qué democracia? Kers, Mercedes y Leiras, Santiago C. La ciencia de la política. Bolívar ...

  6. El mito de la unidad del pueblo.

    OpenAIRE

    Arenas, Nelly; Gómez Calcaño, Luis

    2007-01-01

    Presentación. Ramos Jiménez, Alfredo Los círculos bolivarianos. El mito de la unidad del pueblo. Arenas, Nelly y Gómez Calcaño, Luis Lo massmediático y las sociedades contemporáneas. Un acercamiento a la relación medios-democracia. Briceño Romero, Ysabel La economía ambiental y la política ambiental. Caraballo, Leonardo Javier Veinte años de democracia en la Argentina. ¿Qué democracia? Kers, Mercedes y Leiras, Santiago C. La ciencia de la política. Bolívar ...

  7. Barry Buzan y la teoría de los complejos de seguridad.

    OpenAIRE

    Sisco Marcano, Claudia; Chacón Maldonado, Oláguer

    2007-01-01

    Presentación. Ramos Jiménez, Alfredo Los círculos bolivarianos. El mito de la unidad del pueblo. Arenas, Nelly y Gómez Calcaño, Luis Lo massmediático y las sociedades contemporáneas. Un acercamiento a la relación medios-democracia. Briceño Romero, Ysabel La economía ambiental y la política ambiental. Caraballo, Leonardo Javier Veinte años de democracia en la Argentina. ¿Qué democracia? Kers, Mercedes y Leiras, Santiago C. La ciencia de la política. Bolívar ...

  8. Rivas Leone, José Antonio: El desconcierto de la política. Los desafíos de la política democrática.

    OpenAIRE

    Herrera Zgaib, Miguel Ángel

    2007-01-01

    Presentación. Ramos Jiménez, Alfredo Los círculos bolivarianos. El mito de la unidad del pueblo. Arenas, Nelly y Gómez Calcaño, Luis Lo massmediático y las sociedades contemporáneas. Un acercamiento a la relación medios-democracia. Briceño Romero, Ysabel La economía ambiental y la política ambiental. Caraballo, Leonardo Javier Veinte años de democracia en la Argentina. ¿Qué democracia? Kers, Mercedes y Leiras, Santiago C. La ciencia de la política. Bolívar ...

  9. SAGA Cook & Chill -ruoanlaittopaperin testaaminen ravintolaympäristössä : Case: SeAMK opetusravintola Prikka

    OpenAIRE

    Keskinen, Simo

    2015-01-01

    Tutkimus käsittelee ammattikeittiöille kehitettyä SAGA Cook & Chill -ruoanlaittopaperia, jonka aihe tuli Metsä Tissuelta toimeksiantona vuonna 2013. Tutkimusajankohdaksi valittiin vuoden 2014 alku, tammi- ja helmikuun välille. Tutkimuksen tuloksia kerättiin kvalitatiivisin metodein, hyödyntäen Seinäjoen ammattikorkeakoulun tiloissa toimivaa opetusravintola Prikkaa, ruokaa valmistettaessa lounaalle. Ruokaa valmistettiin neljäntoista päivän ajan, hyödyntäen seitsemää pääruokiin suunniteltua res...

  10. Introducción

    Directory of Open Access Journals (Sweden)

    Alojz Ihan

    2001-12-01

    Full Text Available Alojz Ihan nació en Ljubljana, Eslovenia, en 1961. Es doctor en medicina, especialista en microbiología e inmunologia clínicas, y trabaja como profesor de inmunología en la Facultad de Medicina de Ljubljana. Su obra literaria comprende cinco libros de poemas: Srebrnik (La moneda de Plata, 1985, Igralci pokra (Los jugadores de póker, 1989, Pesmi (Poemas, 1989, Ritem (Ritmo, 1993 y Južno dekle (Chica del sur, 1995. Ha publicado igualmente dos novelas y dos libros de ensayos. Sus ensayos y artículos aparecen con regularidad en diarios y revistas de Eslovenia.

  11. Hotelli Cumulus Mikkelin majoitusasiakkaiden tyytyväisyys

    OpenAIRE

    Kinnunen, Jenni Ljuba

    2016-01-01

    Tämän opinnäytetyön tavoitteena on tutkia majoitusasiakkaiden tyytyväisyyttä hotelli Cumulus Mikkelissä keskittyen pääosin hotellin vastaanottoon, hotellihuoneeseen, Huviretki-ravintolaan ja aamiaiseen. Opinnäytetyön toimeksiantaja on hotelli Cumulus Mikkeli. Tässä opinnäytetyössä käytetään kvalitatiivista tutkimusmenetelmää ja tutkimusaineisto kerättiin haastattelemalla hotellin majoitusasiakkaita yksitellen kyselylomakkeen kanssa. Haastateltujen asiakkaiden määrä oli 20, joista 10 ...

  12. "Balkanski bojevnik"

    OpenAIRE

    Lampe, Špela

    2015-01-01

    Zloglasni primer »Balkanski bojevnik« je za zdaj nekoliko potihnil, vendar ne za dolgo. To je eden izmed najbolj odmevnih primerov v zgodovini Slovenije, ki je veliko pozornosti zahteval tudi mednarodno. Državno tožilstvo je 17 oseb obtožilo, da naj bi trgovali s prepovedanimi drogami (kokainom) in orožjem ter vodili in sodelovali v hudodelski združbi. 4 obtoženci so bili spoznani za krive, ostalih 13 – domnevne vodje in večje ribe – pa je bilo deležnih oprostilne sodbe, ker so jim bile v pre...

  13. Potilasohjauksen osaamisen johtaminen terveydenhuollossa : hoitotyön johtajien näkemyksiä

    OpenAIRE

    Lehtoranta, Marja

    2013-01-01

    Tutkimuksen tarkoituksena oli selvittää potilasohjauksen osaamisen johtamista käytännössä. Tutkimuksessa kuvattiin osaamisen johtamisesta erityisesti käytössä olevia potilasohjauksen rakenteita, käytäntöjä ja viestintää, potilasohjauksen osaamisen tunnistamista, kartoittamista ja mittaamista sekä osaamisen kehittämistä ja ylläpitämistä. Tutkimusaineisto kerättiin vuonna 2011 osana Keski-Suomen sairaanhoitopiirin Potilasohjaus vaikuttavaksi (PoiJu) –kehittämishanketta haastattelemalla 22 hoito...

  14. Mobiilipelin ansaintamallit ja kannattavuuslaskelmat

    OpenAIRE

    Myllymäki, Anne; Mäkinen, Jenni

    2017-01-01

    Opinnäytetyön tavoitteena oli tuottaa kattava, mutta yleishyödyllinen opas aloitteleville mobiilipeliyrittäjille. Työn avulla selvitettiin, mitkä olivat tämän hetken käytetyimmät ansaintamallit mobiilipeleissä, mitkä tekijät vaikuttivat mobiilipelin kannattavuuteen ja kuinka näihin lukuihin päästiin erilaisten ansaintamallien pohjalta. Työ toteutettiin osittain kirjallisuuskatsauksen avulla ja näitä tietoja analysoiden sekä yhdistellen tehtiin erilaisia kannattavuuslaskelmia sekä kerättii...

  15. ZAŠČITA IN VARNOST INFORMACIJSKEGA SISTEMA V HOTELU

    OpenAIRE

    Mavrin, Marko

    2016-01-01

    Razvoj informacijsko-komunikacijskih tehnologij (IKT) skozi zadnja leta v hotelskih podjetjih kaže na številne pridobitve in priložnosti za izboljšanje poslovanja ter pridobivanja konkurenčne prednosti. Vsaka noviteta s seboj prinese tudi nova varnostna tveganja in nevarnosti, na katere mora biti podjetje pripravljeno. Ker so za uspešno delovanje podjetja pomembni podatki, predvsem pa obdelava podatkov, je ključno, da ne pride do razkritja podatkov tretji osebi. Varovanje in zaščita podatkov ...

  16. Ensihoitotyön sosiaalinen kuormittavuus : – työhyvinvoinnin voimavara vai taakka?

    OpenAIRE

    Ahonen, Kaisa

    2015-01-01

    Opinnäytetyön tarkoituksena on kartoittaa ensihoitotyön sosiaalista kuormittavuutta eräässä aluepelastuslaitoksessa. Opinnäytetyön tavoitteena on tehdä tarvittavia kehittämisehdotuksia sosiaalisen kuormittavuuden hallitsemiseen organisaatiossa. Työn kuormittavuudella on suuri vaikutus työhyvinvointiin, jolla on merkitystä organisaation suorituskykyyn. Aineisto kerättiin kesäkuussa 2014 aikaisemmin kehitetyllä ja testatulla mittarilla. QPSNordic on pohjoismainen psyykkisten ja sosiaalisten...

  17. Sosiaalisen median ja moniaistisuuden hyödyntäminen Uudenmaanseudun pienyrityksissä

    OpenAIRE

    Haapaniemi, Anna

    2014-01-01

    Tämän opinnäytetyön tarkoituksena oli selvittää miten pienet yritykset voivat hyödyntää sosiaalista mediaa ja moniaistisuutta markkinoinnissaan. Opinnäytetyössä haluttiin tuoda esiin uusia mahdollisuuksia hyödyntää sosiaalista mediaa pienien resurssien avulla. Opinnäytetyö tehtiin osana Sensing Rural Cultures (SING)-hanketta. Hankkeen tavoitteena on parantaa ja tukea matkailualan pienyritysten kulttuurillisesti tärkeiden kohteiden matkailupotentiaalia. Hanke pyrkii keräämään tietoa ja mat...

  18. Ukrepanje policije v amok situaciji : diplomsko delo visokošolskega strokovnega študija Varstvoslovje

    OpenAIRE

    Cuder, Rok

    2012-01-01

    Izbruhi nemotivirane nasilnosti z uporabo orožja niso nov pojav. Ker je prvi zapisani primer takega vedenja znan z območja Indonezije, so tako obliko vedenja poimenovali amok (kar v malajščini pomeni »norost z neobvladljivo jezo«, v Indoneziji pa »besno popasti«). V širši javnosti so amok situacije postale znane ob pokolu na ameriški srednji šoli Columbine, kjer sta dva storilca pobila 13 dijakov in učiteljev, preden sta naredila samomor. Ta primer je postal mejnik v taktiki delovanja policij...

  19. Branding av en reality-tv-serie i Finland : Fallstudie Maajussille morsian

    OpenAIRE

    Rautiainen, Laura

    2016-01-01

    Mitt examensarbete handlar om reality-tv serien Maajussille morsian och dess framgång i Finland. Jag undersöker brandingens roll inom medievärlden och mer specifikt de brandingverktygen som används i lokalisering samt fenomenalisering av Maajussille morsian. Jag inleder mitt examensarbete med en teoridel som behandlar branding på en mer allmän nivå varefter jag går djupare in på brandkapitalets betydelse för succé. Förutom branding behandlar jag i teorin också fenomenet reality-tv. Som grund ...

  20. IAS 40 ur ett Nordenperspektiv : Jämförelse av regelverkets efterlevnad 2014 jämfört med 2009

    OpenAIRE

    Wigge, Gunilla

    2016-01-01

    Börsnoterade bolag ska i sin koncernredovisning redovisa enligt IFRS och förvaltningsfastigheter skall redovisas enligt IAS 40 Förvaltningsfastigheter. Detta examensarbete undersöker hur Nordiska börsnoterade bolag tillämpar vissa punkter inom IAS 40 i 2014 års redovisning jämfört med 2009 års redovisning. Syftet med undersökningen är att undersöka skillnader mellan de granskade företagens redovisning 2014 och 2009, med utgångspunkten i en tidigare publicerad undersökning (Hedlund & Ersso...

  1. Vormistatud ruumid 2010 / Kai Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Kai, 1975-

    2011-01-01

    Eesti Sisearhitektide Liidu 2010. a. preemia saanud töödest. Söögikoha interjööri preemia: kohvik Supelsaksad Pärnus (Ruth, Jaak ja Anna Huimerind), ühiskondliku interjööri preemia: ADM Interactive'i büroo Tallinnas (Tomomi Hayashi, Ahti Grünberg, Kerli Valk), ajaloolise interjööri preemia: Kihnu muuseum (Malle Jürgenson, Tea Tammelaan, Krista Lepland, Jaak Huimerind, Indrek Laos), näituse- ja installatsiooni kujunduse preemia: rändnäitus "Eesti kirjanik karikatuuris" (Janno Siimar, Kaarel Vahtramäe, Mart Lankots, Liina Jakobson), tudengipreemia - Aet Tera

  2. Parimad interjöörid: büroo, külamuuseum ja kohvik / Tiina Kolk

    Index Scriptorium Estoniae

    Kolk, Tiina

    2011-01-01

    Eesti Sisearhitektide Liit valis 2010. aasta parimad interjöörid: kohvik Supelsaksad Pärnus (Anna ja Ruth Huimerind), ADM Interactive'i bürooruumid Tallinnas (Tomomi Hayashi, Ahti Grünberg, Kerli Valk), Kihnu muuseum (Malle Jürgenson, Tea Tammelaan, Krista Lepland, Jaak Huimerind, Indrek Laos). Näituse ja installatsiooni kujunduse preemia pälvis rändnäitus "Eesti kirjanik karikatuuris" (Janno Siimar, Kaarel Vahtramäe, Mart Lankots, Liina Jakobson). Tudengipreemia pälvis Aet Tera. Nominentide tööde põhjal avati 17. mail 2011 Arhitektuuri- ja Disanigaleriis näitus

  3. Ringens disipler : hva? hvordan? hvorfor på TV? : dokumentarfilmproduksjon og analyse

    OpenAIRE

    Hagen, John Einar

    2006-01-01

    I håp om å danne bro mellom teori og praksis, består denne oppgaven av både en film og en skriftlig del. Ringens Disipler er en 25 minutter lang dokumentarfilm om fansen til Ringenes Herre. Vi følger tre utvalgte personer i billettkøen til den siste filmen i trilogien: Ringenes Herre: Atter en Konge, ved Colosseum kino i Oslo. Filmen beskriver forholdene i køen og følger fansen videre på veien mot den store premierekvelden. I den skriftlige oppgaven forsøker jeg å finne ut hva slags film Ring...

  4. ÅPEN KROPP OG LUKKET SINN: Den norske grøsserfilmen fra 2003 til 2015

    OpenAIRE

    Andresen, Christer Bakke

    2016-01-01

    Sammendrag av avhandlingen Det begynte med De dødes tjern i 1958, men så skulle det gå mange tiår før Norge fikk sin egen bølge av skrekkfilm etter årtusenskiftet. Avhandlingen diskuterer hvorfor og hvordan skrekkfilmen blir en vanlig sjanger i norsk film etter 2000. Blant svarene finnes en politisk styrt orientering mot mer kommersiell film, liberalisering av sensurordningen, og en økende sjangerkompetanse hos filmskapere og publikum. Andresen undersøker hvilken form den norske skrek...

  5. RFID:n käyttö huoltotöiden seuraamisessa

    OpenAIRE

    Penttilä, Annika

    2015-01-01

    RFID on teknologia, joka mahdollistaa esineiden ja henkilöiden tunnistamisen langattomasti. Teknologiaa on käytetty jo vuodesta 1935 asti ja tällä hetkellä sen käyttö on yleistymässä logistiikan ja kaupallisen alan apuvälineenä ja tehostamiskeinona. Tämän työn tarkoitus oli tutustua RFID-teknologiaan ja sen tuomiin etuihin. Työssä verrattiin RFID-teknologiaa samankaltaisiin muihin järjestelmiin. Työssä kerättiin tietoa ja selvitettiin, kuinka huoltoyritys mcare Oy voisi kehittää ja tehost...

  6. Työntekijä aktiivisena työhyvinvoinnin edistäjänä tulkkauspalveluyrityksessä

    OpenAIRE

    Pakkala, Pigga-Maiju

    2013-01-01

    Kehittämistyön tilaajana oli Viittomakielialan Osuuskunta Via. Työn tavoitteena oli selvittää Viittomakielialan Osuuskunta Vian kuukausipalkkaisten tulkkien työhyvinvoinnin tekijöitä ja miten työntekijä itse pystyy aktiivisesti edistämään omaa ja työyhteisön hyvinvointia. Kehittämistyö toteutettiin yrityksen työhyvinvointihankkeessa keräten aineistoa samanaikaisesti hankkeelle kuin kehittämistyölle. Kehittämistyön menetelmänä oli realistinen evaluaatio, tarkemmin sanottuna prosessievaluaa...

  7. Markkinointiviestintäsuunnitelma : Case: Matkailijan Rokotusklinikka

    OpenAIRE

    Kautonen, Veera

    2012-01-01

    Tämän työn aiheena on markkinointi ja markkinointiviestinnän suunnitteleminen. Työ on toteutettu yhteistyössä matkailijan Rokotusklinikan kanssa. Opinnäytetyön tarkoituksena on tukea yritystä markkinoinnin aloittamisessa. Työn teoreettisessa viitekehyksessä käsitellään markkinoinnin kilpailukeinoja, markkinointiviestinnän merkitystä yritykselle sekä mitä asioita tulee ottaa huomi-oon markkinointiviestintäsuunnitelmaa luodessa. Työn teoreettiseen pohjaan on kerätty erilaisia kirjallisia s...

  8. Mainosvideot Popot Sneaker Storelle

    OpenAIRE

    Perttilä, Miika

    2012-01-01

    Toiminnallisen opinnäytetyön tavoitteena oli tehdä Popot Sneaker Storea hyödyttäviä käytännön markkinoinnin toimenpiteitä tulevaisuuden markkinoinnin kanavassa. Popot Snea-ker Store on retrourheilukenkiä myyvä pieni yritys Helsingin Punavuoressa, joka on menestynyt hyvin aktiivisen markkinoinnin avulla. Tarkoitus oli jatkaa Popot Sneaker Storen aktiivista linjaa markkinoinnissa online-videomarkkinoinnin keinoin. Online-videomarkkinointi valikoitui toimintatavaksi sen vuoksi, että se on mu...

  9. Inventarium: Medier og maskiner hos Henrich von Kleist

    OpenAIRE

    Jacobsen, Yngve Sandhei

    2002-01-01

    Litteraturen fra begynnelsen av 1800-tallet har ofte blitt lest som en ganske enkel flukt fra det moderne livets kompleksitet i retning av den skjønne kunsten, naturen og sjelen. Gjennom besjelingen av en ytre natur og fordypingen i egen inderlighet forsøker den romantiske dikteren visstnok å gjenreise en enhet som er i ferd med å gå tapt. Tegnene på den industrielle revolusjon kommer dermed til uttrykk i et slags negativformat: Ikke gjennom hva hvert enkelt diktverk sier, men gjennom hva det...

  10. Yritysideasta yritykseksi

    OpenAIRE

    Kolmonen, Kimmo

    2013-01-01

    Tämä opinnäytetyö on uudenlainen portfolio-opinnäytetyö, missä opiskelija kerää opintojaksoilla, harjoittelun sekä opiskelijavaihdon yhteydessä tehtyjä tuotoksia eli projekti- tai muita oppimistehtäviä yhteen ja laatii niiden pohjalta kokoavan raportin, jonka liitteeksi tulevat tuotokset. Tämä opinnäytetyö käsittelee liiketoiminnan käynnistämisen prosessia käytännön esimerkin kautta. Opinnäytetyössä seurattava yritys on Personal Digiguide. Personal Digiguide -yrityksen yritysideana on tar...

  11. Uporaba digitalnega marketinga v podjetju jagros, d. o. o.

    OpenAIRE

    Šek, Urška

    2017-01-01

    V svetu sodobne tehnologije nastajajo nove oblike medijev in podjetja morajo uporabljati digitalne medije, saj jim ti omogočajo lažje komuniciranje s svojimi odjemalci. Podjetja lahko izbirajo med različnimi načini družbenih omrežij ter tako ugotovijo, kateri način je najprimernejši. Digitalni marketing je način, ki je izbruhnil v svet tehnologije. Predstavlja gospodarski razcvet, saj so tradicionalne marketinške metode postale manj dobičkonosne, ker so ostale v večini omejene le na standa...

  12. The associative memory system for the FTK processor at ATLAS

    CERN Document Server

    Magalotti, D; The ATLAS collaboration; Donati, S; Luciano, P; Piendibene, M; Giannetti, P; Lanza, A; Verzellesi, G; Sakellariou, Andreas; Billereau, W; Combe, J M

    2014-01-01

    In high energy physics experiments, the most interesting processes are very rare and hidden in an extremely large level of background. As the experiment complexity, accelerator backgrounds, and instantaneous luminosity increase, more effective and accurate data selection techniques are needed. The Fast TracKer processor (FTK) is a real time tracking processor designed for the ATLAS trigger upgrade. The FTK core is the Associative Memory system. It provides massive computing power to minimize the processing time of complex tracking algorithms executed online. This paper reports on the results and performance of a new prototype of Associative Memory system.

  13. PRIMERJAVA MED POPOLDANSKIM IN NAVADNIM SAMOSTOJNIM PODJETNIKOM

    OpenAIRE

    Kavaš, Anita

    2012-01-01

    Svetovna gospodarska kriza je kriva, da v zadnjem času propada veliko število podjetij. Posledica tega je velika stopnja brezposelnosti. Nekateri posamezniki so tako prisiljeni ustanoviti svojo podjetje, spet drugi začutijo priložnost, ki se ponudi na trgu ob umiku prejšnjih podjetij za nove poslovne poti. Zaradi zgoraj naštetega je v porastu ustanavljanje osnovne oblike samozaposlitve – samostojnega podjetnika. Ker se ravno v tem času odražajo rezultati večletne recesije in je na trgu prese...

  14. Upravljanje in ravnanje s človeškimi viri v logistiki Slovenske vojske : magistrsko delo

    OpenAIRE

    Žižek, Martin

    2010-01-01

    Upravljanje s človeškimi viri (HRM — Human resource management) je zelo pomemben segment delovanja vsake organizacije. Zanemarjanje tega pomembnega segmenta delovanja lahko odločilno vpliva na zadovoljstvo zaposlenih pri delu in posledično na rezultate organizacije. Ker pa organizacijo vodijo ljudje, je treba omogočiti dobre delovne pogoje in tako pri zaposlenih ustvariti zadovoljstvo pri delu in jim vzbuditi občutek pripadnosti. Ravnanje s človeškimi viri je proces, ki zaje...

  15. Formation of inner-shell autoionizing CO+ states below the CO2+ threshold

    International Nuclear Information System (INIS)

    Osipov, T.; Weber, Th.; Rescigno, T. N.; Lee, S. Y.; Schoeffler, M.; Belkacem, A.; Orel, A. E.; Sturm, F. P.; Schoessler, S.; Lenz, U.; Havermeier, T.; Kuehnel, M.; Jahnke, T.; Doerner, R.; Williams, J. B.; Landers, A.; Ray, D.

    2010-01-01

    We report a kinematically complete experiment on the production of CO + autoionizing states following photoionization of carbon monoxide below its vertical double-ionization threshold. Momentum imaging spectroscopy is used to measure the energies and body-frame angular distributions of both photo- and autoionization electrons, as well as the kinetic energy release (KER) of the atomic ions. These data, in combination with ab initio theoretical calculations, provide insight into the nature of the cation states produced and their subsequent dissociation into autoionizing atomic (O * ) fragments.

  16. Formation of inner-shell autoionizing CO+ states below the CO2+ threshold

    Science.gov (United States)

    Osipov, T.; Weber, Th.; Rescigno, T. N.; Lee, S. Y.; Orel, A. E.; Schöffler, M.; Sturm, F. P.; Schössler, S.; Lenz, U.; Havermeier, T.; Kühnel, M.; Jahnke, T.; Williams, J. B.; Ray, D.; Landers, A.; Dörner, R.; Belkacem, A.

    2010-01-01

    We report a kinematically complete experiment on the production of CO+ autoionizing states following photoionization of carbon monoxide below its vertical double-ionization threshold. Momentum imaging spectroscopy is used to measure the energies and body-frame angular distributions of both photo- and autoionization electrons, as well as the kinetic energy release (KER) of the atomic ions. These data, in combination with ab initio theoretical calculations, provide insight into the nature of the cation states produced and their subsequent dissociation into autoionizing atomic (O*) fragments.

  17. RAČUNOVODSKI VIDIK ODKRIVANJA LATENTNE KRIZE V PODJETJU

    OpenAIRE

    Tomazin, Saša

    2010-01-01

    Razmere na trgu se iz dneva v dan spreminjajo, zato morajo biti podjetja fleksibilna v smislu prilagajanja in pozitivnega koriščenja sprememb. Ravno iz teh vzrokov lahko trdimo, da so podjetja neprestano v stanju potencialne krize. Latentna kriza pa prestavlja korak naprej, saj se že kažejo krizni simptomi v družbi, vendar jih vodstvo ne zazna, jih zanika ali nima informacij. O prikriti krizi govorimo torej tudi v primeru, če management pozna krizno situacijo, vendar ne ukrepa, ker so težave ...

  18. PODATKOVNE STORITVE ADO.NET IN ADO.NET ENTITY FRAMEWORK

    OpenAIRE

    Volavc, Franc

    2012-01-01

    V diplomskem delu smo predstavili Microsoftovi ogrodji ADO.NET in ADO.NET Entity Framework. Preučili in analizirali smo metode za dostop do podatkovnih virov, ki jih ponujata ogrodji, ter nato te ugotovitve preslikati v odločitveno drevo, katero bo programerjem in razvijalcem informacijskih sistemov pomagalo pri odločanju glede pristopa za dostop do podatkovnih virov. Ker bomo v diplomskem delu predstavili Microsoftovi ogrodji, bomo posledično omejeni zgolj na Microsoftovo tehnologijo, se pra...

  19. Intelligensoppfatning, kjønn, og kognitiv refleksjon

    OpenAIRE

    Lien, Andreas

    2015-01-01

    Tema og problemstilling: Oppgaven undersøker forholdet mellom intelligensoppfatninger og kognitiv refleksjon, og hvorvidt kognitiv refleksjon kan styrkes ved å fremme et formbart syn på intelligens. Spesielt er det et mål å se om det er mulig å gjøre dette ved å bruke enkle instruksjoner som er i samsvar med intelligensoppfatninger. Oppgavens problemstilling er:: I hvilken grad kan man påvirke oppgaveløsning som krever kognitive refleksjon hos studenter ved bruk av enkle instruksjoner som ret...

  20. Kognitiv pragmatikk og relevansteori

    OpenAIRE

    Falkum, Ingrid Lossius; Kjøll, Georg

    2014-01-01

    Pragmatikk som fagfelt kan defineres som studier av språk i bruk, og kan i sin videste form omfatte undersøkelser av både kognitive, sosiale og kulturelle aspekter ved kommunikasjon (Verschueren et al. 1995: 2). Kognitiv pragmatikk er, som navnet antyder, den undergrenen av pragmatikken som søker å forstå hvordan kommunikasjon oppstår på bakgrunn av menneskets kognitive og språklige evner. Mens sosiopragmatikken vil være opptatt av å undersøke fenomener som høflighet, sosiale roller, makt og ...

  1. PSIHOLOŠKI UČINKI MOČI

    OpenAIRE

    Ropert, Tadevž

    2015-01-01

    V zadnjem desetletju je v socialni psihologiji opazen izjemen porast raziskav o moči, zlasti o njenih številnih psiholoških učinkih. Pričujoče magistrsko delo v ospredje postavlja vpliv moči na neetično vedenje, ki je po dosedanjih ugotovitvah kompleksen in vsebuje več moderatorjev. Ker je nedavna raziskava pokazala, da del dneva vpliva na pojavnost neetičnega vedenja (Kouchaki in Smith, 2014), tj., da se pojavi učinek jutranje moralnosti, smo poskusili ugotovitve obeh področij integrirati. N...

  2. Icosahedral cationic framework in the structures of MR2F7 fluorides

    International Nuclear Information System (INIS)

    Golubev, A.M.; Maksimov, B.A.; Rastsvetaeva, R.K.

    1997-01-01

    Cationic icosahedral frame formed by BiCs 6 Bi 6 icosahedrons is detected in C 5 Bi 2 F 7 structure. Similarity of cationic motives of CsBi 2 F 7 and β-KEr 2 F 7 structure types is determined, occurrence of a similar motive in RbEr 2 F 7 structure is assumed. Cationic motives of MR 2 F 7 fluorides (R=Y, Ln) are studied and dependence of cationic frame type on the ratio of metal ion radii is shown using KLn 2 F 7 fluorides as an example. 12 refs.; 4 figs.; 1 tab

  3. Spolno nadlegovanje v slovenski policiji

    OpenAIRE

    Kmetič, Andreja

    2017-01-01

    V magistrski nalogi, ki je pred nami, obravnavamo spolno nadlegovanje v slovenski policiji. Ker se tematika magistrske naloge osredotoča predvsem na delovanje policije, smo velik del posvetili teoretični razlagi. Pomembno vprašanje nam je predstavljal zgodovinski začetek samega spolnega nadlegovanja, saj nas je zanimalo, kdaj se je o tem sploh začelo govoriti oziroma pisati. S pomočjo različnih avtorjev smo definirali pomen spolnega nadlegovanja in ugotovili, da gre v večini primerov za o...

  4. Vähittäiskaupan hyllytystehokkuuden kehittäminen

    OpenAIRE

    Kiviniemi, Katja

    2015-01-01

    Tämä opinnäytetyö on kehitystyö. Kohdeyrityksenä on Pirkanmaan Osuuskauppa. Tämän opinnäytetyön tarkoituksena oli selvittää vähittäiskaupan hyllytystehokkuutta ja luoda hyllytystehokkuusmittari tuloskorttiin. Työn teoriaosuus käsittelee vähittäiskaupan hyllytystä ja tuloskorttia. Hyllytystehokkuusmittaria varten selvitettiin kaupan eri palveluiden, kuten palvelutiskin, pankin, postin ja keräilyn työajat, kokonaistunnit, rahastustunnit, sekä myydyt kappaleet. Hyllytystehokkuusmittari on t...

  5. Mustialan maanviljelysopiston ja sen lähiympäristön vanhojen omenapuiden kulttuurinen ja geneettinen monimuotoisuus

    OpenAIRE

    Ahinko, Heli

    2016-01-01

    Luonnonvarakeskuksen (Luke) Nurkkapuuhanke käynnistettiin tammikuussa 2012 keräämään ja täydentämään tarhaomenan paikallislajikkeisiin liittyvää tietoa. Opinnäytetyö on osa Nurkkapuuhanketta ja sen toimeksiantajana toimii Luonnonvarakeskus. Opinnäytetyön tavoitteena oli löytää ja tunnistaa Tammelan kunnassa sijaitsevan Mustialan entisen Maanviljelysopiston, nykyisen Hämeen ammattikorkeakoulun (HAMK) Mustialan yksikön- sekä sen lähialueella kasvavat vanhat omenapuut. Omenapuiden tunteminen mah...

  6. Implementering av BIM i bærekraftig oppgradering av bygninger: Mulighetsstudie for utføring av tilstandsanalyser med nettbrett

    OpenAIRE

    Vik, Vidar Samson

    2012-01-01

    Vi opplever i dag en økt hyppighet av klimakatastrofer som flom og tørke som følge av økt konsentrasjon av klimagasser i atmosfæren. Dette har ført til et behov for å redusere klimagassutslippene fra industrien på jorden. Byggebransjen, ofte kalt 40 % -bransjen, står for om lag 40 % av klimagassutslippene, og har dermed et stort potensial for reduksjon. BIM er en prosess som søker å redusere ressursbruken, og er dermed en bærekraftig prosess som har blitt tatt i bruk i stor skala i nybygg. Re...

  7. Naisten tekemä väkivalta

    OpenAIRE

    Lattu, Emmi

    2016-01-01

    Tutkimuksessa tarkastellaan naisten tekemää fyysistä väkivaltaa. Aineistona on haastattelut vankeusrangaistusta väkivaltarikoksesta suorittaville vangeille sekä perheneuvolan asiakkaille, joilla on väkivaltakäyttäytymistä. Toisen aineistokokonaisuuden muodostaa väkivaltaa tehdeiden naisten kirjoitukset, joita keräsin lehti-ilmoitusten kautta. Tarkempana tutkimuskohteena ovat naisten tavat oikeuttaa väkivaltaansa, naisten väkivaltaan liittämät tunteet ja naisten tavat pyrkiä irrottautumaa...

  8. Osallistumisen ja vaikuttamisen tapaa etsimässä : tarkastelun kohteena Pihlajamäen Kehittämismaraton -toiminta

    OpenAIRE

    Heino-Mouhu, Sini

    2013-01-01

    Opinnäytetyö tarkastelee Pihlajamäessä toteutettua asukkaiden lähidemokratiaa vahvistavaa Kehittämismaraton -toimintaa. Tavoitteena oli kerätä tietoa siitä, mitä osallistumista edistäviä ja estäviä tekijöitä maratontoiminnan aikana nousi esiin ja mitä mahdollisia kehittämisehdotuksia asukkailla oli toiminnan suhteen. Tutkimuskohteen taustailmiönä on kansalaisten osallistumis- ja vaikuttamistapojen kehityssuuntaukset. Aihetta pohjustetaan kansalaisosallisuuden käsitteistöllä sekä viimeaikaisel...

  9. CLT:n ominaisuudet ja käyttö rakennusmateriaalina

    OpenAIRE

    Pulkkinen, Hanna-Liisa

    2016-01-01

    Opinnäytetyössä käsitellään CLT:n ominaisuuksia ja käyttöä rakennusmateriaalina. CLT muodostuu sanoista Cross Laminated Timber, joka tarkoittaa ristiinliimatuista puulevykerroksista valmistettua puulevyä. CLT-levyistä on jatkojalostettu CLT-elementtejä ja CLT-rakentamisesta on tullut jo yksi suosituimmista rakennusmenetelmistä Keski-Euroopassa. Suomessa CLT-rakentaminen on vielä melko harvinaista. Opinnäytetyössä tavoitteena oli kerätä CLT:stä ja CLT-rakentamisesta jo olemassa oleva tieto ja ...

  10. CLT-rakentaminen

    OpenAIRE

    Kekäläinen, Reeta

    2015-01-01

    Opinnäytetyöni käsittelee CLT rakentamista kaikissa eri vaiheissa. CLT koostuu ristikkäin liimatuista lamelli- eli puulevykerroksista. Olen tutkinut CLT:n valmistamista ja tutustunut Suomen ensimmäiseen CLT-levytehtaaseen, joka sijaitsee Kemissä Ammattiopisto Lappian tiloissa. Opinnäytetyön tarkoituksena oli kerätä kattava tietopaketti CLT:stä eli ristiinliimatusta puusta (Cross laminated timber), koska rakennustapana se on vielä melko uusi ja Suomessa harvinainen. Lisäksi työssä esitellään u...

  11. Management poslovnih procesov in sodobni poslovni modeli v oskrbovalnih verigah

    OpenAIRE

    Jakl, Tim

    2016-01-01

    Management oskrbovalnih verig (MOV) postaja vse pomembnejši oddelek uspešnih organizacij. MOV pridobiva na pomenu zaradi organizacij, ki več ne tekmujejo na ravni posameznih entitet, ampak v sklopu večjega števila podjetij – oskrbovalnih verig. Ker z oskrbovalnimi verigami običajno razumemo skupino podjetij, na čelu s proizvajalcem dobrin, smo se v magistrski nalogi odločili preučiti manj raziskano področje, t.j. management storitvenih oskrbovalnih verig. Pri tem se osredotočamo na njihove po...

  12. IZBOLJŠANJE MANAGEMENTSKEGA VODENJA V JAVNEM ZAVODU SPLOŠNE BOLNIŠNICE MURSKA SOBOTA

    OpenAIRE

    Maček, Ines

    2015-01-01

    Za magistrsko nalogo z naslovom Izboljšanje managementskega vodenja v javnem zavodu Splošne bolnišnice Murska Sobota smo se odločili, ker menimo, da uspešnost javnega zavoda ni odvisna samo od spretnega vodstva, ampak predvsem od dobrega sodelovanja in komuniciranja na različnih organizacijskih ravneh javnega zavoda. Zaposleni v javnem zavodu morajo nenehno sodelovati in komunicirati med seboj in tudi s svojimi nadrejenimi, le-ti pa morajo tesno sodelovati z vodstvom. Javni zavod brez komu...

  13. Vastaanottovirkailijoiden kokemukset turvallisuudesta

    OpenAIRE

    Niemistö, Niina

    2016-01-01

    Tämän opinnäytetyön tarkoituksena oli selvittää, mitkä tekijät vaikuttavat hotellin vastaanoton turvallisuuteen sekä vastaanottovirkailijoiden kokemuksiin turvallisuuden tunteesta. Toimeksiantaja työlläni on hotelli Scandic Lahti. Opinnäytetyön tietoperustassa käsitellään turvallisuutta ja turvattomuutta käsitteenä, sekä tarkastellaan majoitusturvallisuutta käyttäen jo aikaisempaa tutkimusta valtakunnallisesta turvallisuuskyselystä. Opinnäytetyön selvitysaineisto kerättiin helmikuussa 2...

  14. PRIPOVEDNIŠTVO JOŽETA KERENČIČA

    OpenAIRE

    Mohorko, Laura

    2015-01-01

    Pripovedna proza Jožeta Kerenčiča je bila zaradi ideoloških vzgibov in njegovega političnega predvojnega delovanja skozi desetletja skorajda neraziskana, po osamosvojitvi Slovenije pa v večji meri prezrta. Ker je obravnavani avtor eden izmed manj vidnih predstavnikov socialnega realizma, se je njegovim proznim delom posvetilo bore malo literarnih zgodovinarjev. Jože Kerenčič je v obdobju med vojnama bil izjemno aktiven klicatelj revolucije in vstajniški govornik v vzhodnoštajerskem prostoru. ...

  15. Analitična primerjava filmskih žanrov pri spremembi stilističnih elementov medija

    OpenAIRE

    Kompare, Rok

    2017-01-01

    Filmi dandanes predstavljajo velik del zabavne industrije. Ker so ljudje različni, so jim posledično všeč različni filmi, različne filmske zvrsti oziroma filmski žanri. Le te se nanašajo na strukturo stilističnih in narativnih elementov, ki gradijo filmsko formo medija. Kot primeri so: drama, akcija, grozljivka, komedija, znanstvena fantastika itd. Problem, s katerim se srečujejo režiserji je, kako in na kakšen način uprizoriti posamezno zgodbo, s katero tehniko pristopiti, kakšne barve upora...

  16. Mixed municipal solid waste (MSW) treatment in Waste centre Spodnji Stari Grad, Krško

    OpenAIRE

    Kortnik, Jože; Leskovar, Jože

    2015-01-01

    Review paper Received: October 25, 2013 Accepted: November 7, 2013 Mixed municipal solid waste (MSW) treatment in Waste centre Spodnji Stari Grad, Krško Ravnanje z mešanimi komunalnimi odpadki v Zbirnem centru Spodnji Stari Grad, Krško Jože Kortnik1'*, Jože Leskovar2 University of Ljubljana, Faculty of Natural Sciences and Engineering, Department of Mining and Geotechnology, Aškerčeva 12, 1000 Ljubljana, Slovenia 2Kostak, d. d., Leskovška cesta 2a, 8270 Krško, Slovenia Correspo...

  17. Temperature dependence of the photodissociation of CO2 from high vibrational levels: 205-230 nm imaging studies of CO(X1Σ+) and O(3P, 1D) products

    Science.gov (United States)

    Sutradhar, S.; Samanta, B. R.; Samanta, A. K.; Reisler, H.

    2017-07-01

    The 205-230 nm photodissociation of vibrationally excited CO2 at temperatures up to 1800 K was studied using Resonance Enhanced Multiphoton Ionization (REMPI) and time-sliced Velocity Map Imaging (VMI). CO2 molecules seeded in He were heated in an SiC tube attached to a pulsed valve and supersonically expanded to create a molecular beam of rotationally cooled but vibrationally hot CO2. Photodissociation was observed from vibrationally excited CO2 with internal energies up to about 20 000 cm-1, and CO(X1Σ+), O(3P), and O(1D) products were detected by REMPI. The large enhancement in the absorption cross section with increasing CO2 vibrational excitation made this investigation feasible. The internal energies of heated CO2 molecules that absorbed 230 nm radiation were estimated from the kinetic energy release (KER) distributions of CO(X1Σ+) products in v″ = 0. At 230 nm, CO2 needs to have at least 4000 cm-1 of rovibrational energy to absorb the UV radiation and produce CO(X1Σ+) + O(3P). CO2 internal energies in excess of 16 000 cm-1 were confirmed by observing O(1D) products. It is likely that initial absorption from levels with high bending excitation accesses both the A1B2 and B1A2 states, explaining the nearly isotropic angular distributions of the products. CO(X1Σ+) product internal energies were estimated from REMPI spectroscopy, and the KER distributions of the CO(X1Σ+), O(3P), and O(1D) products were obtained by VMI. The CO product internal energy distributions change with increasing CO2 temperature, suggesting that more than one dynamical pathway is involved when the internal energy of CO2 (and the corresponding available energy) increases. The KER distributions of O(1D) and O(3P) show broad internal energy distributions in the CO(X1Σ+) cofragment, extending up to the maximum allowed by energy but peaking at low KER values. Although not all the observations can be explained at this time, with the aid of available theoretical studies of CO2 VUV

  18. Harry Potter -kirjojen suomennoksissa käytetyt uudissanat.

    OpenAIRE

    Karppinen, Hanna

    2003-01-01

    Tutkielman pääasiallinen tarkoitus on kuvata Harry Potter -kirjojen suomennoksissa käytettyjä uudissanoja ja käsitellä uudissanojen teoriaa. Myös lastenkirjallisuudesta, lasten lukemisesta, käännöstieteestä ja Harry Potter -ilmiöstä on kerrottu sen verran, että aihetta ennestään tuntemattomien on mahdollista seurata tutkielmaa. Tutkittavat sanat on kerätty kirjoista Harry Potter ja viisasten kivi, Harry Potter ja salaisuuksien kammio, Harry Potter ja Azkabanin vanki ja Harry Potter ja li...

  19. Uveljavljanje trendov digitalizacije v podjetjih - Industrija 4.0

    OpenAIRE

    Belej, Klemen

    2016-01-01

    V diplomskem delu smo predstavili digitalizacijo v podjetjih in opredelili manj znan pojem Industrijo 4.0. Opisali smo koncept Industrije 4.0, prikazali razvoj industrijskih revolucij in predstavili novejše tehnologije, ki se pojavljajo v podjetjih kot so: big data, internet stvari, aditivna tehnologija, razširjena resničnost... Podrobneje so predstavljeni kolaborativni roboti, ki lahko sodelujejo s človekom. Pojasnili smo tudi vlogo vitke proizvodnje v Industriji 4.0. Ker je v podjetjih kon...

  20. TAKKALUUKKUKONSEPTI PALLON MUOTOISEEN TAKKAAN

    OpenAIRE

    Paatero, Mesimarja

    2009-01-01

    Tuotemuotoilun opinnäytetyönä suunniteltiin keksijä Mauno Kososen pallon muotoiseen takkaan yksi toimiva, hyvin muotoiltu ja perusteltu ehdotus takkaluukuksi. Työ käsittää takkaluukun kehyksen, vetimen, lasin kehyksen, ilmansäätömekaniikan, avausmekanismin ja tuhkaluukun sekä sen vetimen konseptuaalisen suunnittelun. Takkaluukkuja on tutkittu sekä muotoilullisesta että teknisestä näkökulmasta, tutustuttu niiden malleihin ja kerätty tietoa eri ratkaisuista, havainnoimalla ja dokumentoima...

  1. Avoimen lähdekoodin alustojen sopivuus älykotiin

    OpenAIRE

    Liimatainen, Janne

    2017-01-01

    Internet of Things kasvaa jatkuvasti ja sen eräs suurimmista sovelluskohteista on älykoti. IoT:n ongelmana on kuitenkin ollut keskimäärin erittäin huono tietoturva ja tämä on heijastunut myös älykoteihin esimerkiksi hakkeroituina kameroina ja itkuhälyttiminä. Toinen, älykodissa erityisen suuri ongelma on kerätyn tiedon yksityisyys. Tässä tutkielmassa kartoitetaan, kuinka hyvin avoimen lähdekoodin ohjelmistot soveltuvat toimivan ja turvallisen älykodin toteuttamiseen. Turvallisuuden osalta pai...

  2. Psykisk helsearbeid på internett: konsekvenser for normalitets- og identitetsdannelse hos ungdom

    OpenAIRE

    Anders Johan W. Andersen; Tommy Svensson

    2011-01-01

    Psykisk helsearbeid på internett øker i omfang, og verdsettes på grunn av bekvemmelighet, lave kostnader og muligheter for anonymitet. Artikkelen bygger på en kartlegging av norske og svenske nettbaserte eposttjenester for ungdom og unge voksne, og viser at det var 24 nettsteder som tilbød slike tjenester i 2009. Tjenestene hadde opphav i både offentlig og frivillig sektor. Flesteparten av sidene fra offentlig sektor tok utgangspunkt i eksisterende tjenestetilbud, og var en videreutvikling av...

  3. Uuden ja modernin business mallin kehittäminen kiinteistönvälitysyhtiölle

    OpenAIRE

    Virtanen, Sini

    2017-01-01

    Tässä opinnäytetyössä tehdään liiketoimintasuunnitelma uudelle kiinteistönvälitysalan yritykselle. Opinnäytetyön tarkoituksena on luoda liiketoimintasuunnitelma siten, että yrityksen kiinteät kustannukset ovat mahdollisimman alhaiset. Tässä toiminnallisessa opinnäytetyössä on kaksi pääosaa. Toinen pääosista koostuu viitekehyksestä ja toinen osa sisältää konkreettisen liiketoimintasuunnitelman. Alkuun kuvailen kiinteistönvälitysalaa yleisesti ja varsinaisessa teoriaosuudessa ker-ron,...

  4. Keuhkoahtaumatautiin sairastuneiden elämänlaatuun vaikuttavia tekijöitä

    OpenAIRE

    Vornila, Karita

    2012-01-01

    Tämän opinnäytetyön tarkoituksena oli kartoittaa elämänlaatuun vaikuttavia tekijöitä keuh-koahtaumatautiin sairastuneilta. Opinnäytetyön tavoitteena oli lisätä tietoisuutta keuhkoahtaumatautia sairastavan potilaan elämänlaatuun vaikuttavista tekijöistä. Tietoa opinnäytetyöntekijä keräsi Hengitysliitto Heli ry:n internet-sivuille avatun keskustelualustan avulla. Hengitysliitto on sosiaali- ja terveysalan järjestö, jonka tarkoituksena on edistää muun muassa hengityssairaan hyvää elämää. Keskus...

  5. Analiza poslovnega okolja Nemčije in ZDA

    OpenAIRE

    Podlesnik, Mitja

    2017-01-01

    V diplomskem projektu predstavljamo in primerjamo poslovno okolje dveh držav, ZDA in Nemčije. Na eni strani ZDA kot ena izmed največjih svetovnih velesil v gospodarstvu in tudi v ostalih dejavnikih, na drugi strani pa Nemčija kot največja gonilna sila gospodarstva v Evropi. Ker je globalizacija vedno bolj občutna in v porastu, zraven pa je še velik razcvet digitalne tehnologije, praktično mej v gospodarstvu več ni. Vedno več podjetij širi in posluje izven svojih domačih meja v želji po prepoz...

  6. Metodologija analize stroškov in koristi za investicije v prometno infrastrukturo na osnovi Poročila vplivov na okolje

    OpenAIRE

    Podvornik, Nina

    2016-01-01

    Povečane potrebe po prometnem omrežju vodijo k dodatnim prometnim investicijam, ki so ne glede na njihov obseg, postavitev v prostor ter učinkovitost pomemben dejavnik gospodarskega razvoja. Investicije v prometno infrastrukturo lahko na sam razvoj vplivajo pozitivno (dvig gospodarske rasti, kakovost življenja, dostopnost idr.) in tudi negativno (različni vplivi na okolje). Ker so prometne investicije zelo obsežne, je vsestranska ocena le-teh ključnega pomena pri samem prometnem načrtovanju v...

  7. Päivystyspoliklinikan hoitohenkilökunnan kokemuksia simulaatiokoulutuksesta

    OpenAIRE

    Ahopelto, Eeva; Järvinen, Erika; Kauppila, Anne

    2011-01-01

    Opinnäytetyön tavoitteena oli tuottaa tietoa simulaatiokoulutukseen osallistuneiden kokemuksista koulutuksesta, sekä määritellä koulutuksen kehittämishaasteita. Opinnäytetyön tarkoituksena oli kuvata hoitohenkilökunnan kokemuksia simulaatiokoulutuksesta. Tämän määrällisenä tutkimuksena tehdyn opinnäytetyön aineistonkeruu menetelmänä käytettiin strukturoitua kyselylomaketta, jossa oli myös kaksi avointa kysymystä. Aineisto kerättiin Webropol kyselyllä, jonka linkki lähetettiin vastaajille ...

  8. Oblikovanje in izdelava embalaže za nakit Katja Koselj Jewellery

    OpenAIRE

    Gregorka, Nika

    2017-01-01

    Dandanes je vloga videza embalaže vedno pomembnejša in je zato eden izmed bistvenih elementov pri darilni embalaži. Ker embalaža s svojo podobo izraža tudi kakovost izdelka, je le-ta včasih še pomembnejša kot izdelek, ki ga predstavlja. Potemtakem je pomembno, da je kakovostna, preprosta, koristna in okolju prijazna. V diplomskem delu smo predstavili izdelavo in načrtovanje embalaže za slovenski ročno izdelani nakit oblikovalke Katje Koselj. V pregledu literature smo opisali pojem embalaže, n...

  9. ”Rakastava ja fiksu ihminen ja se keittää aina hyvät kahvit” : Yhteisöllinen valokuvaprojekti kehitysvammaisten ohjatun asumisen kodissa

    OpenAIRE

    Saarinen, Kirsi

    2013-01-01

    Opinnäytetyön tavoitteena oli toteuttaa kehitysvammaisten aikuisten ohjatun asumisen yksikössä Puistokodissa sen yhteisöllisyyttä ja viihtyisyyttä tukeva valokuvaprojekti. Projektin aikana kerätyn tutkimusaineiston avulla haluttiin lisäksi tuottaa tietoa valokuvatyöskentelyn toimivuudesta ja siihen liittyvistä hyvistä käytännöistä Puistokodin asukkaiden hyvinvoinnin tukemiseksi mahdollisesti myös tulevaisuudessa. Asukkaat osallistuivat valokuvaprojektin aikana kuuteen ryhmätapaamise...

  10. Urheilu- ja ulkoilusukat : tietopaketti vaatetusfysiologisista lähtökohdista

    OpenAIRE

    Lindberg, Iina

    2015-01-01

    Opinnäytetyöni tavoitteena oli tehdä tietopaketti urheilu- ja ulkoilusukista vaatetusfysiologisista lähtökohdista. Tietopaketti on suunnattu alan opiskelijoille ja yrityksille. Tietopaketin on tarkoitus toimia perehdyttämisen työvälineenä, jonka avulla uusi työntekijä tai opiskelija saa perusymmärryksen aihealueesta. Päädyin tutkimaan aihealuetta yhteistyöyrityksen Vokant Management Oy:n ehdotuksesta. Opinnäytetyöni on kvalitatiivinen aineistopohjainen tutkimus. Tutustuin ja keräsin tieto...

  11. ATCA-based ATLAS FTK input interface system

    CERN Document Server

    Okumura, Y; The ATLAS collaboration; Olsen, J; Iizawa, T; Mitani, T; Korikawa, T; Yorita, K; Annovi, A; Beretta, M; Gatta, M; Sotiropoulou, C; Gkaitatzis, S; Kordas, K; Kimura, N; Cremonesi, M; Yin, H; Xu, Z

    2014-01-01

    The first stage of the ATLAS Fast TracKer (FTK) is an ATCA-based input interface system, where hits from the entire silicon tracker must be clustered and organized into overlapping eta-phi trigger towers before being sent to the tracking processors. First, FTK Input Mezzanine cards receive hit data and perform clustering to reduce data volume. Then, the ATCA-based Data Formatter system will organize the trigger tower data, sharing data among boards over a full-mesh backplane. The board and system level performance studies and implementation details, as well as the operation experiences from the FTK full-chain testing, will be presented.

  12. Machoideal och/eller meningslös underhållning? : Om fem mäns berättelser kring krigsfilmen Saving Private Ryan med fokus på maskulinitet och publiken som meningsskapare.

    OpenAIRE

    Olsson, Eva

    2005-01-01

    Uppsatsen undersöker fem mäns berättelser kring krigsfilmen Saving Private Ryan, med fokus på maskulinitet. Föreställningarna och bilderna kring maskulinitet som kan urskiljas i intervjupersonernas berättelser, knyts till R.W. Connells teoretiska ramverk kring hegemonisk maskulinitet och de hierarkiska relationerna mellan olika maskuliniteter. Vidare resoneras det kring hur berättelserna exemplifierar en syn på mediepublik som aktiva meningsskapare, då intervjupersonerna tar fasta på olika as...

  13. Grafični uporabniški vmesnik za vgrajene sisteme

    OpenAIRE

    MAJERLE, TILEN

    2017-01-01

    Grafični uporabniški vmesnik je način interakcije med uporabnikom in napravo, največkrat osebnim računalnikom. V današnjem času postajajo vgrajeni sistemi vse bolj zmogljivi, s tem pa tudi vse večje zahteve po delovanju. Pri najbolj zmogljivih napravah lahko priključimo zaslon na sistem in tako omogočimo uporabniku grafičen prikaz. Ker imajo vgrajeni sistemi precej manj spominskih kapacitet, moramo razmisliti o grafičnih knjižnicah, ki so namenjene prav takšnim sistemom. ...

  14. Hoitajien ergonomia potilaan siirtymisen avustamisessa

    OpenAIRE

    Virta, Emma-Pauliina

    2010-01-01

    Opinnäytetyö toteutettiin eteläsuomalaisen sairaalan kolmella osastolla. Opinnäytetyön tarkoituksena oli kartoittaa hoitajien näkemystä ergonomiasta potilaan siirtymisen avustamisessa ja ergonomian toteutumisesta sekä selvittää, mitkä tekijät edistävät ja mitkä estävät sitä. Opinnäytetyön tavoitteena oli kehittää hoitajien ergonomiaa potilaan siirtymisen avustamisessa. Opinnäytetyössä käytettiin kvantitatiivista tutkimusmenetelmää. Aineisto kerättiin puolistrukturoiduilla kyselylomakkeilla, j...

  15. Krmiljenje in programiranje z uporabo programskega okolja GraphFruit v tehniškem izobraževanju

    OpenAIRE

    Debeljak, Krištof

    2014-01-01

    Raziskan je bil problem uporabe in programiranja mini PLC krmilnikov v primeru, ko le-te uporabljajo uporabniki, ki nimajo dovolj znanja o programiranju oz. ko ga uporabljamo v šoli kot učni pripomoček. Krmilnike v osnovi razdelimo na tri različne nivoje: enostavne mini PLC-je, srednje zmogljive in razširljive krmilnike ter profesionalne krmilnike. Raziskava je obravnavala samo krmilnike prve in druge skupine, ker zahtevajo krmilniki tretje skupine bistveno višji nivo znanja in...

  16. Mapping the dissociative ionization dynamics of molecular nitrogen with attosecond resolution

    International Nuclear Information System (INIS)

    Klinker, M; González-Vázquez, J; Martin, F; Trabattoni, A; Sansone, G; Nisoli, M; Liu, C; Linguerri, R; Hochlaf, M; Klei, J; Vrakking, M J J; Calegari, F

    2015-01-01

    We wish to understand the processes underlying the ionization dynamics of N 2 as experimentally induced and studied by recording the kinetic energy release (KER) in a XUV-pump/IR-probe setup. To this end a theoretical model was developed describing the ionization process using Dyson Orbitals and, subsequently, the dissociation process using a large set of diabatic potential energy surfaces (PES) on which to propagate. From said set of PES, a small subset is extracted allowing for the identification of one and two photon processes chiefly responsible for the experimentally observed features. (paper)

  17. Skyggedom av enkepensjonsdommen

    DEFF Research Database (Denmark)

    Rognlien, Ida Gundersby

    2014-01-01

    Masteroppgaven undersøker om bortfall av ektefellepensjon ved lovendring med tilbakevirkende kraft er i strid med retten til eiendom etter EMK TP 1 art 1. Skyggedommetoden/ Feminist Judgments -metoden brukes for å gjenskrive enkepensjonsdommen Rt.2006.262 i et feministisk perspektiv. Da mannen døde.......1975.220. I spørsmålet om inngrepet er proporsjonalt ble vektlagt at det ikke foreligger en transparent avveining av de relevante interessene. Videre er hensynene bak og behovene for den opprinnelige ektefellepensjonen fortsatt tilstede, og de er ikke tilstrekkelig avveid mot formålene med inngrepet...

  18. Ei haukku haavaa tee : koiran vaikutus lapsen toimintaan ja toiminnallisuuden kehitykseen

    OpenAIRE

    Ansamaa, Katariina; Kaitila, Emmi

    2014-01-01

    Eläinten vaikutuksesta ihmisen terveyteen ja hyvinvointiin on olemassa paljon tutkimuksia. Myös eläinavusteisesta terapiasta on tutkimuksia, mutta koira-avusteisen terapian tutkimustieto on vielä vähäistä. Toimintaterapiassa koiran avulla voidaan pyrkiä löytämään ja mahdollistamaan asiakkaalle arjen merkityksellisiä toimintoja. Tämän opinnäytetyön tarkoituksena oli kerätä tietoa lasten koira-avusteisesta toimintaterapiasta. Teoreettinen viitekehys muodostuu eläin- ja koira-avusteisen terapian...

  19. FACEBOOK IN PARTNERSKI ODNOSI: Vloga uporabe Facebooka in stilov navezanosti v partnerskih odnosih pri izražanju in doživljanju ljubosumja na Facebooku

    OpenAIRE

    Fermišek, Neja

    2017-01-01

    Popularnost Facebooka je v zadnjih nekaj letih izrazito narastla, vendar kljub temu njegov vpliv na partnerske odnose še zmeraj ostaja relativno neraziskan. Magistrsko delo ugotavlja, kako je uporaba Facebooka povezana z ljubosumjem in nadzorom partnerja na Facebooku ter z zadovoljstvom v samem partnerskem odnosu. Ker pa je romantična ljubezen proces navezanosti, se nam je prav tako zdelo pomembno, da v empiričnem delu raziščemo povezavo med različnimi stili navezanosti in ljubosumjem na Face...

  20. UPORABA SODOBNIH TEHNOLOGIJ SPLETNEGA OGLAŠEVANJA

    OpenAIRE

    Kostanjevec, Mateja

    2016-01-01

    Splet je postal za večino že skoraj nepogrešljiv del vsakdana. Na spletu iščemo informacije, delimo informacije, se družimo. Ker ogromno časa preživimo na spletu, je postalo zelo pomembno za podjetja, da so prisotna na spletu. Svoje potencialne kupce lahko na spletu dosežejo s postavitvijo spletnega mesta in spletnim oglaševanjem. V diplomskem delu smo najprej opredelili marketinško komuniciranje, katera so orodja in kako le ta vplivajo na potencialne kupce. Opredelili smo tudi oglaševan...

  1. Liiketoimintasuunnitelma Siivousalan yritykselle

    OpenAIRE

    Haapala, Jenna

    2015-01-01

    Opinnäytetyön tarkoituksena oli laatia ajantasaista tietoa hyvän liiketoimintasuunnitelman kokoamisesta. Mitä tulevan yrittäjän on otettava huomioon ennen kuin hän alkaa keskustella rahoittajien tai muiden liiketoiminnasta mahdollisesti kiinnostuneiden tahojen kanssa? Tutkimuksen tarkoitus oli saada kerättyä kattavasti tietoa liiketoimintasuunnitelman teosta ja siihen liittyvästä olennaisista ja tärkeimmistä sisällöistä. Opinnäytetyö koostuu yrityksen suunniteluun liittyvästä teoriasta j...

  2. Det finnes ingen gangstere i Norge

    OpenAIRE

    Gresaker, Ann Kristin

    2007-01-01

    Denne oppgaven handler om åtte gutters forhold til rapmusikk. Jeg har intervjuet åtte gutter/unge menn med minoritetsbakgrunn som bor eller har bodd store deler av livet sitt på østkanten i Oslo. Informantene er i alderen mellom 17 og 24 år og alle har et spesielt forhold til rapmusikk. Syv av de åtte rapper selv på ulike nivå og med ulike ambisjoner. Problemstillingen jeg søker å svare på er todelt, og første del lyder: Hvilke dominerende fortellinger om hiphop/rap finner vi hos gutter/unge ...

  3. Improving the ATLAS physics potential with the Fast Track Trigger System

    CERN Document Server

    Cavaliere, Viviana; The ATLAS collaboration

    2015-01-01

    The ATLAS Fast TracKer (FTK) is a custom electronics system that will operate at the full Level-1 accept rate, 100 kHz, to provide high quality tracks as input to the High-Level Trigger. The event reconstruction is performed in hardware, thanks to the massive parallelism of associative memories (AM) and FPGAs. We present the advantages for the physics goals of the ATLAS experiment and the recent results on the design, technological advancements and testing of some of the core components used in the processor.

  4. Innføringen av de norske lovene på Island i perioden 1274-1319

    OpenAIRE

    Smerud, Bjørn Gunnar

    2013-01-01

    I 1274 fikk Magnus VI Håkonsson innført en landsdekkende lovbok i Norge, kalt Landsloven. Han ønsket også å innføre lignende lovbøker i skattlandene som var blitt underlagt den norske kronen i perioden før hans regjeringstid. I denne oppgaven ser jeg nærmere på hvordan dette ble gjort på Island i perioden mellom 1274 og 1319. Dette gjøres gjennom en grundig sammenligning av den norske Landsloven og Jónsbók, den islandske versjonen fra 1281.

  5. Turvajalkineiden vaikutus jalkaterveyteen Suur-Savon Sähkötyö Oy:ssä

    OpenAIRE

    Pulkkinen, Riikka; Tossavainen, Inka; Ryynänen, Elina

    2014-01-01

    Opinnäytetyön tarkoituksena oli selvittää, millaisia vaikutuksia turvajalkineilla voi olla jalkaterveyteen, minkälaisia jalkaongelmia turvajalkineiden käyttö voi aiheuttaa, voivatko työntekijät itse vaikuttaa turvajalkineiden hankintaan ja millainen on turvajalkineiden hankintaprosessi Suur-Savon Sähkötyö Oy:ssä. Opinnäytetyömme toimeksiantaja oli Suur-Savon Sähkötyö Oy. Tutkimusmenetelmänä käytettiin pääasiassa kvantitatiivista tutkimusta ja aineisto kerättiin puolistrukturoidulla kysely...

  6. Opettaja kotimaisessa lastenelokuvassa

    OpenAIRE

    Pankka, Essi

    2017-01-01

    Fiktio vaikuttaa arvoihimme, maailmankuvaamme ja stereotypiakäsityksiin. Siksi ei ole yh-dentekevää, mitä lapset, nuoret ja aikuiset lisääntyvällä ruutuajallaan katsovat. Kotimainen lastenelokuva elää kultakauttaan ja kerää vuosi vuodelta enemmän katsojia, päihittäen jopa amerikkalaiset suurelokuvat. Tämän tutkimuksen tavoitteena on selvittää miten kotimaisessa 2000-luvun lastenelokuvassa kuvataan peruskouluikäisten lasten opettajia ja koulua. Mitä al-le kouluikäinen tai alakouluikäinen lapsi...

  7. Du er god nok! Litteraturstudie om tilrettelegging av mestring for elever med dysleksi.

    OpenAIRE

    Loktu, Thea Amanda Hansen

    2017-01-01

    Bacheloroppgave, grunnskolelærerutdanning, 2017. Norsk: Temaet for oppgaven er mestring og dysleksi og omhandler hvorfor og til dels hvordan en særlig skal legge til rette for mestring hos elever med dysleksi. Oppgaven er fundert i både et samfunnsmessigperspektiv og et individperspektiv. Bacheloren søker å finne de momentene som påvirker læring for denne gruppen, med fokus på det helhetlige mennesket. Problemstillingen lyder slik: Hvorfor legge særlig til rette for mestring hos elever ...

  8. KERÎMÎ’NİN EDİRNE ŞEHRENGİZİ

    Directory of Open Access Journals (Sweden)

    Zehra Gmre

    2015-07-01

    Full Text Available Bu makalede Kerîmî’nin şehrengizinin şekil ve muhteva özellikleri ile eserin tenkitli metnine yer verilmiştir. Kanunî devri şairlerinden olan ve hayatı hakkında oldukça sınırlı bilgilere ulaşılan Kerîmî’nin Edirne şehrengizinin iki nüshasına ulaşılmıştır. Bu nüshaların karşılaştırılması neticesinde oluşan metne göre eser 202 beyittir. Tevhid, münâcât, sebeb-i te’lif, Edirne şehrinin övgüsü, Edirne güzellerinin övgüsü, dua ve hâtime bölümleri bulunan manzumede Kerîmî 59 güzelin övgüsünü yapmaktadır. Kerîmî’nin Edirne şehrengizi, XVI. yüzyıldan itibaren görülmeye başlayan ve yazılması bir süre moda haline gelen Divan şiiri içerisinde özgün yapısıyla dikkat çeken türün tipik bir örneğidir. Sanat kaygısının görülmediği, çarşı esnafından meslek sahibi erkek güzellerin mesleklerine, ad ve lakaplarına uygun cinas ve teşbihlerle tasvir edildiği karakteristik bir yapı arz etmektedir.

  9. VLOGA IZVEDENCA ZA RAČUNOVODSTVO V KAZENSKIH POSTOPKIH

    OpenAIRE

    Golnar, Brigita

    2015-01-01

    V našem diplomskem seminarju smo spoznali forenzično računovodstvo. Ker je ta veja računovodstva močno povezana s pravno stroko, smo bolje predstavili pravni vidik, ki se navezuje na našo temo. V okviru tega smo se dotaknili kazenskega procesnega prava in opisali kazenski in dokazni postopek. Poudarek celotnega diplomskega seminarja temelji na tem, kakšna je vloga izvedenca v kazenskih postopkih. Spoznali smo, da je vloga izvedenca v kazenskih postopkih lahko zelo pomembna, zato mora izvedene...

  10. The first neighborhood micro-grid of shared energy, RennesGrid: A harbinger of the energy transition at the local level

    International Nuclear Information System (INIS)

    Djahel, Thierry

    2017-01-01

    To develop a concrete policy for saving energy and for the energy transition, the Rennes metropolitan area and Schneider Electric have launched RennesGrid, a 20-year experiment with managing energy consumption at Ker Lann, an urban development zone located in Bruz township, 12 kilometers southwest of Rennes, France. Covering more than 160 hectares, Ker Lann groups: approximately sixty companies specialized in high technology; seventeen establishments of higher education, research and training; and residential units and dormitories for students. RennesGrid will make it less dependent on carbon energy thanks to the production of local, renewable sources using photovoltaic installations. For consumers, the objective is to reduce their energy needs and consume a renewable form of energy produced locally. Planned for operation at the end of 2017 and endowed with a global investment budget of Euro 5.8 million, this experiment is a private business with a hold over three hectares of land under a 20-year concession. Its business model is, however, mainly based on a cooperative approach (in particular with residents of the zone) and on innovative arrangements for participatory funding

  11. Sing English: Om sangens potensial i engelskopplæringen

    Directory of Open Access Journals (Sweden)

    Ragnhild Elisabeth Lund

    2012-03-01

    Full Text Available Sang er en åpenbar kilde til læring av fremmedspråk. Læreplaner for engelskfaget opp gjennom tidene har påpekt dette, og læreverkene i engelsk inneholder mange sanger. Men nøyaktig hva er det sang kan bidra med? Hva slags sanger er tatt med i bøkene, og hvilke målsettinger ser ut til å være knyttet til dem? Artikkelen besvarer disse spørsmålene ved å vise til læreplaner og utvalgte lærebøker fra perioden 1885 – 2008 og hvordan de legger opp til at sang skal brukes som en del av opplæringen i engelsk. Undersøkelsen er begrenset til ungdomstrinnet. Innledningsvis refererer artikkelen til ulike begrunnelser for bruk av sang i fremmedspråkopplæringen. Når sang nevnes i læreplanene eller innlemmes i lærebøkene, reflekteres enkelte av disse begrunnelsene. Samtidig er det påfallende hvor ofte planer og bøker ikke begrunner bruken av sang eller setter sangene inn i en didaktisk sammenheng. Artikkelen konkluderer derfor med at sanger ser ut til å representere et stort, men delvis uutnyttet potensial i engelskopplæringen på ungdomstrinnet.

  12. Ungdom med innvandringsbakgrunn etter overgangen til videregående opplæring – tapte nettverk og svekket skoletrivsel?

    Directory of Open Access Journals (Sweden)

    Kristinn Hegna

    2014-10-01

    Full Text Available Nylig publisert forskning har vist at de sosioøkonomiske forskjellene i ungdomsskolekarakterer har økt noe etter at Kunnskapsløftet ble innført i 2006/2007. Denne artikkelen undersøker om det samme har skjedd i Oslo – landets eneste virkelige storby med betydelig sosial ulikhet og en særskilt stor andel innvandrere. På tross av slike trekk får Oslos ungdomsskoleelever litt bedre gjennomsnittskarakterer enn landsgjennomsnittet, og «Oslo-forspranget» har økt de siste årene. På midten av 2000-tallet var karakterforskjellene mellom «høy» og «lav» sosioøkonomisk familiebakgrunn mindre i Oslo enn i resten av landet, men etter at Kunnskapsløftet ble innført, er det ikke lenger slik. I 2010/2011 var den sosiale ulikheten i eksamenskarakterer den samme i Oslo som i resten av landet. I artikkelen diskuterer vi forskjellige årsaker til at ulikhetene i skolen øker.

  13. An Associative Memory Chip for the Trigger System of the ATLAS Experiment

    CERN Document Server

    AUTHOR|(INSPIRE)INSPIRE-00380893; The ATLAS collaboration; Liberali, Valentino; Crescioli, Francesco; Beretta, Matteo; Frontini, Luca; Annovi, Alberto; Stabile, Alberto

    2017-01-01

    The AM06 is the 6th version of a large associative memory chip designed in 65 nm CMOS tech- nology. The AM06 operates as a highly parallel ASIC processor for pattern recognition in the ATLAS experiment at CERN. It is the core of the Fast TracKer electronic system, which is tai- lored for on-line track finding in the trigger system of the ATLAS experiment. The Fast TracKer system is able to process events up to 100 MHz in real time. The AM06 is a complex chip, and it has been designed combining full-custom memory arrays, standard logic cells and IP blocks. It contains memory banks that store data organized in 18 bit words; a group of 8 words is called a pattern. The chip silicon area is 168 mm2; it contains 421 millions of transistors and it stores 217 patterns. Moreover, the associative memory is suitable also for other interdisciplinary appli- cations (i.e., general purpose image filtering and analysis). In the near future we plan to design a more powerful and flexible chip in 28 nm CMOS technology.

  14. Dynamic isotope effect on the product energy partitioning in CH2OH+→CHO++H2

    Science.gov (United States)

    Rhee, Young Min; Kim, Myung Soo

    1998-10-01

    The deuterium isotope effect on the product energy partitioning in the title reaction was investigated both experimentally and theoretically. The measured kinetic energy release (KER) showed a significant dependence on the position of deuteration. A reliable potential energy surface of the reaction was constructed from ab initio results using the recently developed interpolation algorithm. The classical trajectory calculation on this surface well reproduced the experimental finding. Close inspection of the potential energy surface revealed that the isotope effect on KER and the product rotations arose from the alteration of the symmetry of the reaction path near the transition state induced by the mass change upon isotopic substitution. The product vibrations were found to be affected by the change in the coupling constants which also arose from the mass-dependent change in the reaction path. Possibility of the quantum mechanical tunneling was also considered. Tunneling-corrected classical trajectory results were in excellent agreement with the experimental ones, indicating that the reaction proceeds via barrier penetration below the threshold.

  15. Transient-induced latchup in CMOS integrated circuits

    CERN Document Server

    Ker, Ming-Dou

    2009-01-01

    "Transient-Induced Latchup in CMOS Integrated Circuits equips the practicing engineer with all the tools needed to address this regularly occurring problem while becoming more proficient at IC layout. Ker and Hsu introduce the phenomenon and basic physical mechanism of latchup, explaining the critical issues that have resurfaced for CMOS technologies. Once readers can gain an understanding of the standard practices for TLU, Ker and Hsu discuss the physical mechanism of TLU under a system-level ESD test, while introducing an efficient component-level TLU measurement setup. The authors then present experimental methodologies to extract safe and area-efficient compact layout rules for latchup prevention, including layout rules for I/O cells, internal circuits, and between I/O and internal circuits. The book concludes with an appendix giving a practical example of extracting layout rules and guidelines for latchup prevention in a 0.18-micrometer 1.8V/3.3V silicided CMOS process."--Publisher's description.

  16. ELEMENTS OF GROUND FLOOR GYMNA STICS FOR INDIVIDUAL WORK WITH A CIRCULAR ATTACKER – PRO GRAMM

    Directory of Open Access Journals (Sweden)

    Fahrudin Mavrić

    2007-05-01

    Full Text Available Po si tion of a cir cu lar at tac ker (pi vot man, player in the li ne, etc. is most spe cifi c and pro bably most dif fi cult. Play of a cir cu lar at tac ker re gar ding pre sent de fen si ve for ma ti ons ac cor ding to this year’s World Cham pi on ship in Ger many Is ba sed upon se ar ching and ma king of spa ce in very ac ti ve de fen si ve for ma ti ons with the player’s task to pro vi de si tu a tion of sco ring of so me of his co-players using dif fe rent bloc ka des etc. , or do ing it him self. Pi vot man is not only a player of po wer ac ting as a ram part, but al so a mul ti-tasking sports at hle te or a gymna stics uni ver sal player. In this work we emp ha si zed ele ments of gro und fl o or gymna stics in vol ved in trai ning pro cess of Hand ball club No vi Pa zar players with na ac cent of in di vi dual work with pi vot man.

  17. Leseopplæring i norskfagets begynneropplæring med fokus på fagspesifikk lesekompetanse

    Directory of Open Access Journals (Sweden)

    Anne Håland

    2016-04-01

    Full Text Available Distinksjonen knyttet til generell og fagspesifikk lese- og skriveopplæring i fagene har fått fornyet interesse både i norsk og internasjonal sammenheng. Denne artikkelen diskuterer hva dette betyr i norskfagets begynneropplæring, og søker med dette å supplere litteraturen som finnes om lesing av skjønnlitteratur. Vi stiller spørsmålet: Hvordan posisjonerer elever på 1. trinn seg som litterære lesere? Spørsmålet utforskes gjennom klassesamtaler rundt to utvalgte bildebøker med innlagte lesestopp, basert på teorier om hva det vil si å lese skjønnlitteratur, og da særlig Judith Langers teorier (2005 om forestillingsverdener. Utdragene fra klassesamtalene viser at elevene er i stand til å posisjonere seg som litterære lesere og utforske tekster på en fagspesifikk måte.

  18. Luuleaasta 1994 : parlamendi koosseis on selgunud / Barbi Pilvre

    Index Scriptorium Estoniae

    Pilvre, Barbi, 1963-

    1995-01-01

    Rannit, Aleksis. Nii näen sind ikka; Kangur, Kalju. Sõna sees olek; Traat, Mats. Koidu kätes; Rimmel, Rudolf. Setu netu; Suislepp, Harald. Köögertali kojutulek; Piir, Enno. Sunnitöölise Mekka; Üllaste, Leenart. Lind tormis; Hirv, Indrek. Taskuraamat (taskutähekerjus); Mirtem, Valev [Luhaäär, Ingvar]. Maithunad Eestis; Mirtem, Valev [Luhaäär, Ingvar]. Armuühtepühad; Mirtem, Valev [Luhaäär, Ingvar]. Tulevaas; Kurvits, Lembit. Matle laul; Lillemets, Enn. Olemise valge koer ehk Ingli kolju; Jessod, Mats [Jakobson, Mati]. Jah, luuletused; Jessod, Mats [Jakobson, Mati]. Ohjad Oti mäel; Jessod, Mats [Jakobson, Mati]. Poeetilisi prohmakaid; Ivar, Ivo. Riimiskid; Kilokalor, Kalle. Öösel näeb halvemini kui päeval; Trubetsky, Tõnu. Anarhia; Laanvee, Ervin. Jaa. Mina olen; Kuningas, Marko J. ...jääb USK, LOOTUS, ARMASTUS; Ruben, Arne. Ajakirjanik; Ollinovski, Jim [Ollino, Ott]. Luuletused; Toomik, Tõnu. 27 luuletust; Tosin, Ants. Õnnetähestik; Krüger, Urmas. Ka nii võib...; Kärner, Siim. Usseaid; Sikk, Heino. Võrokõstõlõ: poeem; Kollin, Viktor. Kodutunne; Alo, Ülo [Võsar, Ülo Alo]. Ööbikuvalgus; Sepp, Vello. Vigased pärlid; Palo, Wilhelm. Tuule-luuled; Soomets, Triin. Randmes unejanu; Soomets, Triin. Janu masinas; Ränik, Valeria. Ajast väljas; Kivi, Aita. Kalender-päevik Aita Kivi luuletustega; Maagemust, Maarika. Kaaludes kaldaid; Hiiussaar, Ann. Valgete uste taga; Kolkkanen, Imbi. Mina ja maailm; Mets, Neeme. Kesalill; Kolesnitshenko, Kaidi-Ly. Kaks silma; Kahro, Anne. Nälkjast!; Kabe, Aino. Tuulema mõtteriim. Raatma, Salme. Laululatern; Osila, Virve. Lootuse luiged; Isak, Asta. Valguse ja varjude vahel; Õunapuu, Meeli. Mööda teid ja radu

  19. "Uni katab meid ühele palju kahele vähe..." : [luuletused] / Jaan Kaplinski

    Index Scriptorium Estoniae

    Kaplinski, Jaan, 1941-

    2001-01-01

    Tekst eesti ja inglise k. J. Kaplinski lühibiograafia eesti ja inglise k. lk. 93. Sisu: "Uni katab meid ühele palju kahele vähe..." = "Sleep covers us too much for one, too little for two..." ; "Olematus ulatub kõikjale ja olemasolu on täis rahu..." = "Non-being pervades everything and being is full of peace..." ; "See mis meid äratas..." = "What woke us..." ; "Seesama meri meis kõigis..." = "The same sea in us all..." ; Dana paramita ; "Ida ja Lääne vaheline piir rändab ikka, vahel itta, vahel läände..." = "The East-West border is always wandering..." ; "Pesu ei saa kunagi pestud..." = "The washing never gets home..." ; "Neli ja pool tonni sileesia sütt..." = "Four-and-a-half tons of Silesian coal..." ; "Ei teagi, kas ma tohin rääkida roheline..." = "I don't even know if I have the right to say "green"..." ; "Maailmu on nii palju kui liivateri mere ääres..." = "There are as many worlds as grains of sand on a beach..." ; "Viimane pilv läheb üle taeva läänest itta..." = "A last cloud goes over the sky from West to East..." ; "Taevas on pilves. Soe tuul tuleb hõlma alla..." = "The sky is overcast. The warm wind is creeping under your shirt..." ; "Mu tädi tundis neid hästi, mina ei tea..." = "My aunt knew them well, I know of them..." ; "Hommikul tutvustati mind president Mitterrandile..." = "In the morning, I was presented to President Mitterrand..." ; "Meri ei taha lainetada. Tuul ei taha puhuda..." = "The sea doesn't want to wave...".Poems written in English: "Om svabhavasuddhah sarva dharmah. No selfhood..." ; "My little boy..." ; "After many bitterly cold days..." ; "You can forget nature..." ; I walk facing East..." ; "A skier going south..."

  20. 212ʻ Fahrenheiti : eesti luule 2006 / Piret Bristol

    Index Scriptorium Estoniae

    Bristol, Piret, 1968-

    2008-01-01

    Järgmistest 2006. a. ilmunud luulekogudest: Ryytle, Indrek. Inglid rokijaamas. Puhja : I. Rüütle ; Runnel, Hando. Viru veri ei värise. Tartu : Ilmamaa ; Vabat, Martin. Mina olengi kirjandusklassik. Tartu : Eesti Kirjanduse Selts ; Korts, Eliina. Lööklaused murravad metsi. Tartu : Eesti Kirjanduse Selts ; Koff, Indrek. Vana laul. Luige : Verb ; Teede, Andra. Takso Tallinna taevas. Luige : Verb ; Vusser, Kaspar. Vusserduste võnked. Tallinn : P. Kukk ; Elbing, Andrus. Siin Beebilõust, tere! : häired pimelinna tänavalt = Ciao, it's Babyface : trouble from the streets of a blind city. Tallinn : Epifanio ; Hint, Miina. Vabaduse vang, ehk, Põrandaalune kirjandus. Tallinn : MR ; Jüriado, Tiiu. Luule on ime. Habaja : Kentaur ; Ligi, Katre. Naabrivalve. Tartu : Ilmamaa ; Krull, Hasso. Talv. Tallinn : Tuum ; Mets, Mae. Pühapäeval on reede. Tartu : Ilmamaa ; Ploom, Ülar. Porr ja sorry. Tallinn : Tuum ; Hirv, Indrek, Surmapõletaja. Tallinn : Tuum ; Piir, Milvi Martina. Kõrkjavaas. Tartu : Fantaasia ; Soomets, Triin. Väljas. Tallinn : Tuum ; Mathura. Kohalolu. Rapla : Allikäärne ; Afanasjev, Vahur. Katedraal Emajões. Tartu ; Brüssel : ID Salong//Sild, Ivar. Spermaga ja puha. Pärnu : Jumalikud Ilmutused ; Meiel, Kaupo. Polügrafisti käsiraamat. Pärnu : Jumalikud Ilmutused ; Kivisildnik, Sven. Vägistatud jäämägi. Pärnu : Jumalikud Ilmutused ; Arder, Ott. Luule sünnib kus sünnib kui sünnib / koost. Leelo Tungal. Tallinn : Tänapäev ; Kompus, Marko. Vallaliste jõgede tõkkejooksja. Tartu : M. Kompus

  1. Nomenclatural adjustments in African plants 1

    Directory of Open Access Journals (Sweden)

    Peter Goldblatt

    2014-12-01

    Full Text Available Background: Ongoing systematic studies of the African flora necessitate periodic nomenclatural adjustments and corrections. Objectives: To effect requisite nomenclatural changes. Method: Relevant literature was surveyed and type material located and studied. Results: Nomenclatural corrections were published in Justicia L. (Acanthaceae, Babiana KerGawl. and Geissorhiza Ker Gawl. (Iridaceae and Zaluzianskya F.W.Schmidt (Scrophulariaceae. Conclusions: Firstly, a complete enumeration of all southern African species of Justicia was provided within the infrageneric classification for the genus accepted by Graham (1988 and later modified and expanded by Ensermu (1990 and Hedrén (1990. In this circumscription, Justicia includes such well-established segregates in an African context as Adhatoda Miller, Aulojusticia Lindau, Duvernoia E.Mey. ex Nees, Monechma Hochst. and Siphonoglossa Oersted.Both southern African species of Adhatoda were transferred to Justicia, as well as all of the southern African species of Monechma, with eight new combinations or replacement names provided. All species were placed to section within Justicia. Secondly, the type of Gladiolus nervosus Lam. (1788 was considered to be conspecific with Gladiolus strictus Aiton (1789 and is therefore the earliest available name for the species currently known as Babiana stricta (Aiton Ker Gawl. The new combination Babiana nervosa (Lam. Goldblatt & J.C.Manning was provided. Thirdly, Geissorhiza ornithogaloides has been regarded as a new species described by F.W. Klatt (1866 but the name should be treated as the combination G. ornithogaloides (Lichst. ex Roem. & Schult. Klatt, based on Ixia ornithogaloides Lichst. ex Roem. & Schult.(1817a. Examination of the type showed that it is conspecific with Geissorhiza marlothii R.C.Foster (1941 and it is therefore the valid name for the taxon treated as G. ornithogaloides subsp. marlothii (R.C.Foster Goldblatt. An epitype for the taxon was designated

  2. Uus Eesti disain / Silvia Pärmann

    Index Scriptorium Estoniae

    Pärmann, Silvia

    2016-01-01

    Allan Prooso, Argo Männiku ja Kalmer Alliku (HOOG) disainitud riiulid. Liis Lindmaa ja Anatoli Tafitšuki disainitud kassimaja Juno. Anni Varmi puidust lõikelauad, Toivo Raidmetsa tool Arike, Maria Kalmu vineerist prossid, Jaanus Orgusaare kapp Rolling. Merili Sule ja Petrica Artene (StenCilit) disainitud seinašabloonid. Merlin Tiiveli (NION design) käsitsi valmistatud sisustuaksessuaarid (korvid, vaibad, kott-toolid). Margus Triibmanni toolvalgusti Cranberry, Stella Soomlaisi naturaalsest nahast käekotid. Kristjan Rabi, Janno Roodi, Veljo Viikanti (Aegaon) disainitud käekellad. Mari Saani, Mariana Laane (stuudio Nüüd) keraamika. Silver Tibbingi pakendikujundused Sõsara kosmeetikatoodetele, Elena Volki ja Eveliis Salaka Helge Kodu ruumiparfüümid. Kerly Kaljuste ja Anu Rajamäe (KOOSdisain) kodutekstiilid. Meelis Undi ja Mari Otsa (WolfBerry) lastemööbel

  3. Družbena segregacija avtohtonih migrantov v Mehiki: primer mesta Monterrey

    Directory of Open Access Journals (Sweden)

    Arun Kumar Acharya

    2012-01-01

    Full Text Available Značilen pojav, ki ga lahko opazimo v Mehiki, je ruralno urbana migracija oziroma preseljevanje ljudi s podeželja v mesta. Zadnjih nekaj let se stopnja preseljevanja avtohtonih prebivalcev v mesta na severu Mehike, še zlasti v Monterrey, kjer iščejo zaposlitev, nenadzorovano veča. Ko migranti prispejo v to velemesto, imajo zaradi prikrite diskriminacije težave s prilagajanjem mestnemu okolju. Glavni argument in hipoteza tega članka je, da se ti ljudje sami družbeno izolirajo in segregirajo, ker se bojijo (kulturne in rasne diskriminacije in nasilja. Podatke za to študijo smo zbrali s pomočjo terenske raziskave, za katero smo leta 2009 in 2010 v Monterreyu intervjuvali 350 avtohtonih prebivalcev, ki so se tja priselili iz različnih krajev v Mehiki.

  4. Henkilöstötilinpäätös Yritys Oy

    OpenAIRE

    Turunen, Tytti

    2011-01-01

    Tämän opinnäytetyön aiheena oli Yritys Oy:n henkilöstötilinpäätös vuodelta 2009. Henkilöstötilinpäätös jaetaan kahteen osaan, henkilöstötuloslaskelmaan ja henkilöstökertomukseen. Tavoitteena oli laatia Yritys Oy:lle henkilöstötilinpäätöksestä malli, jota yritys voi käyttää ja hyödyntää tulevaisuudessa henkilöstötilinpäätöstä laatiessa. Tavoitteena oli myös antaa kehittämisehdotuksia, minkälaista tietoa kannattaa kerätä seuraavia henkilöstötilinpäätöksiä varten. Henkilöstötilinpäätöksen tavoit...

  5. Beleženje delovnega časa z uporabo tehnologije RFID

    OpenAIRE

    MAŠIĆ, TADEJ

    2018-01-01

    Za beleženje delovnega časa zaposlenih se v podjetjih in ustanovah uporabljajo različne metode. Kljub razpoložljivim sodobnih tehnologijam še vedno ponekod najdemo beleženje delovnega časa z vpisovanjem prihodov in odhodov na list papirja ali v računalniške tabele. Takšni načini niso avtomatizirani in prinašajo več slabosti kot prednosti. Na trgu obstajajo računalniško avtomatizirani sistemi za beleženje časa, a ker so ti lahko zelo dragi, se zanje manjša podjetja in ustanove odločajo le redk...

  6. Palvelumuotoilutyöpajan toteutus Oulun kaupunginteatterilla : Hurmos-hanke

    OpenAIRE

    Pieniniemi, Miia

    2016-01-01

    Tämä opinnäytetyö on osa Hurmos-hanketta ja se tehtiin Oulun kaupunginteatterille. Työ toteutettiin toiminnallisena opinnäytetyönä ja sen materiaali kerättiin Oulun kaupunginteatterilla toukokuussa 2016 järjestystä palvelumuotoilutyöpajasta. Työn tavoitteena oli selvittää miten nuoret saataisiin käymään enemmän teatterissa. Työssä käytettiin tutkimusmenetelmänä laadullista tutkimusta sekä aineistonkeruumenetelmänä havainnointia. Opinnäytetyön tietoperustassa käydään tarkemmin läpi palvelu...

  7. Upajmo si biti starši. Praktično delovanje dveh sol za starše

    Directory of Open Access Journals (Sweden)

    Andreja Jereb

    2005-12-01

    Full Text Available V prispevku predstavljam dva primera uspdne prakse sole za starSe. Prvi zasluzi pozornost, ker zajema vse potrebne vsebine za ozavdcanje starsev o kompleksnosti in konfliktnosti odnosov v druzini tako med zakoncema kot tudi med starsi in mladostniki. Program je pripravljen sistematicno, sreeanja so strukturirana in privlacna za starSe mladostnikov, ki marsikatero tezavo iz doma prepoznajo v stevilnih primerih iger vlog. Drugi, spanski primer, zasluzi pozornost predvsem zaradi aktivne vloge starsev pri pripravi na sreeanje, z leti vedno aktivnejSe vloge na srecanjih in v pogovorih v druZini, zaradi cesar je precej zahteven tako za voditelja kot za starSe, a sodee po izjavah starsev iskana in uspdna metoda dela s starsi.

  8. Du kan, men du gör inget. : En studie av utvecklingssamtal på ett gymnasium.

    OpenAIRE

    Måhl, Anna

    2007-01-01

    Mitt syfte med denna uppsats är att studera tre elevvårdskonferenser för att först se om deras innehåll överensstämmer med vad Cilla Lindblom Larsson skriver om utvecklings-samtal på grundskolan, att de handlar om pojkarnas skolbeteende och de råd och anvis-ningar pojkarna får där är moraliserande och tillrättavisande, och sedan undersöka hur samtalsstrukturen ser ut i dessa konferenser. I arbetets första del undersöker jag vad dessa elevvårdskonferenser handlar om och kommer fram till att de...

  9. Teoretisk och praktisk genomgång av IPv6 och dess säkerhetsaspekter

    OpenAIRE

    Andersson, David

    2012-01-01

    Den här uppsatsen går teoretiskt och praktiskt igenom IPv6 för att skapa en förståelse för det nya protokollet. Uppsatsen beskriver utöver den teoretiska genomgången av protokollet även det praktiska arbete som ligger bakom implementationen som är tänkt att kunna ge såväl privatpersoner som mindre organisationer tillgång till en säker IPv6 lösning även om Internetleverantören endast kan erbjuda IPv4.   Arbetet är gjort på eget initiativ då behovet av kunskap kring IPv6 växer lavinartat och då...

  10. Lämplighetsbedömningar av unga kvinnor och män – Värme- och kompetensdimensionernas betydelse i rekrytering

    OpenAIRE

    Rönnblad, Charlotta

    2013-01-01

    I frågan om social bedömning av andra individer och grupper utgör värme och kompetens två centrala dimensioner. Värme syftar på hur snäll, vänlig och omtänksam en person är, dess funktion är att bedöma vad personens avsikt är. Kompetens tyder på hur intelligent, självsäker och rationell en person är, dess funktion är att bedöma hur kapabel personen är att utföra avsikterna. Vanligtvis attribueras män utgående från kompetensdimensionen och kvinnor från värmedimensionen. Utgående från teorin om...

  11. Sällskapsdjurens betydelse för de äldres välbefinnande

    OpenAIRE

    Gäddnäs, Emma

    2016-01-01

    Denna studie undersöker sällskapsdjurens betydelse för de äldres välbefinnande. Syftet med studien är att diskutera vad sällskapsdjur betyder för de äldres välbefinnande och vad djur kan betyda för de äldre som bor på äldreboende. Frågeställningarna i studien lyder ”Vilken betydelse har sällskapsdjur för de äldres välbefinnande och deras känsla av delaktighet?” och ”Vilken betydelse har sällskapsdjur inom äldreomsorgen?” Metoden som används för att svara på frågeställningarna är både tidigare...

  12. The ATLAS Fast Tracker Processing Units - input and output data preparation

    CERN Document Server

    Bolz, Arthur; Adelman, Jahred; Anderson, John Thomas; Armbruster, Aaron James; Asbah, Nedaa; Blair, Robert; Brost, Elizabeth; Drake, Gary; Gkaitatzis, Stamatios; Iizawa, Tomoya; Ilic, Nikolina; Jiang, Zihao; Kawaguchi, Yoshimasa; Kimura, Naoki; Kordas, Kostantinos; Sotiropoulou, Calliope Louisa; Love, Jeremy; Mitani, Takashi; Nikolaidis, Spyridon; Okumura, Yasuyuki; Proudfoot, James; Thayil, Steffie Ann; Tompkins, Lauren; Wang, Rui; Watari, Ryutaro; Webster, Jordan S; Yorita, Kohei; Zhang, Jinlong

    2017-01-01

    The ATLAS Fast TracKer(FTK) is a custom hardware system for fast, associative memory based track reconstruction. It will provide tracking information within the full acceptance of the inner tracking detectors to the high level trigger at a rate of up to 100 kHz. %, thus allowing for a refined and more efficient event selection at the trigger level. At the first stage of the FTK the Data Formatter subsystem clusters inner detector hits and organizes them into 64 $\\eta$-$\\phi$ trigger regions. At the last stage, the FTK to Level-2 Interface Cards repackage track records and send them to the high level trigger computing farm. This report aims to give an overview over the functionality of the two systems, their hardware implementation in the Advanced Telecommunications Computing Architecture standard, and the status of their integration into ATLAS.

  13. IFRS9 - rahoitusinstrumentit

    OpenAIRE

    Ojanen, Valtteri

    2012-01-01

    Työssäni on tarkoitus tutkia, miten IFRS9 tulee vaikuttamaan tilinpäätöksen laadintaan ja sitä kautta finanssialan yrityksen tilinpäätöksen lukuihin. Työssä on myös tarkoitus tuoda esiin esimerkiksi finanssivalvonnan ja tilintarkastajien näkökannat, jolloin pystytään tuomaan erilaisten toimijoiden näkökulmia. Lähtökohtana ovat pohjatiedot omasta IFRS opinnäytetyöstä ja se päälle sitten tiedot, jotka olen kerännyt työtä tehdessä. Työn tutkimusosio toteutetaan haastattelemalla yksittäisiä ...

  14. AC/DC-piirien mitoitus sähköasematoimituksissa

    OpenAIRE

    Rautarinta, Juha

    2015-01-01

    Tämän opinnäytetyön tarkoituksena oli tutkia Akku- ja Mitoitus-ohjelmia sekä selvittää niiden soveltuvuutta sähköasemien apusähköjärjestelmien mitoitukseen. Ohjelmia käytettiin VEO Oy:n toimittaman 110/20 kV:n sähköaseman tasasähköpiirien mitoituksen tutkimiseen. Työn alkuun on kerätty teoriaa etenkin sähköasemien tasasähköjärjestelmien mitoituksessa huomioon otettavista asioista ja standardeista. Lopussa käydään läpi ohjelmien käyttöä, ohjelman käyttämiä laskumenetelmiä ja kaavoja. ...

  15. ELEKTRONSKO POSLOVANJE IN MOBILNE NAPRAVE

    OpenAIRE

    Belna, Metka

    2016-01-01

    M-poslovanje je veja e-poslovanja, ki pa z razliko od e-poslovanja poteka preko mobilnih naprav, z uporabo brezžičnega mobilnega interneta. Brezžični mobilni internet je danes razvit že do takšne mere, da presega zmogljivosti klasičnega interneta. Govorimo že o četrti generaciji brezžičnih mobilnih omrežij, ki jih na kratko imenujemo 4G. Storitve m-poslovanja so še posebej privlačne zato, ker jih lahko uporabimo kjerkoli in kadarkoli, saj omogočajo stalno brezžično internetno povezavo, hkrati...

  16. Izokrat: Panegirik

    Directory of Open Access Journals (Sweden)

    Nataša Martina Pintarič

    2018-02-01

    Full Text Available Velikokrat sem se začudil nad tistimi, ki so prvi sklicali praznovanje in ustanovili športna tekmovanja, ker so imeli telesne uspehe za vredne nagrad, nobene časti pa niso dodelili tistim, ki so si zasebno prizadevali za skupno dobro in izurili svoj razum, tako da bi lahko koristili tudi drugim. [2] Tem bi bilo primerneje posvetiti pozornost. Če bi namreč atleti dobili dvakrat tolikšno moč, ne bi drugi pridobili ničesar, če pa bi postal razumen en mož, bi imeli korist od njegove preudarnosti vsi, ki­ bi je želeli biti deležni.

  17. OGLAŠEVANJE IN MANIPULACIJA: ŠTUDIJA PRIMERA

    OpenAIRE

    Lazar, Alja

    2015-01-01

    Diplomska naloga se začne z definicijo oglaševanja. Na splošno povemo kaj je, opišemo zgodovino ter načine oglaševanja. Ker pa oglaševanje pogosto vsebuje manipulativni način, smo se osredotočili še na manipulacijo. Povedali kaj je, kakšne so njene pojavne oblike in kako vpliva na ljudi. Osredotočimo se na manipulacijo, kot ključni element oglaševanja, ugotavljamo razsežnost manipuliranja, ter kako manipulativno oglaševanje deluje na ljudi. Manipulativno oglaševanje moralno ovrednotimo, ter ...

  18. Evidence of interatomic Coulombic decay in ArKr after Ar 2p Auger decay

    International Nuclear Information System (INIS)

    Morishita, Y; Saito, N; Suzuki, I H; Fukuzawa, H; Liu, X-J; Sakai, K; Pruemper, G; Ueda, K; Iwayama, H; Nagaya, K; Yao, M; Kreidi, K; Schoeffler, M; Jahnke, T; Schoessler, S; Doerner, R; Weber, T; Harries, J; Tamenori, Y

    2008-01-01

    We have identified interatomic Coulombic decay (ICD) processes in the ArKr dimer following Ar 2p Auger decay, using momentum-resolved electron-ion-ion coincidence spectroscopy and simultaneously determining the kinetic energy of the ICD electron and the KER between Ar 2+ and Kr + . We find that the spin-conserved ICD processes in which Ar 2+ (3p -3 3d) 1 P and 3 P decay to Ar 2+ (3p -2 ) 1 D and 3 P, respectively, ionizing the Kr atom, are significantly stronger than the spin-flip ICD processes in which Ar 2+ (3p -3 3d) 1 P and 3 P decay to Ar 2+ (3p -2 ) 3 P and 1 D, respectively

  19. Active condensation of the atmospheric moisture as a self-irrigation mechanism for the ground-covering plants

    Directory of Open Access Journals (Sweden)

    Karpun Yuriy Nikolaevich

    2015-12-01

    Full Text Available Studies conducted at the Subtropical Botanical Garden of Kuban (Utch-Dere, Sochi pretty much allow to explain the abnormally high drought resistance of Liriope graminifolia Lour. and Ophiopogon japonicus Ker.-Gawl., plants that naturally grow mostly in sufficient humidity. Quite low temperatures of the leaves’ surface allow to effectively condense the atmospheric moisture and to direct it along the leaf blade to the ground. The accumulation of condensation water leads to self-irrigation, a mechanism that ensures survival of plants in case of insufficient natural precipitation in the form of rain or fog. Combined with xeromorphic leaves with a thick cuticle and thick branch roots with fusiform bulb-shaped swellings, allowing to store water, makes the named plants extremely resistant to stress factors such as prolonged summer droughts accompanied by high daytime temperatures.

  20. Meddela dödsbud : En ansvarsfull uppgift

    OpenAIRE

    Bodén, Elina

    2008-01-01

    Till polisens uppgift hör att meddela dödsbud när de är ansvariga för en utredning av dödsfallet men det finns inga existerande gemensamma riktlinjer för hur det ska ske. Polisen tar ofta med sig präster när de åker ut och meddelar dödsbud men samarbetet mellan kyrkan och polisen ser olika ut runt om i Sverige trots att det finns ett behov av ett samarbete i hela landet. Syftet med rapporten är att förstå vilka reaktioner som poliser kan mötas av när dödsbud meddelas för att de ska känna sig ...

  1. Uniqueness of non-linear ground states for fractional Laplacians in R

    DEFF Research Database (Denmark)

    Frank, Rupert L.; Lenzmann, Enno

    2013-01-01

    We prove uniqueness of ground state solutions Q = Q(|x|) ≥ 0 of the non-linear equation (−Δ)sQ+Q−Qα+1=0inR,where 0 fractional Laplacian in one dimension. In particular, we answer affirmatively an open question...... recently raised by Kenig–Martel–Robbiano and we generalize (by completely different techniques) the specific uniqueness result obtained by Amick and Toland for s=12 and α = 1 in [5] for the Benjamin–Ono equation. As a technical key result in this paper, we show that the associated linearized operator L...... + = (−Δ) s +1−(α+1)Q α is non-degenerate; i.e., its kernel satisfies ker L + = span{Q′}. This result about L + proves a spectral assumption, which plays a central role for the stability of solitary waves and blowup analysis for non-linear dispersive PDEs with fractional Laplacians, such as the generalized...

  2. Fantasifull utflykt med skilda perspektiv : En studie om genus, normbrytning och stereotyper i bilderboken Se upp för krokodilen! (2013)

    OpenAIRE

    Ljungberg, Sofia

    2015-01-01

    Studien undersöker hur könsroller gestaltas ur ett genusperspektiv i bilderboken Se upp för krokodilen! (Moroni & Eriksson, 2013). Syftet är att få djupare kunskaper om hur dessa skildringar speglar målen i läroplanen för förskolan om att motverka traditionella könsnormer och främja jämställdhet och likabehandling mellan könen. Forskare menar att bilderboken är ett användbart och didaktiskt verktyg för att fånga barns intressen och påverka deras tankegångar. Tidigare forskning (Kåreland, ...

  3. Crystal growth and structure of KLnP/sub 4/O/sub 12/

    International Nuclear Information System (INIS)

    Guangyan, H.; Shuzhen, L.; Shuying, Y.; Mingyu, C.

    1985-01-01

    Potassium rare earth tetraphosphates KLnP/sub 4/O/sub 12/ are a kind of polyphosphates of rare earths with unique properties and structures. KNdP/sub 4/O/sub 12/ is a high-Nd-concentration laser material with a non-centrosymmetric space group P2, yielding linear and nonlinear optical properties. α-KErP/sub 4/O/sub 12/ might be used as a material for engineering device purpose. KTbP/sub 4/O/sub 12/ can emit strong green fluorescence, it might be a kind of a new crystal material for laser or luminescence. In order to search for new crystal materials and to study the correlations among the composition, structures and the properties of rare earth compounds, the crystal growth of KLnP/sub 4/O/sub 12/ and their structures are studied in this paper

  4. NASILJE V DRUŽINI

    OpenAIRE

    Marinčič, Maja

    2014-01-01

    Z nasiljem se dandanes človek srečuje na vseh področjih svojega življenja. Med različne vrste nasilja, ki jih poznamo spada tudi nasilje v družini. Diplomska naloga raziskuje področje nasilja v družini, saj predstavlja pereč problem današnje družbe. To pa zato ker je prisotno v vseh družbenih slojih, kulturah in religijah. Zmotno je mišljenje, da se nasilje dogaja le v revnih in neizobraženih družinah. Predstavili in opisali smo različne oblike nasilja, te pa se pogosto med seboj tudi dopolnj...

  5. Muovit ja niiden hyödyntäminen elektroniikan näkökulmasta : käsikirja

    OpenAIRE

    Holmström, Jens

    2011-01-01

    Tämän työn tarkoituksena on antaa lukijalle tietoa muoveista. Työ avulla pitäisi pystyä muodos-tamaan kuva erilaisista muovilaaduista, niiden ominaisuuksista ja käyttökohteista. Tämän lisäksi työssä käsitellään muovien historiaa ja muovien erilaisia valmistus- ja tuotantomenetelmiä. Työssä myös käsitellään muovien kierrätystä sekä mietitty miten työn tietoja voidaan hyödyntää elektroniikka alalla. Työstä suurin osa on ollut tiedon keräämistä useammista lähteistä lyhyeen ja helposti sisäist...

  6. Arrowroot as a novel substrate for ethanol production by solid state simultaneous saccharification and fermentation

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Tian-xiang; Tang, Qing-li; Zhu, Zuo-hua [School of Chemical Engineering, Guizhou University, Guizhou, Guiyang 550003 (China); Wang, Feng [National Key Laboratory of Biochemical Engineering, Institute of Process Engineering, Chinese Academy of Sciences, Beijing 100190 (China)

    2010-08-15

    Ethanol production from Canna edulis Ker was successfully carried out by solid state simultaneous saccharification and fermentation. The enzymatic hydrolysis conditions of C. edulis were optimized by Plackett-Burman design. The effect of inert carrier (corncob and rice bran) on ethanol fermentation and the kinetics of solid state simultaneous saccharification and fermentation was investigated. It was found that C. edulis was an alternative substrate for ethanol production, 10.1% (v/v) of ethanol concentration can attained when 40 g corncob and 10 g rice bran per 100 g C. edulis powder were added for ethanol fermentation. No shortage of fermentable sugars was observed during solid state simultaneous saccharification and fermentation. There was no wastewater produced in the process of ethanol production from C. edulis with solid state simultaneous saccharification and fermentation and the ethanol yield of more than 0.28 tonne per one tonne feedstock was achieved. This is first report for ethanol production from C. edulis powder. (author)

  7. Vozy formule 1

    OpenAIRE

    Zbožínek, Adam

    2009-01-01

    Tato práce uvádí základní pravidla a předpoklady pro konstrukci a použití vozů formule 1. Hlavní zaměření je na aerodynamiku, která je nejdůležitější disciplínou v tomto motoristickém sportu, dále je tato práce zaměřena na základní faktory týkající se motoru vozu, kol, nové technologie KERS a provedení volantu. This work shows basic rules and conditions for construction and use of cars formula 1. The main part of this work focus on the aerodynamics which is the most important discipline of...

  8. Att sluta eller inte sluta : En litteraturstudie om tobaksavvänjningsmetoder

    OpenAIRE

    Bjellman, Karin

    2007-01-01

    Att sluta eller inte sluta? En litteraturstudie om tobaksavvänjningsmetoder Bjellman, K. Tobaksbruket har en lång historia, och de tobaksrelaterade sjukdomarna kostar samhället miljarder i sjukvårdskostnader och produktionsbortfall varje år. Andelen rökare minskar stadigt i Sverige, idag röker ca 15 procent av befolkningen. Resultaten från olika metoder för tobaksavvänjning är tämligen blygsamma, och ugefär nittio procent av de som slutar röka gör det på egen hand. Syftet med denna studie var...

  9. Steni muinasjutuvõistluse võitjad selgunud / Ants Roos, Ann Roos

    Index Scriptorium Estoniae

    Roos, Ants

    2008-01-01

    Steni XVI muinasjutuvõistluse žüriisse kuulusid: Ann Roos, Ants Roos, Leelo Tungal, Krista Kumberg, Leida Olszak, Ülle Väljataga. Tulemused: I koht Siim Niinelaid, II koht Julius Air Kull, III koht Mihkel Rammu. Žürii eriauhinnad: Anna Kristin Peterson, Elis Ruus, Rain Hallikas, Mariliis Peterson, Marjaliisa Palu, Karl Kirsimäe, Margaret Pulk. Ergutusauhinnad: Karmel Klaus, Martti Kaljuste, Kristina Korell, Mirjam Võsaste, Mihkel Põder, Iirys Kalde, Miriam Jamul, Mari-Ann Mägi, Ketlin Saar, Liisbeth Kirss. Muud eriauhinnad said: Allan Läll, Berle Mees, Anett Kuuse, Karl Erik Kübarsepp, Grete Tamm, Siim Niinelaid, Kaisa Marie Sipelgas, Ellen Anett Põldmaa, Evelin Laul, Karl Laas, Karl Stamm, Kerli Retter

  10. Vinstvarningars påverkan på företag i Large och Small Cap? :  

    OpenAIRE

    Maliqi, Agon; Persson, Henric

    2013-01-01

    Den här studien undersöker hur vinstvarningar påverkar stora och små företag. För att förklara dess påverkan på företagen har den effektiva marknadshypotesen och behavioral finance använts som grund. Avgränsningen har gjorts till Stockholmsbörsen då inga tidigare studier haft fokus på den. Empirin visar att företag i Large Cap påverkas med i snitt -4,63% och företagen i Small Cap med -8,42%. Large Cap visade signifikanta abnorma avkastningar under eventdatumet och dagen efter medan Small Cap ...

  11. Supersymmetry of anti-de Sitter black holes

    International Nuclear Information System (INIS)

    Caldarelli, Marco M.; Klemm, Dietmar

    1999-01-01

    We examine supersymmetry of four-dimensional asymptotically anti-de Sitter (AdS) dyonic black holes in the context of gauged N = 2 supergravity. Our calculations concentrate on black holes with unusual topology and their rotating generalizations, but we also reconsider the spherical rotating dyonic Ker-Newman-AdS black hole, whose supersymmetry properties have previously been investigated by Kostelecky and Perry within another approach. We find that in the case of spherical, toroidal or cylindrical event horizon topology, the black holes must rotate in order to preserve some supersymmetry; the non-rotating supersymmetric configurations representing naked singularities. However, we show that this is no more true for black holes whose event horizons are Riemann surfaces of genus g > 1, where we find a non-rotating extremal solitonic black hole carrying magnetic charge and permitting one Killing spinor. For the non-rotating supersymmetric configurations of various topologies, all Killing spinors are explicitly constructed

  12. Att lita på andras blodgåva : Åsikter om att homosexuella män i praktiken nekas donera blod

    OpenAIRE

    Elwin, Elin

    2015-01-01

    Denna kandidatuppsats undersöker vilka upp­fattningar sjuksköterskor och homo­sexuella män har kring reglerna för blodgivning, med inriktning på att homosexuella män i praktiken inte får donera blod. Studien har genomförts med kvalitativ intervju som metod. Resultatet framhäver att mina informanter klassificerat blod och människor olika, där både utländskt blod och svenskt blod rangordnas efter potentiell risk för smitta. Sjuksköterskorna och de homosexuella männen hanterar även reglerna olik...

  13. Att tillämpa återkommande mätning av kundnöjdhet i IT-projekt : En vidareutvecklad modell baserad på modellerna American Customer Satisfaction Index (ACSI) och SERVQUAL

    OpenAIRE

    Karlmats, Roberg; Karlsson, Daniel

    2015-01-01

    I dagens samhälle är det allt viktigare för företag att behålla sina existerande kunder då konkurrensen blir allt hårdare. Detta medför att företag försöker vidta åtgärder för att vårda relationer med sina kunder. Detta problem är även högst relevant inom IT-branschen. Inom IT-branschen är det vanligt att arbeta agilt i IT-projekt. Vår samarbetspartner har sett ett ökat behov av att mäta servicekvalitet på ett återkommande sätt inom IT-projekt, detta för att mäta relevanta variabler som sträc...

  14. Finansiering av investeringar i immateriella tillgångar

    OpenAIRE

    Voltaire, Christian; Gillebrink, Valerie

    2008-01-01

    Vid en bedömning av ett kreditärende ser banken till projektets företagsekonomiska förutsättningar. För företag som har immateriella tillgångar som de viktigaste tillgångarna i sin redovisning kan det uppstå problem när de ansöker om kredit hos banker. Detta beror på att immateriella tillgångar inte fungerar på samma sätt som materiella och därigenom tillbringar vag säkerhet för en beviljad kredit. Syftet med denna uppsats är att söka finna vad det är som krävs för att ett tjänsteföretag ska ...

  15. Kas nii nagu ikka? : Eesti Sisearhitektide Liidu 2010. aasta preemiad / Ene Läkk

    Index Scriptorium Estoniae

    Läkk, Ene, 1957-

    2011-01-01

    Konkursist "Eesti interjöörid ja mööblidisain 2010". Söögikoha interjööri preemia: kohvik Supelsaksad Pärnus (Ruth ja Anna Huimerind), ühiskondliku interjööri preemia: ADM Interactive'i bürooruumid Tallinnas (Tomomi Hayashi, Ahti Grünberg, Kerli Valk), ajaloolise interjööri preemia: Kihnu muuseum (Malle Jürgenson, Tea Tammelaan, Krista Lepland, Jaak Huimerind, Indrek Laos), näituse- ja installatsiooni kujunduse preemia: rändnäitus "Eesti kirjanik karikatuuris" (Janno Siimar, Kaarel Vahtramäe, Mart Lankots, Liina Jakobson), tudengipreemia - Aet Tera. 24 nominenti loetletud

  16. Livsbalans i det nya arbetslivet : En kvantitativ studie om chefer och övriga anställda

    OpenAIRE

    Eltell, Maria; Nordin, Matilda

    2014-01-01

    Syfte: Det nya arbetslivet har inneburit en rad förändringar för den lönearbetande populationen i Sverige, gällande allt ifrån tid, rum och tillgänglighet i de alltmer flexibla arbetsvillkoren. Syftet med denna studie är därför att undersöka ett antal faktorer i det nya arbetslivet som kan ha inverkan på den lönearbetande populationens livsbalans. Studien undersöker också om det finns skillnader mellan chefers och övriga anställdas livsbalans samt även om chefens nivå i hierarkin påverkar liv...

  17. Let’s Play – Why watch? : En enkätundersökning om Let’s Play genren på YouTube

    OpenAIRE

    Havia, Mats

    2017-01-01

    Detta examensarbete är en webbundersökning inom Let’s Play genren på YouTube. Målet var att göra en forskning som svara på frågan ”Vilka är orsakerna till att man tittar på Let’s Play videor på YouTube?”. För att få svar på denna forskningsfråga användes Uses and Gratifications Theory (UGT). UGT baserar sig på att människor aktivt söker efter specifika medier och innehåll för att få specifika tillfredställelser eller resultat. Som litteratur användes Introducing Communications Theory, kapitel...

  18. Overview of the ATLAS Fast Tracker Project

    CERN Document Server

    AUTHOR|(INSPIRE)INSPIRE-00025195; The ATLAS collaboration

    2016-01-01

    The next LHC runs, with a significant increase in instantaneous luminosity, will provide a big challenge for the trigger and data acquisition systems of all the experiments. An intensive use of the tracking information at the trigger level will be important to keep high efficiency for interesting events despite the increase in multiple collisions per bunch crossing. In order to increase the use of tracks within the High Level Trigger, the ATLAS experiment planned the installation of a hardware processor dedicated to tracking: the Fast TracKer processor. The Fast Tracker is designed to perform full scan track reconstruction of every event accepted by the ATLAS first level hardware trigger. To achieve this goal the system uses a parallel architecture, with algorithms designed to exploit the computing power of custom Associative Memory chips, and modern field programmable gate arrays. The processor will provide computing power to reconstruct tracks with transverse momentum greater than 1 GeV in the whole trackin...

  19. Design of a Hardware Track Finder (Fast Tracker) for the ATLAS Trigger

    CERN Document Server

    AUTHOR|(INSPIRE)INSPIRE-00010976; Albicocco, P.; Alison, J.; Ancu, L.S.; Anderson, J.; Andari, N.; Andreani, A.; Andreazza, A.; Annovi, A.; Antonelli, M.; Asbah, N.; Atkinson, M.; Baines, J.; Barberio, E.; Beccherle, R.; Beretta, M.; Bertolucci, F.; Biesuz, N.V.; Blair, R.; Bogdan, M.; Boveia, A.; Britzger, D.; Bryant, P.; Burghgrave, B.; Calderini, G.; Camplani, A.; Cavasinni, V.; Chakraborty, D.; Chang, P.; Cheng, Y.; Citraro, S.; Citterio, M.; Crescioli, F.; Dawe, N.; Dell'Orso, M.; Donati, S.; Dondero, P.; Drake, G.; Gadomski, S.; Gatta, M.; Gentsos, C.; Giannetti, P.; Gkaitatzis, S.; Gramling, J.; Howarth, J.W.; Iizawa, T.; Ilic, N.; Jiang, Z.; Kaji, T.; Kasten, M.; Kawaguchi, Y.; Kim, Y.K.; Kimura, N.; Klimkovich, T.; Kolb, M.; Kordas, K.; Krizka, K.; Kubota, T.; Lanza, A.; Li, H.L.; Liberali, V.; Lisovyi, M.; Liu, L.; Love, J.; Luciano, P.; Luongo, C.; Magalotti, D.; Maznas, I.; Meroni, C.; Mitani, T.; Nasimi, H.; Negri, A.; Neroutsos, P.; Neubauer, M.; Nikolaidis, S.; Okumura, Y.; Pandini, C.; Petridou, C.; Piendibene, M.; Proudfoot, J.; Rados, P.; Roda, C.; Rossi, E.; Sakurai, Y.; Sampsonidis, D.; Saxon, J.; Schmitt, S.; Schoening, A.; Shochet, M.; Shojaii, S.; Soltveit, H.; Sotiropoulou, C.L.; Stabile, A.; Swiatlowski, M.; Tang, F.; Taylor, P.T.; Testa, M.; Tompkins, L.; Vercesi, V.; Volpi, G.; Wang, R.; Watari, R.; Webster, J.; Wu, X.; Yorita, K.; Yurkewicz, A.; Zeng, J.C.; Zhang, J.; Zou, R.

    2016-01-01

    The use of tracking information at the trigger level in the LHC Run II period is crucial for the trigger an data acquisition (TDAQ) system and will be even more so as contemporary collisions that occur at every bunch crossing will increase in Run III. The Fast TracKer (FTK) is part of the ATLAS trigger upgrade project; it is a hardware processor that will provide every Level-1 accepted event (100 kHz) and within 100$\\mu$s, full tracking information for tracks with momentum as low as 1 GeV. Providing fast, extensive access to tracking information, with resolution comparable to the offline reconstruction, FTK will help in precise detection of the primary and secondary vertices to ensure robust selections and improve the trigger performance.

  20. «Selvbestemt abort – et sykepleiefaglig ansvar?»

    OpenAIRE

    Husebø, Karen Søyland; Brynildsrud, Nina Espedal

    2015-01-01

    Problemstilling: «Hvorfor søker unge kvinner i Norge abort, og hva kan bidra til å redusere aborttallene?» og «Hvordan ivareta den abortsøkende kvinne på sykehus?» Hensikt: I denne oppgaven vil vi se nærmere på hvilke kvinner som tar provosert abort, og hva som gjør at nettopp disse kvinnene velger dette. Vi skal også ta for oss hvilke tiltak som kan være med på å redusere aborttallene. Til slutt vil vi se på hva som er viktig i ivaretagelsen av kvinner som kommer til sykehuset for å ta...

  1. Vindkraftverk av UHPC 2.2 : En undersökning av högpresterande betong med syntetfiberarmeringen STRUX

    OpenAIRE

    Rydén, Michaéla; Nilsson, Thina

    2013-01-01

    Användandet av betong som ersättare för stål vid produktionen av vindkraftverkstorn har ökat den senaste tiden. Betongtorn är betydligt billigare än ståltorn men problem som sprickbildningar, frostsprängningar och följaktligen armeringskorrosion har uppstått bl a på grund av vibrationer från rotorn. I fundamentet i vindkraftverk kan ovan nämnda problem också uppstå och det uppfyller således inte alltid funktionskraven. Det här examensarbetet undersöker möjligheten att eliminera dessa problem ...

  2. Motivation : En studie om lärares och elevers syn på motivation i skolan

    OpenAIRE

    Sundström, Jenny; Wiman, Malin

    2009-01-01

    I vårt examensarbete undersöker vi olika typer av motivation. Vårt syfte med arbetet var att undersöka lärares syn motivation samt elevers egen motivation i skolan. De frågeställningar vi utgick från var: 1. Vilken typ av motivation har elever i år 4 och år 5? 2. Finns det någon skillnad mellan pojkars och flickors motivation? 3. Vilken typ av motivation strävar lärare efter att elever ska erhålla och använda sig av? 4. Hur ser lärare på intrinsic (inre) motivation, extrinsic (yttre) motivati...

  3. Ülemaaline ilulugejate 15. võistulausumine

    Index Scriptorium Estoniae

    2008-01-01

    Vabariiklikust etlejate konkursist. 4.-6. klasside arvestuses võitis Grand Prix'i Markkus Pulk, laureaatideks tulid Maria Pihlak, Kenneth Norden ja Laura Elisabeth Konsand. Eripreemiad said Laura Oolup, Maria Zaitseva, žürii aitähi said Sander Aavik ja Liisa Lutter. 7.-9. klasside arvestuses võitis Grand Prix' Anna Talvi, laureaatideks tulid Liisa Saaremäel, Karmen Kozma, Riko Osila. Eripreemiad said Indrek Jõe, Eliise Seedre, žürii aitähi sai Kirke Algma. 10.-12. klasside arvestuses võitis Grand Prix' Doris Tääker, laureaatideks tulid Jörgen Liik, Virgo Ernits ja Ilja Massalov. eripreemiad said Marian Heinat ja Kadri Toomsalu. Kuressaare Gümnaasiumi õpilasžürii preemiad läksid Kenneth Nordenile, Riko Osilale ja Doris Tääkerile

  4. Comparison of Regenerative Braking Efficiencies of MY2012 and MY2013 Nissan Leaf

    Directory of Open Access Journals (Sweden)

    Albert Boretti

    2016-07-01

    Full Text Available The use of kinetic energy recovery systems (KERS is the best solution presently available to dramatically improve the energy economy of passenger cars. The paper presents an experimental analysis of the energy flow to and from the battery of a MY 2012 and a MY 2013 Nissan Leaf covering the Urban Dynamometer Driving Schedule (UDDS. The two vehicles differ for the integration of the electric drivetrain component, plus a different use of the electric motor and the regenerative brakes, in addition to a different weight. It is shown that while the efficiency propulsive power to vehicle / power from battery are basically unchanged, at about 87-89 %, the efficiency power to the battery / braking power to vehicle are significantly improved from values of about 70-80 % to values of 72-87 %. The analysis provides a state-of-the-art benchmark of the propulsion and regenerative braking efficiencies of electric vehicles.

  5. Street Food Suomessa ja liiketoimintasuunnitelma katuruokayritykselle

    OpenAIRE

    Hellman, Joonas; Koski, Olli

    2016-01-01

    Tämän opinnäytetyön tarkoituksena oli kerätä tietoa katuruoasta Suomessa ja tuottaa taustatietoa oman yrityksen liiketoimintasuunnitelmaa varten. Teoriatiedot hankittiin pääasiassa alan kirjallisuudesta, Internet-lähteistä sekä käyttäen hyväksi omaa ja alan yleistä tietoa. Tutkimusosa koostuu kyselytutkimuksesta ja sen analysoimisesta. Opinnäytetyön tekijät osallistuivat Ravintolapäivään saadakseen käytännön kokemusta ja tietoa. Kaikkia kolmea edellä mainittua osa-aluetta käytettiin päät...

  6.  Svensk företagsetablering i Dubai :   - en studie om företagens motiv och processer

    OpenAIRE

    Thaqi, Alban; Edvinsson, Sandra

    2010-01-01

    Inledning Ett ökat intresse för globalisering har gjort att företag söker sig till nya marknader kontinuerligt, svenska företag utgör inget undantag. En mycket aktuell marknad för utlandsetablering är Dubai. Från att ha varit ett litet fisk- och pärlsamhälle är det idag ett globalt center för affärer som attraherar aktörer från hela världen. Syfte Syftet med studien är att undersöka varför samt hur svenska företag väljer att etablera sig i Dubai. Metod Studien bygger på en kvalitativ metod...

  7. METODOLOGIJA ZA DIMENZIONIRANJE NESEMAFORIZIRANIH NIVOJSKIH KRIŽIŠČ

    OpenAIRE

    Vogrinec, Petra

    2010-01-01

    Promet je pomemben dejavnik v razvoju človeštva. Omogoča transport ljudi, tovora in informacij. Ker se cestni promet iz leta v leto povečuje, prihaja do večjih zamud in kolon na cestah in v križiščih. Če so povprečne zamude prevelike, je treba izvesti ukrepe za povečanje prepustnosti ceste oziroma križišča. V diplomi je predstavljena metodologija za dimenzioniranje nesemaforiziranih nivojskih križišč. Poudarek je na križišču glavne in stranske ceste. Izračun je narejen po »Highway Capacity...

  8. Lääkehoidon huomioiminen fysioterapiassa fysioterapeuttien kokemana

    OpenAIRE

    Arkko, Maiju

    2014-01-01

    Opinnäytetyö selvittää fysioterapeuttien käsityksiä heidän omasta lääkehoidon osaamisestaan. Työ on tarkoitettu lähinnä fysioterapeuttikoulutuksen opettajien käyttöön, mutta sitä voidaan käyttää myös materiaalina, mikäli halutaan saada tietoa esimerkiksi opinnäytetyössä esiintyvien lääkkeiden vaikutuksista. Tutkimus on laadullinen, ja se on toteutettu Delfoi-menetelmällä. Tutkimuksen aineisto kerättiin sähköpostin välityksellä tutkimukseen osallistuneilta neljältä fysioterapeutilta, jotk...

  9. Förvaltningen av en bostadsrättsförening : –en studie med utgångspunkt från medlemmarnas ekonomiska intresse

    OpenAIRE

    Forsén, Rikard; Andersson, Rickard

    2009-01-01

    Bakgrund:  Bostadsrätten  utgör  en  alltmer  attraktiv  boendeform  och  dess  främsta  syfte  är  att tillgodose dess medlemmar med ett prisvärt boende. Månadsavgifterna från bostadsrättsförenings medlemmar bidrar  till att alla kostnader  täcks upp och därmed är boendekostnaden beroende av hur bostadsrättsföreningens kostnader hanteras. Denna studie undersöker hur verksamheten  i en bostadsrättsförening är förenlig med att verka för medlemmarnas bästa ekonomiska intresse.   Syfte: Syftet m...

  10. ATLAS Fast Tracker Status and Tracking at High luminosity LHC

    CERN Document Server

    Ilic, Nikolina; The ATLAS collaboration

    2018-01-01

    The LHC’s increase in centre of mass energy and luminosity in 2015 makes controlling trigger rates with high efficiency challenging. The ATLAS Fast TracKer (FTK) is a hardware processor built to reconstruct tracks at a rate of up to 100 kHz and provide them to the high level trigger. The FTK reconstructs tracks by matching incoming detector hits with pre-defined track patterns stored in associative memory on custom ASICs. Inner detector hits are fit to these track patterns using modern FPGAs. This talk describes the electronics system used for the FTK’s massive parallelization. The installation, commissioning and running of the system is happening in 2016, and is detailed in this talk. Tracking at High luminosity LHC is also presented.

  11. "Stendum, feg och impotent är Turkiets president" : En kvalitativ innehållsanalys av den tyska mediedebatten om Jan Böhmermann-affären utifrån olika argument för yttrandefrihet.

    OpenAIRE

    Lindström, Malin

    2017-01-01

    Den här uppsatsen undersöker argument för yttrandefrihet som framkommit i den så kallade Böhmermannaffären som inträffade våren 2016 i Tyskland, då den tyska satirikern Jan Böhmermann läste upp en niddikt om Turkiets president Recep Tayyip Erdoğan. Erdoğan kände sig kränkt och anmälde Böhmermann enligt ett tyskt lagrum. Undersökningen syftar till att utröna vilka typargument för yttrandefrihet som framkommit i debatten om Böhmermannaffären från olika aktörer och utifrån vilket intresse dessa ...

  12. Person till person kommunikation : Sociala mediers inverkan på det uppkopplade samhället

    OpenAIRE

    Kärrholm, Dan; Johansson, Henrik

    2016-01-01

    Denna kandidatuppsats undersöker eventuella risker för person till person kommunikation som kan härstammar i användning av moderna tekniken och de sociala medierna. Syftet är att ta reda på vilka konsekvenser som förekommer när man överkonsumerar modern teknik och diverse sociala medier (t.ex. Facebook, Twitter, instagram och Myspace). Undersökningen kommer sedan ligga till grund för ett gestaltningsarbete där fokusen ligger på att söka en teknik som kan förbättra kommunikationen person till ...

  13. ODNOSI Z JAVNOSTMI IN OGLAŠEVANJE V E-ŠPORTIH

    OpenAIRE

    Druks, Luka

    2015-01-01

    Diplomsko delo govori o odnosih z javnostmi in oglaševanju v e-športih. Glavni named diplomske naloge je, da se predstavi uporaba odnosov z javnostmi in oglaševanja v e-športih. Najprej so v teoretičnem delu predstavljeni odnosi z javnostmi, oglaševanje in e-športi. V praktičnem pa je opisana uporaba odnosov z javnostmi in oglaševanja v ukrajinski e-šport organizaciji Natus Vincere. Ugotovili smo, da zastavljena teza ne drži, ker oglaševanje zaradi večjega finančnega vložka za e-šport...

  14. Complementing network security to the ISO/IEC 27000 standard

    OpenAIRE

    Alila, Patrick

    2007-01-01

    I syfte att öppna upp nya affärsmöjligheter för informationssäkerhetsföretaget Secure State AB, har detta arbete bedrivits för att komplettera företagets nuvarande standard för informationssäkerhetsarbete med ytterligare nätverkssäkerhet. Krav på slutresultatet var att dokumentet eller standarden skulle kunna komplettera ISO 27000, samt vara kostnadseffektivt. Efter en undersökning av den nämnda standarden konstaterades att enbart ISO 27000 i sig inte är ett fullgott verktyg för nätverkssäker...

  15. Työhyvinvointi on kaikkien yhteinen asia

    OpenAIRE

    Jukantupa, Anna

    2015-01-01

    Opinnäytetyön tarkoituksena oli selvittää erään päihde- ja mielenterveystyötä tekevän asumispalveluyksikön henkilöstön kokemuksia työhyvinvointiin vaikuttavista asioista ja miten näihin asioihin voi itse vaikuttaa. Tavoitteena oli lisäksi saada tietoa henkilöstön halukkuudesta osallistua työyhteisön yhteisiin työhyvinvointia ylläpitäviin hetkiin sekä kerätä tietoa, millainen tällaisen hetken sisältö voisi olla. Anonymiteetin takaamiseksi ei paljastettu yhteistyötahon nimeä. Tutkimuksen ...

  16. Discriminating leptonic Yukawa interactions with doubly charged scalar at the ILC

    Science.gov (United States)

    Nomura, Takaaki; Okada, Hiroshi; Yokoya, Hiroshi

    2018-04-01

    We explore discrimination of two types of leptonic Yukawa interactions associated with Higgs triplet, LbarLc ΔLL, and with SU (2) singlet doubly charged scalar, ebarRc k++eR. These interactions can be distinguished by measuring the effects of doubly charged scalar boson exchange in the e+e- →ℓ+ℓ- processes at polarized electron-positron colliders. We study a forward-backward asymmetry of scattering angular distribution to estimate the sensitivity for these effects at the ILC. In addition, we investigate prospects of upper bounds on the Yukawa couplings by combining the constraints of lepton flavor violation processes and the e+e- →ℓ+ℓ- processes at the LEP and the ILC.

  17. Photoionization of helium dimers; Photoionisation von Heliumdimeren

    Energy Technology Data Exchange (ETDEWEB)

    Havermeier, Tilo

    2010-06-09

    The helium dimer is one of the most weakly bound systems in the universe. This makes it an interesting quantum mechanical object for investigation. These Van der Waals Clusters can be produced in an expansion of a cryogenic gas jet through a small nozzle into vacuum. In the present experiment we examine the interaction of He dimers with synchrotron radiation at an energy range from 64 to 78 eV. We observed different pathways leading to single ionization of both He atoms of the dimer compound. This two close standing ions begin now to dissociate in cause of their coulomb potential. All charged fragments were detected in coincidence with a COLTRIMS system. Especially Interatomic Coulombic Decay (ICD) and the two step process (TS1) were clearly identified. Furthermore a distribution of the internuclear distance was obtained from the measured Kinetic Energy Release (KER). (orig.)

  18. Den koreanske bølgen - En kulturvitenskapelig studie av sørkoreansk populærkultur, og hvordan den har nådd Vesten

    OpenAIRE

    Kvinge, Kristin Øyvindsdatter

    2016-01-01

    Hensikten med denne oppgaven er å se på den koreanske bølgen, som ofte refereres til som Hallyu. Den tar for seg både Hallyu som innhold og Hallyu som fenomen. Den koreanske bølgen har spredd seg hurtig i løpet av de siste 20 årene, noe som har bidratt til å gjøre Korea til en av de hurtigst økende økonomiene i den moderne tid. Denne oppgaven forsøker å se nærmere på hvordan Hallyu har nådd Vesten, med fokus på Europa og Norge. Før analysen vil oppgaven se nærmere på hv...

  19. Imageskapande och marknadsföringskommunikation : En deskriptiv studie om Örebro Bostäders arbete i Vivalla och Markbacken

    OpenAIRE

    Abedian Sanandaji, Foad

    2011-01-01

    Slutsatsen efter genomfört arbetet är att Örebro Bostäder AB bland annat har en önskvärd image av Vivalla som ett område med en unik och personlig omgivning med mindre individuella bostadsområden där det finns något för alla smaker. I Markbacken vill Öbo behålla och förstärka en image av variation, där allt från barnfamiljer till den som söker ett lite mer exklusivt boende skall lockas. Vidare har undersökningen visat att dessa önskvärda imager främst förmedlas via mun till mun-metoden, massm...

  20. Jammets Topologi : Från Jam Session till South Park

    OpenAIRE

    Nygren, Johan; Masth, Kalle

    2015-01-01

    I denna uppsats undersöker vi Game/Media Jam, Hackathon och liknande koncept och försökerskapa en metod för att ta fram en modell för deras topologi. Vi ämnar att undersöka degemensamma punkterna Jams och Hackathons har via deras regler, samt jämföra detta med JamSessions. Vidare kommer vi försöka identifiera reglernas syften. Dessa syften sätter vi i entopologiskt mätbar intervall som sedan kan överföras på den topologisk modellen. Sedan användsdessa resultat för att jämföra regelrätta Jams/...