A decade of user operation on the macromolecular crystallography MAD beamline ID14-4 at the ESRF
International Nuclear Information System (INIS)
McCarthy, Andrew A.; Brockhauser, Sandor; Nurizzo, Didier; Theveneau, Pascal; Mairs, Trevor; Spruce, Darren; Guijarro, Matias; Lesourd, Marc; Ravelli, Raimond B. G.; McSweeney, Sean
2009-01-01
The improvement of the X-ray beam quality achieved on ID14-4 by the installation of new X-ray optical elements is described. ID14-4 at the ESRF is the first tunable undulator-based macromolecular crystallography beamline that can celebrate a decade of user service. During this time ID14-4 has not only been instrumental in the determination of the structures of biologically important molecules but has also contributed significantly to the development of various instruments, novel data collection schemes and pioneering radiation damage studies on biological samples. Here, the evolution of ID14-4 over the last decade is presented, and some of the major improvements that were carried out in order to maintain its status as one of the most productive macromolecular crystallography beamlines are highlighted. The experimental hutch has been upgraded to accommodate a high-precision diffractometer, a sample changer and a large CCD detector. More recently, the optical hutch has been refurbished in order to improve the X-ray beam quality on ID14-4 and to incorporate the most modern and robust optical elements used at other ESRF beamlines. These new optical elements will be described and their effect on beam stability discussed. These studies may be useful in the design, construction and maintenance of future X-ray beamlines for macromolecular crystallography and indeed other applications, such as those planned for the ESRF upgrade
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFJ144 (Link to dictyBase) - - - Contig-U12576-1 - (Link to Or...iginal site) - - VFJ144Z 698 - - - - Show VFJ144 Library VF (Link to library) Clone ID VFJ144 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dictycdb.b...IGIDDELGPQLFKVDPAGVFTGYKATAAGEKEQESTNFLEKK FKSNPQLSKDETIQMAISTLQSVLGADLKPSDLEIGICTMDNRKFVIMTDED Translated A...PQLFKVDPAGVFTGYKATAAGEKEQESTNFLEKK FKSNPQLSKDETIQMAISTLQSVLGADLKPSDLEIGICTMDNRKFVIMTDED Frame B: ---givrkyl*
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFH144 (Link to dictyBase) - - - - VFH144P (Link to Original s...ite) VFH144F 641 VFH144Z 312 VFH144P 953 - - Show VFH144 Library VF (Link to library) Clone ID VFH144 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts...nces producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostel...RNA sequence. 42 8e-04 2 AY342298 |AY342298.1 Ictalurus punctatus ER-resident chaperone calreticulin mRNA, c
Babakhanyan, Anna; Leke, Rose G. F.; Salanti, Ali; Bobbili, Naveen; Gwanmesia, Philomina; Leke, Robert J. I.; Quakyi, Isabella A.; Chen, John J.; Taylor, Diane Wallace
2014-01-01
In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women naturally acquire antibodies to ID1-ID2a and if antibodies to ID1-ID2a correlate with absence of placental malaria at delivery. Antibody levels to full-length VAR2CSA and ID1-ID2a were measured in plasma samples from 745 pregnant Cameroonian women, 144 Cameroonian men, and 66 US subjects. IgM levels and IgG avidity to ID1-ID2a were also determined. As expected, antibodies to ID1-ID2a were absent in US controls. Although pregnant Cameroonian women developed increasing levels of antibodies to full-length VAR2CSA during pregnancy, no increase in either IgM or IgG to ID1-ID2a was observed. Surprisingly, no differences in antibody levels to ID1-ID2a were detected between Cameroonian men and pregnant women. For example, in rural settings only 8–9% of males had antibodies to full-length VAR2CSA, but 90–96% had antibodies to ID1-ID2a. In addition, no significant difference in the avidity of IgG to ID1-ID2a was found between pregnant women and Cameroonian men, and no correlation between antibody levels at delivery and absence of placental malaria was found. Thus, the response to ID1-ID2a was not pregnancy specific, but predominantly against cross-reactivity epitopes, which may have been induced by other PfEMP1 antigens, malarial antigens, or microbes. Currently, ID1-ID2a is a leading vaccine candidate, since it binds to the CSA with the same affinity as the full-length molecule and elicits binding-inhibitory antibodies in animals. Further studies are needed to determine if the presence of naturally acquired cross-reactive antibodies in women living in malaria endemic countries will alter the response to ID1-ID2a following vaccination with ID1-ID2a. PMID:24505415
Directory of Open Access Journals (Sweden)
Anna Babakhanyan
Full Text Available In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women naturally acquire antibodies to ID1-ID2a and if antibodies to ID1-ID2a correlate with absence of placental malaria at delivery. Antibody levels to full-length VAR2CSA and ID1-ID2a were measured in plasma samples from 745 pregnant Cameroonian women, 144 Cameroonian men, and 66 US subjects. IgM levels and IgG avidity to ID1-ID2a were also determined. As expected, antibodies to ID1-ID2a were absent in US controls. Although pregnant Cameroonian women developed increasing levels of antibodies to full-length VAR2CSA during pregnancy, no increase in either IgM or IgG to ID1-ID2a was observed. Surprisingly, no differences in antibody levels to ID1-ID2a were detected between Cameroonian men and pregnant women. For example, in rural settings only 8-9% of males had antibodies to full-length VAR2CSA, but 90-96% had antibodies to ID1-ID2a. In addition, no significant difference in the avidity of IgG to ID1-ID2a was found between pregnant women and Cameroonian men, and no correlation between antibody levels at delivery and absence of placental malaria was found. Thus, the response to ID1-ID2a was not pregnancy specific, but predominantly against cross-reactivity epitopes, which may have been induced by other PfEMP1 antigens, malarial antigens, or microbes. Currently, ID1-ID2a is a leading vaccine candidate, since it binds to the CSA with the same affinity as the full-length molecule and elicits binding-inhibitory antibodies in animals. Further studies are needed to determine if the presence of naturally acquired cross-reactive antibodies in women living in malaria endemic countries will alter the response to ID1-ID2a following vaccination with ID1-ID2a.
Critical evaluation of radioactive decay constants for 99Mo, 144Ce, 144Pr and 144Pm
International Nuclear Information System (INIS)
Grigor'yan, Yu.I.; Sokolovskij, L.L.; Chukreev, F.E.
1976-01-01
The decay schemes of 99 Mo, 144 Ce, 144 Pr, 144 Pm are reviewed on the basis of analysis of a large number of published experimental works. A knowledge of the decay constants of the first three nuclei, which are fission products, is of great importance in developing safeguards methods. Quantities characterizing the β-decay of 99 Mo, 144 Ce, 144 Pr and K-electron capture ( 144 Pm) are evaluated. Level schemes are plotted for the daughter nuclei. Evaluations are made in respect of the energies and intensities of γ-rays and conversion electrons accompanying β-decay and K-electron capture, internal conversion coefficients and transition multipolarities, level energies, spins, parities, and lifetimes of the ground and excited states of 99 Tc, 144 Pr, and 144 Nd. From the results obtained the 99 Mo- 99 Tc mass difference can be deduced and a new value of 1358.0 +- 3.0 keV is established instead of the previously used value of 1372.2 +- 3.9 keV. The analagous quantity for the nuclei 144 Pr- 144 Nd is taken as 2994.6 +- 3.2 keV instead of the value 2997.0 +- 3.0 keV. (author)
A proposed HTTP service based IDS
Directory of Open Access Journals (Sweden)
Mohamed M. Abd-Eldayem
2014-03-01
Full Text Available The tremendous growth of the web-based applications has increased information security vulnerabilities over the Internet. Security administrators use Intrusion-Detection System (IDS to monitor network traffic and host activities to detect attacks against hosts and network resources. In this paper IDS based on Naïve Bayes classifier is analyzed. The main objective is to enhance IDS performance through preparing the training data set allowing to detect malicious connections that exploit the http service. Results of application are demonstrated and discussed. In the training phase of the proposed IDS, at first a feature selection technique based on Naïve Bayes classifier is used, this technique identifies the most important HTTP traffic features that can be used to detect HTTP attacks. In the testing and running phases proposed IDS classifies the network traffic based on the requested service, then based on the selected features Naïve Bayes classifier is used to analyze the HTTP service based traffic and identifies the HTTP normal connections and attacks. The performance of the IDS is measured through experiments using NSL-KDD data set. The results show that the detection rate of the IDS is about 99%, the false-positive rate is about 1%, and the false-negative rate is about 0.25%; therefore, proposed IDS holds the highest detection rate and the lowest false alarm compared with other leading IDS. In addition, the proposed IDS based on Naïve Bayes is used to classify network connections as a normal or attack. And it holds a high detection rate and a low false alarm.
International Nuclear Information System (INIS)
Sharma, Pankaj; Patel, Divya; Chaudhary, Jaideep
2012-01-01
As transcriptional regulators of basic helix–oop–helix (bHLH) transcription and non-bHLH factors, the inhibitor of differentiation (Id1, Id2, Id3, and Id4) proteins play a critical role in coordinated regulation of cell growth, differentiation, tumorigenesis, and angiogenesis. Id1 regulates prostate cancer (PCa) cell proliferation, apoptosis, and androgen independence, but its clinical significance in PCa remains controversial. Moreover, there is lack of evidence on the expression of Id2 and Id3 in PCa progression. In this study we investigated the expression of Id2 and Id3 and reevaluated the expression of Id1 in PCa. We show that increased Id1 and Id3 protein expression is strongly associated with increasing grade of PCa. At the molecular level, we report that silencing either Id1 or Id3 attenuates cell cycle. Although structurally and mechanistically similar, our results show that both these proteins are noncompensatory at least in PCa progression. Moreover, through gene silencing approaches we show that Id1 and Id3 primarily attenuates CDKN1A (p21) and CDKN1B (p27), respectively. We also demonstrate that silencing Id3 alone significantly attenuates proliferation of PCa cells as compared with Id1. We propose that increased Id1 and Id3 expression attenuates all three cyclin-dependent kinase inhibitors (CDKN2B, -1A, and -1B) resulting in a more aggressive PCa phenotype
Now called RSA SecurID, SecurID is a mechanism developed by Security Dynamics that allows two-factor authentication for a user on a network resource. It works on the principle of the unique password mode, based on a shared secret. Every sixty seconds, the component generates a new six-digit token on the screen. The latter comes from the current time (internal clock) and the seed (SecurID private key that is available on the component, and is also from the SecurID server). During an authentication request, the SecurID server will check the entered token by performing exactly the same calculation as that performed by your component. The server knows the two information required for this calculation: the current time and the seed of your component. Access is allowed if the token calculated by the server matches the token you specified.
Angiotensin-converting enzyme I/D polymorphism in chronic obstructive pulmonary disease
Directory of Open Access Journals (Sweden)
Pabst S
2009-12-01
Full Text Available Abstract Study objective The etiology of chronic obstructive lung disease (COPD is unclear. It is supposed to be the product of an exogenous antigenic stimulus, such as tobacco smoke, and an endogenous genetic susceptibility. The angiotensin-converting enzyme (ACE gene contains a polymorphism based on the presence (insertion [I] or absence (deletion [D] of a 287-bp nonsense domain, resulting in three different genotypes (II, ID and DD. The aim of the study was to find out whether the ACE gene polymorphism can determine the course of COPD. Patients and design We genotyped 152 Caucasian patients with COPD and 158 healthy controls for the ACE (I/D polymorphism. We divided the COPD group into one group of 64 patients with a stable course of disease, defined as less than three hospitalizations over the last three years due to COPD, and another group of 88 patients with an instable course with more than three hospitalizations. Results The I-allele was significantly associated with an increased risk for COPD in a dominant model (OR 1.67 (95% CI 1.00 to 2.78, p = 0.048, but not in a recessive or co-dominant model. Moreover, the I-allele of ACE (I/D was significantly increased in patients with a stable course of COPD (p = 0.012 compared with controls. In a dominant model (II/ID v DD we found an even stronger association between the I-allele and a stable course of COPD (OR 3.24 (95% CI 1.44 to 7.31, p = 0.003. Conclusion These data suggest that the presence of an ACE I-allele determines a stable course of COPD.
Assessment of a cerium---praseodymium-144 inhalation case
International Nuclear Information System (INIS)
Glenn, R.D.; Heid, K.R.; Houston, J.R.
1976-01-01
A case involving an acute exposure to a 144 Ce- 144 Pr contaminated atmosphere is presented with a discussion of the treatment and evaluation of data collected out to 800 days post intake. Treatment included irrigation of the upper nasal passages with normal saline, nebulization with normal saline mist and DTPA therapy. Assessment of the deposition and the resulting dose commitment was based on in vivo measurements and excretion data. The initial pulmonary burden, which cleared with three distinct half times, was estimated at 2.1 μCi of 144 Ce
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Employment. 144.140 Section 144.140 Foreign... PROGRAMS OR ACTIVITIES CONDUCTED BY THE UNITED STATES DEPARTMENT OF STATE § 144.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment...
Id-1 and Id-2 genes and products as markers of epithelial cancer
Desprez, Pierre-Yves [El Cerrito, CA; Campisi, Judith [Berkeley, CA
2008-09-30
A method for detection and prognosis of breast cancer and other types of cancer. The method comprises detecting expression, if any, for both an Id-1 and an Id-2 genes, or the ratio thereof, of gene products in samples of breast tissue obtained from a patient. When expressed, Id-1 gene is a prognostic indicator that breast cancer cells are invasive and metastatic, whereas Id-2 gene is a prognostic indicator that breast cancer cells are localized and noninvasive in the breast tissue.
International Nuclear Information System (INIS)
Jensen, H.J.; Gast, W.; Georgiev, A.; Jaeger, H.M.; Lieder, R.M.; Utzelmann, S.; Gierlik, M.; Morek, T.; Przestrzelska, K.; Rzaca-Urban, T.; Dewald, A.; Kuehn, R.; Meier, C.; Ender, C.; Haertlein, T.
1996-01-01
The lifetime measurements of excited states in 144 Gd were carried out using the Koeln RDM-plunger together with the 2 x 3 CLUSTER detector setup in Heidelberg. The nucleus was populated in the 100 Mo( 48 Ti,4n) 144 Gd reaction at a beam energy of 205 MeV giving a recoil velocity of v/c = 2.6 %. Three and higher fold γ-ray coincidences were measured at 12 target-stopper distances ranged from 0 to 400 μm. Both the dipole and quadrupole bands in 144 Gd have been observed. The analysis is in progress
Pengalaman Komunikasi Pelanggan Zalora.co.id (Studi Fenomenologi Pelanggan Zalora.co.id)
Aji, Widya Andhika; Pradekso, Tandiyo; Ulfa, Nurist Surayya
2013-01-01
1PENGALAMAN KOMUNIKASI PELANGGAN ZALORA.CO.ID(Studi Fenomenologi Pelanggan Zalora.co.id)Oleh:Widya Andhika AjiFakultas Ilmu Sosial dan Ilmu PolitikUniversitas Diponegoro SemarangABSTRAKPenelitian ini bertujuan untuk menganalisis pengalaman komunikasi danpemahaman penerimaan konsumen terkait pesan komunikasi pemasaran dalamberbelanja di Zalora.co.id. Dengan menggunakan sampel pada lima informandan metode wawancara, dapat ditarik kesimpulan: Pelanggan Zalora.co.idmemiliki pengalaman komunikasi ...
19 CFR 144.36 - Withdrawal for transportation.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Withdrawal for transportation. 144.36 Section 144... § 144.36 Withdrawal for transportation. (a) Time limit. Merchandise may be withdrawn from warehouse for transportation to another port of entry if withdrawal for consumption or exportation can be accomplished at the...
43 CFR 14.4 - Publication of petitions.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Publication of petitions. 14.4 Section 14.4 Public Lands: Interior Office of the Secretary of the Interior PETITIONS FOR RULEMAKING § 14.4 Publication of petitions. A petition for rulemaking may be published in the Federal Register if the official...
Kiss, István; Kiss, Zoltán; Kerkovits, Lóránt; Paksy, András; Ambrus, Csaba
2017-01-01
The relationship between smoking and mortality in patients on hemodialysis is controversial. Earlier studies showed that the insertion/deletion (I/D) polymorphism of the ACE gene might have an effect on mortality. The aim of this study was to test the impact of smoking on survival and whether this association was influenced by ACE gene I/D polymorphism in patients on maintenance hemodialysis. In this prospective, multicenter cohort study we analyzed 709 prevalent patients on maintenance hemodialysis. Patients were allocated into groups based on their smoking habit. Outcome data were collected during the 144-month follow-up period. Outcomes of current smokers and lifelong non-smokers were compared. In order to control for interactions between predictor variables, we also identified 160 matched pairs for further sub-analysis. The vast majority of patients (67%) were non-smokers, followed by current smokers (22.2%) and ex-smokers (9.8%). Smoking had no impact on survival in the matched pair analysis ( p = 0.99). After adjustment for ACE I/D polymorphism and other co-variates, smoking had no effect on survival. Our data suggest that smoking has no impact on survival; neither is it associated with ACE gene I/D polymorphism in hemodialysis patients.
Beam transport radiation shielding for branch lines 2-ID-B and 2-ID-C
International Nuclear Information System (INIS)
Feng, Y.P.; Lai, B.; McNulty, I.; Dejus, R.J.; Randall, K.J.; Yun, W.
1995-01-01
The x-ray radiation shielding requirements beyond the first optics enclosure have been considered for the beam transport of the 2-ID-B and 2-ID-C branch lines of Sector 2 (SRI-CAT) of the APS. The first three optical components (mirrors) of the 2-ID-B branch are contained within the shielded first optics enclosure. Calculations indicate that scattering of the primary synchrotron beam by beamline components outside the enclosure, such as apertures and monochromators, or by gas particles in case of vacuum failure is within safe limits for this branch. A standard 2.5-inch-diameter stainless steel pipe with 1/16-inch-thick walls provides adequate shielding to reduce the radiation dose equivalent rate to human tissue to below the maximum permissible limit of 0.25 mrem/hr. The 2-ID-C branch requires, between the first optics enclosure where only two mirrors are used and the housing for the third mirror, additional lead shielding (0.75 mm) and a minimum approach distance of 2.6 cm. A direct beam stop consisting of at least 4.5 mm of lead is also required immediately downstream of the third mirror for 2-ID-C. Finally, to stop the direct beam from escaping the experimental station, a beam stop consisting of at least 4-mm or 2.5-mm steel is required for the 2-ID-B or 2-ID-C branches, respectively. This final requirement can be met by the vacuum chambers used to house the experiments for both branch lines
46 CFR 201.144 - Offer of proof.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Offer of proof. 201.144 Section 201.144 Shipping... PROCEDURE Evidence (Rule 14) § 201.144 Offer of proof. An offer of proof made in connection with an... accompany the record as the offer of proof. ...
A brief review of revocable ID-based public key cryptosystem
Directory of Open Access Journals (Sweden)
Tsu-Yang Wu
2016-03-01
Full Text Available The design of ID-based cryptography has received much attention from researchers. However, how to revoke the misbehaviour/compromised user in ID-based public key cryptosystem becomes an important research issue. Recently, Tseng and Tsai proposed a novel public key cryptosystem called revocable ID-based public key cryptosystem (RIBE to solve the revocation problem. Later on, numerous research papers based on the Tseng-Tsai key RIBE were proposed. In this paper, we brief review Tseng and Tsai's RIBE. We hope this review can help the readers to understand the Tseng and Tsai's revocable ID-based public key cryptosystem.
Toxicity of 144Ce inhaled in a relatively insoluble form by beagle dogs
International Nuclear Information System (INIS)
Boecker, B.B.; Hahn, F.F.; Muggenburg, B.A.; Mauderly, J.L.; McClellan, R.O.; Pickrell, J.A.
1980-01-01
The metabolism, dosimetry and effects of 144 Ce inhaled in fused aluminosilicate particles are being investigated in the beagle dog to assess the long-term biological consequences of release of relatively insoluble aerosol forms of 144 Ce that could occur in nuclear accidents. The effects resulting from the relatively protracted radiation dose patterns to the lung from this form of 144 Ce are being compared with effects of other radiation dose patterns to the lung. One hundred eleven dogs were exposed to aerosols of 144 Ce in fused aluminosilicate particles to yield initial lung burdens of 0.0024 to 210 μCi/kg body weight and 15 control dogs were exposed to nonradioactive fused aluminosilicate particles. To date, 65 144 Ce-exposed and 2 control dogs have died or were euthanized at 143 to 4578 days after inhalation of 144 Ce. Prominent findings in the 144 Ce-exposed dogs were radiation pneumonitis in 17 dogs that died at early times and neoplastic disease in 39 of the 48 dogs that died 750 days or later. Observations are continuing on the 46 144 Ce-exposed and 13 control dogs remaining alive at this time, at least 3337 days after exposure
Thais, Savannah Jennifer; The ATLAS collaboration
2018-01-01
Efficient and accurate electron identification is of critical importance to measuring many physics processes with leptons in the final state, including H->4l, dark vector boson searches, and various SUSY searches. This poster will describe the current status of the Likelihood driven Electron ID, highlighting the recent move from a MC driven ID to a data-driven ID. It will include the most recent identification efficiency and scale-factor measurements. Additionally, it will describe continued improvements for Run 2 electron ID, highlighting improvements in the low pt region and potential Machine Learning improvements.
How to save distressed IDS-physician marriages: a case study.
Collins, H; Johnson, B A
1998-04-01
A hospital-driven IDS that encounters serious problems resulting from ownership of a physician practice should address those problems by focusing on three core areas: vision and leadership, effectiveness of operations, and physician compensation arrangements. If changes in these areas do not lead to improvements, the IDS may need to consider organizational restructuring. In one case study, a hospital-driven IDS faced the problem of owning a poorly performing MSO with a captive physician group. The IDS's governing board determined that the organization lacked effective communication with the physicians and that realization of the organization's vision would require greater physician involvement in organizational decision making. The organization is expected to undergo some corporate reorganization in which physicians will acquire an equity interest in the enterprise.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Export marks. 28.144... § 28.144 Export marks. (a) General Requirement. In addition to the marks and brands required to be... brewer shall mark the word “Export” on each container or case of beer, or the words “Beer concentrate for...
Tinjauan Desain Website Kemlu.Go.Id
Danu Widhyatmoko
2013-01-01
Review of kemlu.go.id website design is a research report on Kemlu.go.id website design. Kemlu.go.id website aims to be the information gateway of Ministry of Foreign Affairs, and also as guidelines of foreign politic policies of Republic of Indonesia. The review had been accomplished by using analytical method based on the "Nine Essential Principles for Good Web Design" developed by Collis Ta'eed (2007). At the end of the article, several recommendations in developing kemlu.go.id website are...
Energy Technology Data Exchange (ETDEWEB)
Remy, Jacques
1959-07-01
This academic report concerns a study during which cerium 144 has been intravenously injected to three-month old rats under the form of cerium chloride in aqueous solution with pH of 9,5. Rats have then been sacrificed at different times after the injection, and organ or tissue samplings have been performed to study the isotope distribution in their bodies. This allowed the calculation of internal irradiation doses locally received by the animal, and also to identify critical organs with respect to cerium 144. Thus, until the twentieth day after injection, liver is the critical organ. After, it is the skeleton, for the rest of the animal's life. The bone internal irradiation is the highest danger for an internal cerium 144 contamination, due to threats on body hematopoietic functions [French] Le Cerium 144 est injecte a des rats de trois mois par voie intraveineuse, sous forme de chlorure en solution aqueuse a pH = 9,5. Une telle solution est colloidale. Les rats sont sacrifies par groupe de 5 a des temps differents apres l'injection et des prelevements d'organes ou de tissus sont effectues qui permettent d'etudier la distribution de l'isotope dans l'organisme. Cette etude de la distribution du Cerium 144 dans l'organiqme du rat a permis egalement le calcul des doses d'irradiation interne recues localement par l'animal. Ces donnees permettent de definir les organes critiques de l'organisme pour le Cerium 144: Jusqu'au 20eme jour l'organe critique est le foie. Ce sera ensuite le squelette, et ce, pendant toute la vie de l'animal. L'irradiation interne de l'os constitue, en raison des menaces qu'elle comporte pour les fonctions hematopoietiques de l'organisme, le plus grand danger d'une contamination interne par le Cerium 144.
Toxicity of 144Ce inhaled in a relatively insoluble form by aged beagle dogs
International Nuclear Information System (INIS)
Boecker, B.B.; Hahn, F.F.; Muggenburg, B.A.; Mauderly, J.L.; McClellan, R.O.; Pickrell, J.A.
1980-01-01
The toxicity of relatively insoluble 144 Ce inhaled by 8- to 10.5-year-old beagle dogs is being investigated to provide information on possible age-related differences in the resulting long-term biological responses. Forty-two dogs were exposed, nose-only, to aerosols of 144 Ce in fused aluminosilicate particles to yield initial lung burdens of 2.2 to 75 μCi 144 Ce/kg body weight, and 12 control dogs were exposed to nonradioactive fused aluminosilicate particles. To date, 38 144 Ce-exposed dogs and 10 control dogs have died or were euthanized between 197 and 2375 days after inhalation of the 144 Ce. Prominent findings in the 144 Ce-exposed dogs were radiation pneumonitis in 19 dogs that died during the first 943 days post-exposure and neoplastic disease in seven of the 15 dogs. However, only one of these tumors killed the dog. No hemangiosarcomas have been observed in this study, although they were a prominent finding in immature or young adult dogs exposed to 144 Ce. Observations are continuing on the four surviving 144 Ce-exposed and two control dogs
Tinjauan Desain Website Kemlu.Go.Id
Directory of Open Access Journals (Sweden)
Danu Widhyatmoko
2013-04-01
Full Text Available Review of kemlu.go.id website design is a research report on Kemlu.go.id website design. Kemlu.go.id website aims to be the information gateway of Ministry of Foreign Affairs, and also as guidelines of foreign politic policies of Republic of Indonesia. The review had been accomplished by using analytical method based on the "Nine Essential Principles for Good Web Design" developed by Collis Ta'eed (2007. At the end of the article, several recommendations in developing kemlu.go.id website are presented to create better appearance.
Toxicity of inhaled 144CeCl3 in beagle dogs
International Nuclear Information System (INIS)
Muggenburg, B.A.; Hahn, F.F.; Boecker, B.B.; McClellan, R.O.; Pickrell, J.A.
1980-01-01
The metabolism, dosimetry and effects of inhaled 144 CeCl 3 in beagle dogs are being studied to assess the biological consequences of inhaling 144 Ce. Studies have shown that the 144 Ce deposited in the lung as 144 CeCl 3 is translocated at a moderately rapid rate to liver and skeleton and that significant radiation doses are accumulated by all three organs. Fifty-five dogs that inhaled 144 CeCl 3 and 17 control dogs are being observed for their life span. The 144 Ce-exposed dogs had long-term retained burdens that ranged from 2.6 to 360 μCi 144 Ce/kg body weight. Fifty-three of the dogs exposed to 144 CeCl 3 have died and twelve control dogs have died. Serial observations are continuing on the two surviving exposed dogs and five control dogs
A Good IDS Response Protocol of MANET Containment Strategies
Cheng, Bo-Chao; Chen, Huan; Tseng, Ryh-Yuh
Much recent research concentrates on designing an Intrusion Detection System (IDS) to detect the misbehaviors of the malicious node in MANET with ad-hoc and mobility natures. However, without rapid and appropriate IDS response mechanisms performing follow-up management services, even the best IDS cannot achieve the desired primary goal of the incident response. A competent containment strategy is needed to limit the extent of an attack in the Incident Response Life Cycle. Inspired by the T-cell mechanisms in the human immune system, we propose an efficient MANET IDS response protocol (T-SecAODV) that can rapidly and accurately disseminate alerts of the malicious node attacks to other nodes so as to modify their AODV routing tables to isolate the malicious nodes. Simulations are conducted by the network simulator (Qualnet), and the experiment results indicate that T-SecAODV is able to spread alerts steadily while greatly reduce faulty rumors under simultaneous multiple malicious node attacks.
Desprez, Pierre-Yves; Campisi, Judith
2014-09-30
A method for treatment and amelioration of breast, cervical, ovarian, endometrial, squamous cells, prostate cancer and melanoma in a patient comprising targeting Id-1 or Id-2 gene expression with a delivery vehicle comprising a product which modulates Id-1 or Id-2 expression.
MicroRNA-144 inhibits hepatocellular carcinoma cell proliferation
Indian Academy of Sciences (India)
MiR-144 was shown to besignificantly down-regulated in HCC tissues and cell lines. Subsequently, overexpression of miR-144 was transfectedinto HCC cell lines so as to investigate its biological function, including MTT, colony formation, and transwell assays.Gain of function assay revealed miR-144 remarkably inhibited ...
42 CFR 456.144 - Data sources for studies.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Data sources for studies. 456.144 Section 456.144 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Care Evaluation Studies § 456.144 Data sources for studies. Data that the committee uses to perform...
One ID Card for the Entire Campus.
Ridenour, David P.; Ferguson, Linda M.
1986-01-01
The implementation by Indiana State University of a machine-readable photo ID system for their food services prompted an investigation into the available alternatives and requirements for a more efficient all-University ID card system. The new ID system is described. (AUTHOR/MLW)
Inhibitor of differentiation 4 (Id4) is a potential tumor suppressor in prostate cancer
International Nuclear Information System (INIS)
Carey, Jason PW; Asirvatham, Ananthi J; Galm, Oliver; Ghogomu, Tandeih A; Chaudhary, Jaideep
2009-01-01
Inhibitor of differentiation 4 (Id4), a member of the Id gene family is also a dominant negative regulator of basic helix loop helix (bHLH) transcription factors. Some of the functions of Id4 appear to be unique as compared to its other family members Id1, Id2 and Id3. Loss of Id4 gene expression in many cancers in association with promoter hypermethylation has led to the proposal that Id4 may act as a tumor suppressor. In this study we provide functional evidence that Id4 indeed acts as a tumor suppressor and is part of a cancer associated epigenetic re-programming. Data mining was used to demonstrate Id4 expression in prostate cancer. Methylation specific polymerase chain reaction (MSP) analysis was performed to understand molecular mechanisms associated with Id4 expression in prostate cancer cell lines. The effect of ectopic Id4 expression in DU145 cells was determined by cell cycle analysis (3H thymidine incorporation and FACS), expression of androgen receptor, p53 and cyclin dependent kinase inhibitors p27 and p21 by a combination of RT-PCR, real time-PCR, western blot and immuno-cytochemical analysis. Id4 expression was down-regulated in prostate cancer. Id4 expression was also down-regulated in prostate cancer line DU145 due to promoter hyper-methylation. Ectopic Id4 expression in DU145 prostate cancer cell line led to increased apoptosis and decreased cell proliferation due in part by an S-phase arrest. In addition to S-phase arrest, ectopic Id4 expression in PC3 cells also resulted in prolonged G2/M phase. At the molecular level these changes were associated with increased androgen receptor (AR), p21, p27 and p53 expression in DU145 cells. The results suggest that Id4 acts directly as a tumor suppressor by influencing a hierarchy of cellular processes at multiple levels that leads to a decreased cell proliferation and change in morphology that is possibly mediated through induction of previously silenced tumor suppressors
19 CFR 144.38 - Withdrawal for consumption.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Withdrawal for consumption. 144.38 Section 144.38... Withdrawal for consumption. (a) Form. Withdrawals for consumption of merchandise in bonded warehouses shall... considered a withdrawal for consumption pursuant to § 181.53 of this chapter. (c) Information to be shown on...
10 CFR 72.144 - Quality assurance program.
2010-01-01
... quality history and degree of standardization of the item. (d) The licensee, applicant for a license... 10 Energy 2 2010-01-01 2010-01-01 false Quality assurance program. 72.144 Section 72.144 Energy... NUCLEAR FUEL, HIGH-LEVEL RADIOACTIVE WASTE, AND REACTOR-RELATED GREATER THAN CLASS C WASTE Quality...
Method for removing trace contaminants from multicurie amounts of 144Ce
International Nuclear Information System (INIS)
Wagner, J.A.; Kanapilly, G.M.
1976-01-01
Removal of contaminants from stock solutions of 144 Ce(III) was required for large quantities of 144 Ce prior to incorporation into fused aluminosilicate particles for inhalation toxicology studies. Since available procedures for purification of 144 Ce could not be readily adapted to our laboratory conditions and requirements, a simple procedure was developed to purify 144 Ce in multicurie quantities of 144 Ce(III). This procedure consists of separation of 144 Ce from contaminants by precipitation and filtrations at different pH. Its simplicity and efficacy in providing a stock solution that would readily exchange into montmorillonite clay was demonstrated when it was used during the preparation of large amounts of 144 Ce in fused aluminosilicate particles
Inhibitor of differentiation 4 (Id4 is a potential tumor suppressor in prostate cancer
Directory of Open Access Journals (Sweden)
Carey Jason PW
2009-06-01
Full Text Available Abstract Background Inhibitor of differentiation 4 (Id4, a member of the Id gene family is also a dominant negative regulator of basic helix loop helix (bHLH transcription factors. Some of the functions of Id4 appear to be unique as compared to its other family members Id1, Id2 and Id3. Loss of Id4 gene expression in many cancers in association with promoter hypermethylation has led to the proposal that Id4 may act as a tumor suppressor. In this study we provide functional evidence that Id4 indeed acts as a tumor suppressor and is part of a cancer associated epigenetic re-programming. Methods Data mining was used to demonstrate Id4 expression in prostate cancer. Methylation specific polymerase chain reaction (MSP analysis was performed to understand molecular mechanisms associated with Id4 expression in prostate cancer cell lines. The effect of ectopic Id4 expression in DU145 cells was determined by cell cycle analysis (3H thymidine incorporation and FACS, expression of androgen receptor, p53 and cyclin dependent kinase inhibitors p27 and p21 by a combination of RT-PCR, real time-PCR, western blot and immuno-cytochemical analysis. Results Id4 expression was down-regulated in prostate cancer. Id4 expression was also down-regulated in prostate cancer line DU145 due to promoter hyper-methylation. Ectopic Id4 expression in DU145 prostate cancer cell line led to increased apoptosis and decreased cell proliferation due in part by an S-phase arrest. In addition to S-phase arrest, ectopic Id4 expression in PC3 cells also resulted in prolonged G2/M phase. At the molecular level these changes were associated with increased androgen receptor (AR, p21, p27 and p53 expression in DU145 cells. Conclusion The results suggest that Id4 acts directly as a tumor suppressor by influencing a hierarchy of cellular processes at multiple levels that leads to a decreased cell proliferation and change in morphology that is possibly mediated through induction of previously
A Contextual Model for Identity Management (IdM) Interfaces
Fuller, Nathaniel J.
2014-01-01
The usability of Identity Management (IdM) systems is highly dependent upon design that simplifies the processes of identification, authentication, and authorization. Recent findings reveal two critical problems that degrade IdM usability: (1) unfeasible techniques for managing various digital identifiers, and (2) ambiguous security interfaces.…
DEFF Research Database (Denmark)
Jensen, Tenna; Jespersen, Astrid Pernille; Grønnow, Liv Cæcilie
2015-01-01
Idékataloget er en selvstændig publikation hørende til projekt Appetit på maden. Idékataloget er udviklet til brug i Københavns Kommune.......Idékataloget er en selvstændig publikation hørende til projekt Appetit på maden. Idékataloget er udviklet til brug i Københavns Kommune....
African Journals Online (AJOL)
User
Bayero Journal of Pure and Applied Sciences, 9(2): 141 - 144 ... 1- Department of Food science, Kano University of Science and Technology, Wudil, Nigeria ... A total of fifty samples from different water sources were analysed for the following ...
DEFF Research Database (Denmark)
Babakhanyan, Anna; Leke, Rose G F; Salanti, Ali
2014-01-01
In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women natura...
Evaluation of ID-PaGIA syphilis antibody test.
Naaber, Paul; Makoid, Ene; Aus, Anneli; Loivukene, Krista; Poder, Airi
2009-01-01
Laboratory diagnosis of syphilis is usually accomplished by serology. There are currently a large number of different commercial treponemal tests available that vary in format, sensitivity and specificity. To evaluate the ID-PaGIA Syphilis Antibody Test as an alternative to other specific treponemal tests for primary screening or confirmation of diagnosis. Serum samples from healthy adults (n = 100) were used for detection of specificity of ID-PaGIA. To evaluate sensitivity of ID-PaGIA serum samples (n = 101) from patients with confirmed or suspected syphilis were tested for syphilis antibodies with FTA-Abs IgM, ID-PaGIA, ELISA IgM and TPHA tests. No false-positive results were found with ID-PaGIA. Sensitivity of various treponemal tests was the following: FTA-Abs IgM: 95.5%, ID-PaGIA and ELISA IgM: 94%, and TPHA 75%. The positive and negative predictive values of ID-PaGIA were 100 and 89.5%, respectively. Compared with other treponemal tests ID-PaGIA has excellent sensitivity and specificity.
19 CFR 144.33 - Minimum quantities to be withdrawn.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Minimum quantities to be withdrawn. 144.33 Section 144.33 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT... Warehouse § 144.33 Minimum quantities to be withdrawn. Unless by special authority of the Commissioner of...
Facts about Infectious Diseases (ID)
... an ID Specialist? Facts about ID Pocketcard Infectious diseases are caused by microscopic organisms that penetrate the body’s natural ... from diseases such as AIDS or treatment of diseases such as cancer, may allow ... of contaminated food or water, bites from vectors such as ticks or mosquitoes ...
7 CFR 58.144 - Pasteurization or ultra-pasteurization.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Pasteurization or ultra-pasteurization. 58.144 Section... Service 1 Operations and Operating Procedures § 58.144 Pasteurization or ultra-pasteurization. When pasteurization or ultra-pasteurization is intended or required, or when a product is designated “pasteurized” or...
Kloos, W E; George, C G
1991-01-01
The accuracies of the MicroScan Pos ID and Rapid Pos ID panel systems (Baxter Diagnostic Inc., MicroScan Division, West Sacramento, Calif.) were compared with each other and with the accuracies of conventional methods for the identification of 25 Staphylococcus species and 4 subspecies. Conventional methods included those used in the original descriptions of species and subspecies and DNA-DNA hybridization. The Pos ID panel uses a battery of 18 tests, and the Rapid Pos ID panel uses a battery of 42 tests for the identification of Staphylococcus species. The Pos ID panel has modified conventional and chromogenic tests that can be read after 15 to 48 h of incubation; the Rapid Pos ID panel has tests that use fluorogenic substrates or fluorometric indicators, and test results can be read after 2 h of incubation in the autoSCAN-W/A. Results indicated that both MicroScan systems had a high degree of congruence (greater than or equal to 90%) with conventional methods for the species S. capitis, S. aureus, S. auricularis, S. saprophyticus, S. cohnii, S. arlettae, S. carnosus, S. lentus, and S. sciuri and, in particular, the subspecies S. capitis subsp. capitis and S. cohnii subsp. cohnii. The Rapid Pos ID panel system also had greater than or equal to 90% congruence with conventional methods for S. epidermidis, S. caprae, S. warneri subsp. 2, S. xylosus, S. kloosii, and S. caseolyticus. For both MicroScan systems, congruence with conventional methods was 80 to 90% for S. haemolyticus subsp. 1, S. equorum, S. intermedius, and S. hyicus; and in addition, with the Rapid Pos ID panel system congruence was 80 to 89% for S. capitis subsp. ureolyticus, S. warneri subsp. 1, S. hominis, S. cohnii subsp. urealyticum, and S. simulans. The MicroScan systems identified a lower percentage (50 to 75%) of strains of S. lugdunensis, S. gallinarum, S. schleiferi, and S. chromogenes, although the addition of specific tests to the systems might increase the accuracy of identification
40 CFR 144.4 - Considerations under Federal law.
2010-07-01
... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Considerations under Federal law. 144... (CONTINUED) UNDERGROUND INJECTION CONTROL PROGRAM General Provisions § 144.4 Considerations under Federal law. The following is a list of Federal laws that may apply to the issuance of permits under these rules...
19 CFR 144.42 - Combined entry for rewarehouse and withdrawal for consumption.
2010-04-01
... consumption. 144.42 Section 144.42 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... Rewarehouse Entries § 144.42 Combined entry for rewarehouse and withdrawal for consumption. (a) Applicability... rewarehouse and withdrawal for consumption. (b) Procedure for entry. The procedures set forth in § 144.41 are...
Toxicity of 144Ce inhaled in a relatively insoluble form by aged Beagle dogs. X
International Nuclear Information System (INIS)
Boecker, B.B.; Hahn, F.F.; Muggenburg, B.A.; Mauderly, J.L.; McClellan, R.O.; Pickrell, J.A.
1981-01-01
The toxicity of relatively insoluble 144 Ce inhaled by 8- to 10.5-year old Beagle dogs is being investigated to provide possible age-related differences in long-term biological responses. Forty-two dogs were exposed, nose-only, to aerosols of 144 Ce in fused aluminosilicate particles to yield initial lung burdens of 2.2 to 75 μCi 144 Ce/kg body weight, and 12 control dogs were exposed to nonradioactive fused aluminosilicate particles. To date, 39 144 Ce-exposed dogs and 10 control dogs have died or were euthanized between 197 and 2375 days after the inhalation exposure. Prominent findings in the 144 Ce-exposed dogs were radiation pneumonitis in 19 of the 23 dogs that died during the first 943 days after exposure and neoplastic disease in nine of the 16 dogs that died beyond 943 days after exposure. Pulmonary tumors were found in four of these dogs. Observations are continuing on the three surviving 144 Ce-exposed and two control dogs
33 CFR 144.01-30 - First-aid kit.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false First-aid kit. 144.01-30 Section...) OUTER CONTINENTAL SHELF ACTIVITIES LIFESAVING APPLIANCES Manned Platforms § 144.01-30 First-aid kit. On each manned platform a first-aid kit approved by the Commandant or the U.S. Bureau of Mines shall be...
38 CFR 21.144 - Vocational course in a sheltered workshop or rehabilitation facility.
2010-07-01
... workshop or rehabilitation facility may be an institutional, on-job, or combination course which has been... sheltered workshop or rehabilitation facility. 21.144 Section 21.144 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) VOCATIONAL REHABILITATION AND EDUCATION Vocational Rehabilitation...
Toxicity of 144Ce inhaled in a relatively insoluble form by Beagle dogs. XI
International Nuclear Information System (INIS)
Hahn, F.F.; Hanika-Rebar, C.; Boecker, B.B.; Mauderly, J.L.; McClellan, R.O.; Pickrell, J.A.
1978-01-01
The metabolism, dosimetry and effects of 144 Ce inhaled in fused aluminosilicate particles are being investigated in the Beagle dog to assess the biological consequences of release of 144 Ce in a relatively insoluble form such as might occur in certain types of nuclear accidents. The toxicity of inhaled 144 Ce is also of general interest since it is representative of intermediate-lived beta-emitting radionuclides. Two major studies with young adult dogs (12 to 14 months of age at exposure) are involved: (1) a metabolism and dosimetry study in which 24 dogs were serially sacrificed over an extended period of time, and (2) a longevity study with two series of dogs. Series I contains 15 dogs exposed to aerosols of 144 Ce in fused aluminosilicate particles to yield initial lung burdens of 11 to 210 μCi/kg body weight and three control dogs exposed to nonradioactive fused aluminosilicate particles. Series II contains 96 dogs exposed to aerosols of 144 Ce in fused aluminosilicate particles to yield initial lung burdens of 0.0024 to 66 μCi/kg body weight and 12 control dogs exposed to nonradioactive, fused aluminosilicate particles. To date, 51 dogs have died or were euthanized at 143 to 3280 days after inhalation of 144 Ce. The prominent findings were radiation pneumonitis in 17 dogs that died or were euthanized at 750 days or later. The cumulative radiation dose to the lung at time of death has ranged from 550 to 140,000 rads. Serial observations are continuing on the 60 survivors and 15 controls
40 CFR 144.41 - Minor modifications of permits.
2010-07-01
... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Minor modifications of permits. 144.41 Section 144.41 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS... responsibility, coverage, and liability between the current and new permittees has been submitted to the Director...
Enhanced E3 Excitations in 144,146Ba and the Evolution of Octupole Collectivity
Bucher, B.; Zhu, S.; ANL, LLNL, LBNL, INL, UAM, Rochester, Maryland Collaboration
2017-09-01
Recent Coulomb excitation studies on 144,146Ba using the GRETINA-CHICO2 detection system with post-accelerated CARIBU beams have confirmed the existence of enhanced E3 transitions in these isotopes which are centered in a region that has long been predicted to exhibit stable octupole-deformed shapes. Furthermore, the widely-varying E1 strength observed between these isotopes is well-accounted for by models having octupole-deformed potentials, and the variation has been linked to increased occupancies of specific single-particle orbitals in the reflection-asymmetric potential. This talk will summarize the most recent experimental and theoretical results. In addition, data on octupole-related properties in the surrounding isotopes will be discussed in an attempt to better understand the origin and evolution of octupole collectivity in this mass region. This work is supported by the U.S. Department of Energy, Office of Nuclear Physics, under Contract No. DE-AC02-06CH11357 (ANL), DE-AC02-05CH11231 (LBNL, GRETINA), DOE DE-AC52-07NA27344 (LLNL), DE-AC07-05ID14517 (INL), and MINECO (Spain).
Toxicity of 144Ce inhaled in a relatively insoluble form by immature Beagle dogs. XVII
International Nuclear Information System (INIS)
Boeker, B.B.; Muggenburg, B.A.; Hahn, F.F.; Mauderly, J.L.; McClellan, R.O.
1988-01-01
Immature Beagle dogs (3-mo old) received a single, brief inhalation exposure to 144 Ce in fused aluminosilicate particles as part of a series of studies designed to study the effects of age on dose response relationships for inhaled radionuclides. Forty-nine dogs inhaled graded levels of 144 Ce that resulted in initial lung burdens ranging from 0.004-140 μCi/kg 0.15-5200 kBq/kg) body weight. Five control dogs inhaled nonradioactive fused aluminosilicate particles. Forty-one of the 144 Ce-exposed dogs have died: 11 with lung tumors 4 with tumors of the tracheobronchial lymph nodes, with a nasal cavity tumor, and 9 with non neoplastic diseases of the respiratory tract. Observations are continuing on the 8 144 Ce-exposed dogs that are surviving at this time. (author)
40 CFR 52.144 - Significant deterioration of air quality.
2010-07-01
... quality. 52.144 Section 52.144 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... deterioration of air quality. (a) The requirements of sections 160 through 165 of the Clean Act are not met... lands does not include approvable procedures for preventing the significant deterioration of air quality...
41 CFR 105-71.144 - Termination for convenience.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Termination for convenience. 105-71.144 Section 105-71.144 Public Contracts and Property Management Federal Property... Termination for convenience. Except as provided in § 105-71.143 awards may be terminated in whole or in part...
Increased Inhibitor of Differentiation 4 (Id4 Expression in Glioblastoma: A Tissue Microarray Study
Directory of Open Access Journals (Sweden)
Weifin Zeng, Elisabeth J. Rushing, Daniel P. Hartmann, Norio Azumi
2010-01-01
Full Text Available Background: The inhibitor of differentiation/DNA binding protein family (Id1-4 is involved in cell cycle control, tumorigenesis and angiogenesis through the negative regulation of helix-loop-helix transcription factors. Of these proteins, Id4 is known to play an important role in neural stem cell differentiation, and deregulation has been implicated in glial neoplasia. However, the expression and significance of Id4 in astrocytomas has not been fully addressed. Herein we report the differential expression of Id4 in astrocytomas of various grades using tissue microarrays (TMA and immunohistochemistry (IHC. Design: The GBM TMA was constructed from 53 archival cases at Georgetown University Hospital and a TMA with normal brain controls and grades II-III astrocytoma was obtained from Cybrdi (Rockville, MD. TMA sections were stained with Id4 antibody and the slides were scored according to the percentage of staining astrocytic nuclei (<9% -, 10-50% +, >51% ++. The Fisher Exact test was used to test for statistical significance. Results: Nuclear staining for Id4 was seen in 73.58% GBMs, 25% grade III, and 12.5% grade II astrocytomas; staining was absent in normal brain tissue. There was a statistically significant difference between GBM and grades II, III astrocytoma (p <0.01. Significant Id4 expression was not detected in normal brain. Conclusions: Our study confirms the frequent upregulation of Id4 expression in GBM, which lends support to its role in tumorigenesis, possibly in the transformation of low to high-grade astrocytoma (i.e. GBM. Further studies are warranted to determine the precise role of Id4 in glial neoplasia and its potential use in targeted therapy for GBM.
Commissioning of the IDS Neutron Detector and $\\beta$-decay fast-timing studies at IDS
Piersa, Monika
2016-01-01
The following report describes my scientific activities performed during the Summer Student Programme at ISOLDE. The main part of my project was focused on commissioning the neutron detector dedicated to nuclear decay studies at ISOLDE Decay Station (IDS). I have participated in all the steps needed to make it operational for the IS609 experiment. In the testing phase, we obtained expected detector response and calibrations confirmed its successful commissioning. The detector was mounted in the desired geometry at IDS and used in measurements of the beta-delayed neutron emission of $^8$He. After completing aforementioned part of my project, I became familiar with the fast-timing method. This technique was applied at IDS in the IS610 experiment performed in June 2016 to explore the structure of neutron-rich $^{130-134}$Sn nuclei. Since the main part of my PhD studies will be the analysis of data collected in this experiment, the second part of my project was dedicated to acquiring knowledge about technical de...
2010-04-01
... of a subsidiary, affiliate, or joint venture have on a PHA? 943.144 Section 943.144 Housing and Urban... CONSORTIA AND JOINT VENTURES Subsidiaries, Affiliates, Joint Ventures in Public Housing § 943.144 What financial impact do operations of a subsidiary, affiliate, or joint venture have on a PHA? Income generated...
International Nuclear Information System (INIS)
Noetzel, Erik; Veeck, Jürgen; Niederacher, Dieter; Galm, Oliver; Horn, Felicitas; Hartmann, Arndt; Knüchel, Ruth; Dahl, Edgar
2008-01-01
Inhibitor of DNA binding/Inhibitor of differentiation 4 (ID4) is a critical factor for cell proliferation and differentiation in normal vertebrate development. ID4 has regulative functions for differentiation and growth of the developing brain. The role of ID1, ID2 and ID3 are expected to be oncogenic due to their overexpression in pancreatic cancer and colorectal adenocarcinomas, respectively. Aside from these findings, loss of ID3 expression was demonstrated in ovarian cancer. The aim of the present study was to reveal the factual role of ID4 in carcinogenesis in more detail, since its role for the pathogenesis of human breast cancer has been discussed controversially, assigning both oncogenic and tumour suppressive functions. ID4 promoter methylation, ID4 mRNA expression and ID4 protein expression were analysed in primary human breast cancer specimens using methylation-specific PCR (MSP) (n=170), semiquantitative realtime RT-PCR (n=46) and immunhistochemistry (n=3), respectively. In order to demonstrate a functional association of ID4 promoter methylation with its gene silencing, we performed DNA demethylation analysis with four human breast cell lines using MSP and semiquantitative realtime RT-PCR. In addition, we performed correlations of ID4 promoter methylation with ID4 mRNA and ID4 protein expression in matched samples of breast tumour and corresponding normal tissue. We carried out statistical analyses in order to find correlations between ID4 promoter methylation and clinicopathological parameters. Frequent ID4 promoter methylation was observed in primary breast cancer samples (69%, 117/170). We found a tight correlation (P<0.0001) between ID4 promoter methylation and loss of ID4 expression in primary breast cancer 3 specimens. Demethylating treatment with breast cancer cell lines was associated with clear ID4 mRNA re-expression. Tumours with ID4 promoter methylation showed distinct loss of ID4 expression on both transcription and protein level
Toxicity of 144Ce inhaled in a relatively insoluble form by immature Beagle dogs. VIII
International Nuclear Information System (INIS)
Boecker, B.B.; Merickel, B.S.; Hahn, F.F.; Mauderly, J.L.; McClellan, R.O.
1979-01-01
The influence of age at exposure on the resulting patterns of deposition, retention, dosimetry and biological effects from a single inhalation exposure to a relatively insoluble form of a beta-emitting radionuclide with a relatively long physical half-life is being investigated. Immature Beagle dogs (3 months of age) have been exposed once, by inhalation, to an aerosol of 144 Ce incorporated in fused aluminosilicate particles. Eighteen of these dogs were serially sacrificed to study the patterns of deposition, retention and dosimetry and the remaining 49 dogs received graded initial lung burdens that ranged from 0.004 to 140 μCi 144 Ce/kg body weight and are being observed over their life span for study of the resulting long-term biological effects. Five control dogs are also included in this study. To date, 13 of the 144 Ce-exposed dogs in the longevity study and none of the controls have died. Dogs with the highest initial lung burdens of 144 Ce died first (during the first 4 months) with radiation pneumonitis, pulmonary fibrosis and congestive heart failure. Pulmonary hemangiosarcoma was the primary finding in dogs that died at 1.5 to 2 years after exposure. Deaths beyond that time have primarily involved extrapulmonary hemangiosarcomas. One dog, 627B, with an initial lung burden of 24 μCi 144 Ce/kg body weight died during the past year at 2341 days after exposure with a widely disseminated hemangiosarcoma showing heavy involvement of the liver and skin. Observations are continuing on the surviving 36 144 Ce-exposed and five control dogs
Cyclin D1, Id1 and EMT in breast cancer
International Nuclear Information System (INIS)
Tobin, Nicholas P; Sims, Andrew H; Lundgren, Katja L; Lehn, Sophie; Landberg, Göran
2011-01-01
Cyclin D1 is a well-characterised cell cycle regulator with established oncogenic capabilities. Despite these properties, studies report contrasting links to tumour aggressiveness. It has previously been shown that silencing cyclin D1 increases the migratory capacity of MDA-MB-231 breast cancer cells with concomitant increase in 'inhibitor of differentiation 1' (ID1) gene expression. Id1 is known to be associated with more invasive features of cancer and with the epithelial-mesenchymal transition (EMT). Here, we sought to determine if the increase in cell motility following cyclin D1 silencing was mediated by Id1 and enhanced EMT-features. To further substantiate these findings we aimed to delineate the link between CCND1, ID1 and EMT, as well as clinical properties in primary breast cancer. Protein and gene expression of ID1, CCND1 and EMT markers were determined in MDA-MB-231 and ZR75 cells by western blot and qPCR. Cell migration and promoter occupancy were monitored by transwell and ChIP assays, respectively. Gene expression was analysed from publicly available datasets. The increase in cell migration following cyclin D1 silencing in MDA-MB-231 cells was abolished by Id1 siRNA treatment and we observed cyclin D1 occupancy of the Id1 promoter region. Moreover, ID1 and SNAI2 gene expression was increased following cyclin D1 knock-down, an effect reversed with Id1 siRNA treatment. Similar migratory and SNAI2 increases were noted for the ER-positive ZR75-1 cell line, but in an Id1-independent manner. In a meta-analysis of 1107 breast cancer samples, CCND1 low /ID1 high tumours displayed increased expression of EMT markers and were associated with reduced recurrence free survival. Finally, a greater percentage of CCND1 low /ID1 high tumours were found in the EMT-like 'claudin-low' subtype of breast cancer than in other subtypes. These results indicate that increased migration of MDA-MB-231 cells following cyclin D1 silencing can be mediated by Id
RPD: Reusable Pseudo-Id Distribution for a Secure and Privacy Preserving VANET
Directory of Open Access Journals (Sweden)
Sulaiman Ashraph
2013-08-01
Full Text Available In any VANET, security and privacy are the two fundamental issues. Obtaining efficient security in vehicular communication is essential without compromising privacy-preserving mechanisms. Designing a suitable protocol for VANET by having these two issues in mind is challenging because efficiency, unlinkablity and traceability are the three qualities having contradictions between them. In this paper, we introduce an efficient Reusable Pseudo-id Distribution (RPD scheme. The Trusted Authority (TA designating the Road Side Units (RSUs to generate n reusable pseudo ids and distribute them to the On Board Units (OBUs on request characterizes the proposed protocol. RSUs issue the aggregated hashes of all its valid pseudo-ids along with a symmetric shared key and a particular pseudo-id to each vehicle that enters into its coverage range. Through this the certificates attached to the messages can be eliminated and thus resulting in a significantly reduced packet size. The same anonymous keys can then be re-distributed by the RSUs episodically to other vehicles. We analyze the proposed protocol extensively to demonstrate its merits and efficiency.
He, Quan; Wang, Fangfei; Honda, Takashi; Lindquist, Diana M; Dillman, Jonathan R; Timchenko, Nikolai A; Redington, Andrew N
2017-10-01
Previous in vitro studies have demonstrated that miR-144 inhibits hepatocellular carcinoma cell proliferation, invasion, and migration. We have shown that miR-144, injected intravenously, is taken up by the liver and induces endogenous hepatic synthesis of miR-144. We hypothesized that administered miR-144 has tumor-suppressive effects on liver tumor development in vivo. The effects of miR-144 on tumorigenesis and tumor growth were tested in a diethylnitrosamine-induced hepatocellular carcinoma mouse model. MiR-144 injection had no effect on body weight but significantly reduced diethylnitrosamine-induced liver enlargement compared with scrambled microRNA. MiR-144 had no effect on diethylnitrosamine-induced liver tumor number but reduced the tumor size above 50%, as evaluated by magnetic resonance imaging (scrambled microRNA 23.07 ± 5.67 vs miR-144 10.38 ± 2.62, p hepatocellular carcinoma tumorigenesis. Exogenously delivered miR-144 may be a therapeutic strategy to suppress tumor growth in hepatocellular carcinoma.
2010-07-01
... the Underground Injection Control (UIC) Program established under the Safe Drinking Water Act. This... INJECTION CONTROL PROGRAM Requirements for Owners and Operators of Class V Injection Wells § 144.79 General. This subpart tells you what requirements apply if you own or operate a Class V injection well. You may...
Toxicity of 144Ce inhaled in a relatively insoluble form by immature Beagle dogs. XIII
International Nuclear Information System (INIS)
Boecker, B.B.; Muggenburg, B.A.; Hahn, F.F.; Mauderly, J.L.; McClellan, R.O.
1984-01-01
Immature Beagle dogs (3 months old) were exposed once by inhalation to an aerosol of 144 Ce incorporated in fused aluminosilicate particles. The influence of this age on the dose-response relationships is being compared to that of 13-month-old and 8 to 10.5-year-old dogs. This study involves 49 dogs that received graded initial lung burdens from 0.004 to 140 μCi 144 Ce/kg (0.15 to 5200 kBq/kg) body weight and five control dogs. To date, 23 of the 144 Ce-exposed dogs and three of the controls have died. Dogs with the highest initial lung burdens of 144 Ce died during the first 4 months with radiation pneumonitis, pulmonary fibrosis, and congestive heart failure. Pulmonary hemangiosarcoma was the primary finding in dogs that died at 1.5 to 2 years after exposure. Deaths beyond that time have been due primarily to extrapulmonary hemangiosarcomas. Observations are continuing on the surviving 26 144 Ce-exposed and two control dogs at 8.0 to 12.2 years after exposure. 2 figures, 1 table
Toxicity of 144Ce inhaled in a relatively insoluble form by immature Beagle dogs. XII
International Nuclear Information System (INIS)
Boecker, B.B.; Muggenburg, B.A.; Hahn, F.F.; Mauderly, J.L.; McClellan, R.O.
1983-01-01
Immature Beagle dogs (3 months old) were exposed once by inhalation to an aerosol of 144 Ce incorporated in fused aluminosilicate particles. The influence of this age on the dose-response relationships is being compared to that of 13-mo-old and 8 to 10.5-yr-old dogs. This study involves 49 dogs that received graded initial lung burdens from 0.004 to 140 μCi 144 Ce/kg body weight and five control dogs. To date, 19 of the 144 Ce-exposed dogs and one of the controls have died. Dogs with the highest initial lung burdens of 144 Ce died during the first 4 months with radiation pneumonitis, pulmonary fibrosis, and congestive heart failure. Pulmonary hemangiosarcoma was the primary finding in dogs that died at 1.5 to 2 years after exposure. Deaths beyond that time have been due primarily to extrapulmonary hemangiosarcomas. Observations are continued on the surviving 30 144 Ce-exposed and four control dogs at 7.0 to 11.2 years after exposure
Toxicity of 144Ce inhaled in a relatively insoluble form by aged Beagle dogs. XII
International Nuclear Information System (INIS)
Boecker, B.B.; Hahn, F.F.; Muggenburg, B.A.; Mauderly, J.L.; McClellan, R.O.; Pickrell, J.A.
1983-01-01
The toxicity of relatively insoluble 144 Ce inhaled by 8- to 10.5-year-old Beagle dogs is being investigated to determine possible age-related differences in long-term biological responses. Forty-two dogs were exposed to aerosols of 144 Ce in fused aluminosilicate particles to yield initial lung burdens of 2.2 to 75 μCi 144 Ce/kg body weight, and 12 control dogs were exposed to non-radioactive fused aluminosilicate particles. All 144 Ce-exposed and control dogs have died or were euthanized between 197 and 2726 days after the inhalation exposure. Prominent findings in the 144 Ce-exposed dogs were radiation pneumonitis in 19 of the 23 dogs that died during the first 943 days after exposure, and neoplastic disease in 13 of the 20 dogs that died beyond 904 days after exposure. Pulmonary tumors were found in five of these dogs. In contrast to the study with young adult dogs, in which pulmonary hemangiosarcomas were one of the prominent findings, all of these tumors were carcinomas
Toxicity of 144Ce inhaled in a relatively insoluble form by aged Beagle dogs. XIII
International Nuclear Information System (INIS)
Boecker, B.B.; Hahn, F.F.; Muggenburg, B.A.; Mauderly, J.L.; McClellan, R.O.; Pickrell, J.A.
1984-01-01
Toxicity of relatively insoluble 144 Ce inhaled by 8 to 10.5 year-old Beagle dogs is being investigated to determine possible age-related differences in long-term biological responses. Forty-two dogs were exposed to aerosols of 144 Ce in fused aluminosilicate particles to yield initial lung burdens of 2.2 to 75 μCi 144 Ce/kg (81-2800 kBq/kg) body weight, and 12 control dogs were exposed to non-radioactive fused aluminosilicate particles. All 144 Ce-exposed and control dogs have died or were euthanized between 197 and 2726 days after the inhalation exposure. Prominent findings in the 144 Ce-exposed dogs were radiation pneumonitis in 19 of the 23 dogs that died during the first 943 days after exposure, and neoplastic disease in 13 of the 20 dogs that died beyond 904 days after exposure. Pulmonary tumors were found in five of these dogs. In contrast to the study with young adult dogs, in which pulmonary hemangiosarcomas were one of the prominent findings, all of these tumors were carcinomas. 1 figure, 1 table
Demonstrating idAnimate : a multi-touch system for sketching and rapidly manipulating animations
Quevedo Fernandez, Javier; Martens, J.B.O.S.
2012-01-01
This demonstration presents idAnimate, a multi-touch application for sketching animations. Thanks to the affordances provided by multitouch interfaces, idAnimate yields a novel, intuitive and easy to use animation technique named transformation-by-example, that allows users to author animations in
Expression of Id2 in the Second Heart Field and Cardiac Defects in Id2 Knock-Out Mice
Jongbloed, M. R. M.; Vicente-Steijn, R.; Douglas, Y. L.; Wisse, L. J.; Mori, K.; Yokota, Y.; Bartelings, M. M.; Schalij, M. J.; Mahtab, E. A.; Poelmann, R. E.; Gittenberger-De Groot, A. C.
2011-01-01
The inhibitor of differentiation Id2 is expressed in mesoderm of the second heart field, which contributes myocardial and mesenchymal cells to the primary heart tube. The role of Id2 in cardiac development is insufficiently known. Heart development was studied in sequential developmental stages in
ID3 contributes to cerebrospinal fluid seeding and poor prognosis in medulloblastoma
International Nuclear Information System (INIS)
Phi, Ji Hoon; Choi, Seung Ah; Lim, Sang-Hee; Lee, Joongyub; Wang, Kyu-Chang; Park, Sung-Hye; Kim, Seung-Ki
2013-01-01
The inhibitor of differentiation (ID) genes have been implicated as promoters of tumor progression and metastasis in many human cancers. The current study investigated the expression and functional roles of ID genes in seeding and prognosis of medulloblastoma. ID gene expression was screened in human medulloblastoma tissues. Knockdown of ID3 gene was performed in medulloblastoma cells in vitro. The expression of metastasis-related genes after ID3 knockdown was assessed. The effect of ID3 knockdown on tumor seeding was observed in an animal model in vivo. The survival of medulloblastoma patients was plotted according to the ID3 expression levels. Significantly higher ID3 expression was observed in medulloblastoma with cerebrospinal fluid seeding than tumors without seeding. Knockdown of ID3 decreased proliferation, increased apoptosis, and suppressed the migration of D283 medulloblastoma cells in vitro. In a seeding model of medulloblastoma, ID3 knockdown in vivo with shRNA inhibited the growth of primary tumors, prevented the development of leptomeningeal seeding, and prolonged animal survival. High ID3 expression was associated with shorter survival of medulloblastoma patients, especially in Group 4 medulloblastomas. High ID3 expression is associated with medullolbastoma seeding and is a poor prognostic factor, especially in patients with Group 4 tumors. ID3 may represent the metastatic/ aggressive phenotype of a subgroup of medulloblastoma
17 CFR 14.4 - Violation of Commodity Exchange Act.
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Violation of Commodity Exchange Act. 14.4 Section 14.4 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION... Exchange Act. The Commission may deny, temporarily or permanently, the privilege of appearing or practicing...
2010-04-01
... PAYMENT OF TAX, OR WITH DRAWBACK OF TAX Operations by Export Warehouse Proprietors Inventories § 44.144 Opening. An opening inventory shall be made by the export warehouse proprietor at the time of commencing... permit issued under § 44.93. A similar inventory shall be made by the export warehouse proprietor when he...
Toxicity of {sup 144}Ce inhaled in a relatively insoluble form by immature Beagle dogs. XVII
Energy Technology Data Exchange (ETDEWEB)
Boeker, B B; Muggenburg, B A; Hahn, F F; Mauderly, J L; McClellan, R O
1988-12-01
Immature Beagle dogs (3-mo old) received a single, brief inhalation exposure to {sup 144}Ce in fused aluminosilicate particles as part of a series of studies designed to study the effects of age on dose response relationships for inhaled radionuclides. Forty-nine dogs inhaled graded levels of {sup 144}Ce that resulted in initial lung burdens ranging from 0.004-140 {mu}Ci/kg 0.15-5200 kBq/kg) body weight. Five control dogs inhaled nonradioactive fused aluminosilicate particles. Forty-one of the {sup 144}Ce-exposed dogs have died: 11 with lung tumors 4 with tumors of the tracheobronchial lymph nodes, with a nasal cavity tumor, and 9 with non neoplastic diseases of the respiratory tract. Observations are continuing on the 8 {sup 144}Ce-exposed dogs that are surviving at this time. (author)
Toxicity of 144Ce inhaled in a relatively insoluble form by aged Beagle dogs. VII
International Nuclear Information System (INIS)
Hahn, F.F.; Hanika-Rebar, C.; Boecker, B.B.; McClellan, R.O.; Pickrell, J.A.
1978-01-01
The toxicity of 144 Ce inhaled in fused aluminosilicate particles by 8- 10.5-year-old dogs is being investigated to provide information on age-related differences in the response of older members of the human population to accidental inhalation of radioactive aerosols. These data on aged dogs will be compared to the results of similar studies of dogs exposed at approximately 3 months or 12 to 14 months of age. Six blocks of five female dogs each have been divided into four exposure levels with mean initial lung burdens of 7.2, 14, 28, and 57 μCi 144 Ce/kg body weight. Six blocks of four male dogs each have been divided into three exposure levels with mean initial lung burdens of 7.2, 14, and 28 μCi 144 Ce/kg body weight. Controls in each block were exposed to fused aluminosilicate particles containing stable cerium. Nineteen dogs with initial lung burdens ranging from 14 to 75 μCi 144 Ce/kg body weight and cumulative doses to lung of from 20,000 to 74,000 rads have died or were euthanized 197 to 1849 days after exposure with clinicopathologic findings of radiation pneumonitis and pulmonary fibrosis. Eight control dogs have died. Pulmonary retention of the inhaled 144 Ce was similar to that observed previously in dogs exposed at 18 to 22 months of age in a radiation dose pattern study. Serial observations are continuing on the nine surviving 144 Ce-exposed and four control dogs
Toxicity of 144Ce inhaled in a relatively insoluble form by aged Beagle dogs. VIII
International Nuclear Information System (INIS)
Hahn, F.F.; Muggenburg, B.A.; Boecker, B.B.; Mauderly, J.L.; McClellan, R.O.; Pickrell, J.A.
1979-01-01
The toxicity of relatively insoluble 144 Ce inhaled by 8- to 10.5-year-old dogs is being investigated to provide information on age-related differences in the response of dogs to lung burdens of this fission product. These data on aged dogs will be compared to the results of similar studies of dogs exposed at approximately 3 months or 12 to 14 months of age. Forty-two dogs were exposed, nose only, to aerosols of 144 Ce in fused aluminosilicate particles to yield initial lung burdens of 2.2 to 75 μCi/kg body weight and 12 control dogs were exposed to nonradioactive fused aluminosilicate particles. To date, 37 dogs have died or were euthanized 197 to 2375 days after inhalation of 144 Ce. The prominent findings were radiation pneumonitis in 19 dogs that died at early times with cumulative doses to lung of 20 000 to 74 000 rads and neoplastic disease in six of 14 dogs that died 943 days after exposure or later. Pulmonary tumors were found in four of these dogs. However, only one of these tumors killed the dog. No hemangiosarcomas have been observed in this study. This result is in contrast to the results with immature or young adult dogs exposed to 144 Ce. The difference may be a dose-related phenomenon since dogs which developed hemangiosarconomas had greater initial lung burdens of 144 Ce. Aged dogs with similar burdens died at earlier times with radiation pneumonitis. Observations are continuing on the five surviving 144 Ce-exposed and four control dogs
Id2 reinforces TH1 differentiation and inhibits E2A to repress TFH differentiation.
Shaw, Laura A; Bélanger, Simon; Omilusik, Kyla D; Cho, Sunglim; Scott-Browne, James P; Nance, J Philip; Goulding, John; Lasorella, Anna; Lu, Li-Fan; Crotty, Shane; Goldrath, Ananda W
2016-07-01
The differentiation of helper T cells into effector subsets is critical to host protection. Transcription factors of the E-protein and Id families are important arbiters of T cell development, but their role in the differentiation of the TH1 and TFH subsets of helper T cells is not well understood. Here, TH1 cells showed more robust Id2 expression than that of TFH cells, and depletion of Id2 via RNA-mediated interference increased the frequency of TFH cells. Furthermore, TH1 differentiation was blocked by Id2 deficiency, which led to E-protein-dependent accumulation of effector cells with mixed characteristics during viral infection and severely impaired the generation of TH1 cells following infection with Toxoplasma gondii. The TFH cell-defining transcriptional repressor Bcl6 bound the Id2 locus, which provides a mechanism for the bimodal Id2 expression and reciprocal development of TH1 cells and TFH cells.
Epigenetic inactivation of inhibitor of differentiation 4 (Id4) correlates with prostate cancer
International Nuclear Information System (INIS)
Sharma, Pankaj; Chinaranagari, Swathi; Patel, Divya; Carey, Jason; Chaudhary, Jaideep
2012-01-01
The inhibitor of DNA-binding (Id) proteins, Id1–4 are negative regulators of basic helix-loop-helix (bHLH) transcription factors. As key regulators of cell cycle and differentiation, expression of Id proteins are increasingly observed in many cancers and associated with aggressiveness of the disease. Of all the four Id proteins, the expression of Id1, Id2, and to a lesser extent, Id3 in prostate cancer and the underlying molecular mechanism is relatively well known. On the contrary, our previous results demonstrated that Id4 acts as a potential tumor suppressor in prostate cancer. In the present study, we extend these observations and demonstrate that Id4 is down-regulated in prostate cancer due to promoter hypermethylation. We used prostate cancer tissue microarrays to investigate Id4 expression. Methylation specific PCR on bisulfite treated DNA was used to determine methylation status of Id4 promoter in laser capture micro-dissected normal, stroma and prostate cancer regions. High Id4 expression was observed in the normal prostate epithelial cells. In prostate cancer, a stage-dependent decrease in Id4 expression was observed with majority of high grade cancers showing no Id4 expression. Furthermore, Id4 expression progressively decreased in prostate cancer cell line LNCaP and with no expression in androgen-insensitive LNCaP-C81 cell line. Conversely, Id4 promoter hypermethylation increased in LNCaP-C81 cells suggesting epigenetic silencing. In prostate cancer samples, loss of Id4 expression was also associated with promoter hypermethylation. Our results demonstrate loss of Id4 expression in prostate cancer due to promoter hypermethylation. The data strongly support the role of Id4 as a tumor suppressor
27 CFR 20.144 - Packages of completely denatured alcohol.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Packages of completely denatured alcohol. 20.144 Section 20.144 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTRIBUTION AND USE OF DENATURED ALCOHOL AND RUM Sale...
Achieving Payoffs from an Industry Cloud Ecosystem at BankID
DEFF Research Database (Denmark)
Eaton, Ben; Hallingby, Hanne Kristine; Nesse, Per-Jonny
2014-01-01
BankID is an industry cloud owned by Norwegian banks. It provides electronic identity, authentication and electronic signing capabilities for banking, merchant and government services. More than 60% of the population uses BankID services. As the broader ecosystem around BankID evolved, challenges......—arising from tensions between different parts of the ecosystem—had to be resolved. The four lessons learned from the BankID case will help others to build an industry cloud and establish a healthy ecosystem to service a broad user base....
Metabolism of cerium 144 in rat. Distribution - elimination - dosimetry
International Nuclear Information System (INIS)
Remy, Jacques
1959-01-01
This academic report concerns a study during which cerium 144 has been intravenously injected to three-month old rats under the form of cerium chloride in aqueous solution with pH of 9,5. Rats have then been sacrificed at different times after the injection, and organ or tissue samplings have been performed to study the isotope distribution in their bodies. This allowed the calculation of internal irradiation doses locally received by the animal, and also to identify critical organs with respect to cerium 144. Thus, until the twentieth day after injection, liver is the critical organ. After, it is the skeleton, for the rest of the animal's life. The bone internal irradiation is the highest danger for an internal cerium 144 contamination, due to threats on body hematopoietic functions [fr
A non-parametric peak calling algorithm for DamID-Seq.
Directory of Open Access Journals (Sweden)
Renhua Li
Full Text Available Protein-DNA interactions play a significant role in gene regulation and expression. In order to identify transcription factor binding sites (TFBS of double sex (DSX-an important transcription factor in sex determination, we applied the DNA adenine methylation identification (DamID technology to the fat body tissue of Drosophila, followed by deep sequencing (DamID-Seq. One feature of DamID-Seq data is that induced adenine methylation signals are not assured to be symmetrically distributed at TFBS, which renders the existing peak calling algorithms for ChIP-Seq, including SPP and MACS, inappropriate for DamID-Seq data. This challenged us to develop a new algorithm for peak calling. A challenge in peaking calling based on sequence data is estimating the averaged behavior of background signals. We applied a bootstrap resampling method to short sequence reads in the control (Dam only. After data quality check and mapping reads to a reference genome, the peaking calling procedure compromises the following steps: 1 reads resampling; 2 reads scaling (normalization and computing signal-to-noise fold changes; 3 filtering; 4 Calling peaks based on a statistically significant threshold. This is a non-parametric method for peak calling (NPPC. We also used irreproducible discovery rate (IDR analysis, as well as ChIP-Seq data to compare the peaks called by the NPPC. We identified approximately 6,000 peaks for DSX, which point to 1,225 genes related to the fat body tissue difference between female and male Drosophila. Statistical evidence from IDR analysis indicated that these peaks are reproducible across biological replicates. In addition, these peaks are comparable to those identified by use of ChIP-Seq on S2 cells, in terms of peak number, location, and peaks width.
A non-parametric peak calling algorithm for DamID-Seq.
Li, Renhua; Hempel, Leonie U; Jiang, Tingbo
2015-01-01
Protein-DNA interactions play a significant role in gene regulation and expression. In order to identify transcription factor binding sites (TFBS) of double sex (DSX)-an important transcription factor in sex determination, we applied the DNA adenine methylation identification (DamID) technology to the fat body tissue of Drosophila, followed by deep sequencing (DamID-Seq). One feature of DamID-Seq data is that induced adenine methylation signals are not assured to be symmetrically distributed at TFBS, which renders the existing peak calling algorithms for ChIP-Seq, including SPP and MACS, inappropriate for DamID-Seq data. This challenged us to develop a new algorithm for peak calling. A challenge in peaking calling based on sequence data is estimating the averaged behavior of background signals. We applied a bootstrap resampling method to short sequence reads in the control (Dam only). After data quality check and mapping reads to a reference genome, the peaking calling procedure compromises the following steps: 1) reads resampling; 2) reads scaling (normalization) and computing signal-to-noise fold changes; 3) filtering; 4) Calling peaks based on a statistically significant threshold. This is a non-parametric method for peak calling (NPPC). We also used irreproducible discovery rate (IDR) analysis, as well as ChIP-Seq data to compare the peaks called by the NPPC. We identified approximately 6,000 peaks for DSX, which point to 1,225 genes related to the fat body tissue difference between female and male Drosophila. Statistical evidence from IDR analysis indicated that these peaks are reproducible across biological replicates. In addition, these peaks are comparable to those identified by use of ChIP-Seq on S2 cells, in terms of peak number, location, and peaks width.
Id1 represses osteoclast-dependent transcription and affects bone formation and hematopoiesis.
Directory of Open Access Journals (Sweden)
April S Chan
2009-11-01
Full Text Available The bone-bone marrow interface is an area of the bone marrow microenvironment in which both bone remodeling cells, osteoblasts and osteoclasts, and hematopoietic cells are anatomically juxtaposed. The close proximity of these cells naturally suggests that they interact with one another, but these interactions are just beginning to be characterized.An Id1(-/- mouse model was used to assess the role of Id1 in the bone marrow microenvironment. Micro-computed tomography and fracture tests showed that Id1(-/- mice have reduced bone mass and increased bone fragility, consistent with an osteoporotic phenotype. Osteoclastogenesis and pit formation assays revealed that loss of Id1 increased osteoclast differentiation and resorption activity, both in vivo and in vitro, suggesting a cell autonomous role for Id1 as a negative regulator of osteoclast differentiation. Examination by flow cytometry of the hematopoietic compartment of Id1(-/- mice showed an increase in myeloid differentiation. Additionally, we found increased expression of osteoclast genes, TRAP, Oscar, and CTSK in the Id1(-/- bone marrow microenvironment. Lastly, transplantation of wild-type bone marrow into Id1(-/- mice repressed TRAP, Oscar, and CTSK expression and activity and rescued the hematopoietic and bone phenotype in these mice.In conclusion, we demonstrate an osteoporotic phenotype in Id1(-/- mice and a mechanism for Id1 transcriptional control of osteoclast-associated genes. Our results identify Id1 as a principal player responsible for the dynamic cross-talk between bone and bone marrow hematopoietic cells.
Sabolčák, Peter
2006-01-01
FlowIDS is system which can detect some of the undesirable traffi c in computer networks (undesirable traffic could be also ie. virus activity or overloading of network) and mostly doing counteraction which are set by administrator. Information about data ows are provided by hardware of network infrastructure, eliminitaion of undesirable activity is done through changes in network hardware settings. Regarding the quantity of solution which are provided on market, I decided to focus on Cisco n...
RNA-ID, a Powerful Tool for Identifying and Characterizing Regulatory Sequences.
Brule, C E; Dean, K M; Grayhack, E J
2016-01-01
The identification and analysis of sequences that regulate gene expression is critical because regulated gene expression underlies biology. RNA-ID is an efficient and sensitive method to discover and investigate regulatory sequences in the yeast Saccharomyces cerevisiae, using fluorescence-based assays to detect green fluorescent protein (GFP) relative to a red fluorescent protein (RFP) control in individual cells. Putative regulatory sequences can be inserted either in-frame or upstream of a superfolder GFP fusion protein whose expression, like that of RFP, is driven by the bidirectional GAL1,10 promoter. In this chapter, we describe the methodology to identify and study cis-regulatory sequences in the RNA-ID system, explaining features and variations of the RNA-ID reporter, as well as some applications of this system. We describe in detail the methods to analyze a single regulatory sequence, from construction of a single GFP variant to assay of variants by flow cytometry, as well as modifications required to screen libraries of different strains simultaneously. We also describe subsequent analyses of regulatory sequences. © 2016 Elsevier Inc. All rights reserved.
Kanabus, Benoît; Popa, Délia
2017-01-01
Dès lors, on entend mieux la question sur laquelle se referment les mille pages du Marx : « La pensée de Marx nous place devant la question abyssale : qu’est-ce que la vie » ? Cette question peut être reposée à nouveaux frais à l’âge du capitalisme avancé, où, comme le notait Adorno, la vie est devenue « l’idéologie de sa propre absence ». La recherche d’un autre rapport à l’idéologie vient alors prendre le relais de la lutte anti-idéologique de la théorie critique. Cette recherche part du po...
A Whitham-Theory Sonic-Boom Analysis of the TU-144 Aircraft at a Mach Number of 2.2
Mack, Robert J.
1999-01-01
Officially, the Tu-144 was the first supersonic-cruise, passenger-carrying aircraft to enter commercial service. Design, construction, and testing were carried out by the Soviet Union, flight certification was by the Soviet Union, and the only regular passenger flights were scheduled and flown across the territory of the Soviet Union. Although it was not introduced to international passenger service, there were many significant engineering accomplishments achieved in the design, production, and flight of this aircraft. Development of the aircraft began with a prototype stage. Systematic testing and redesign led to a production aircraft in discrete stages that measurably improved the performance of the aircraft from the starting concept to final aircraft certification. It flew in competition with the English-French Concorde for a short time, but was withdrawn from national commercial service due to a lack of interest by airlines outside the Soviet Union. NASA became interested in the Tu- 144 aircraft when it was offered for use as a flying "testbed" in the study of operating characteristics of a supersonic-cruise commercial airplane. Since it had been in supersonic-cruise service, the Tu- 144 had operational characteris'tics similar to those anticipated in the conceptual aircraft designs being studied by the United States aircraft companies. In addition to the other operational tests being conducted on the Tu-144 aircraft, it was proposed that two sets of sonic-boom pressure signature measurements be made. The first set would be made on the ground, using techniques and devices similar to those in reference I and many other subsequent studies. A second set would be made in the air with an instrumented aircraft flying close under the Tu-144 in supersonic flight. Such in-flight measurements would require pressure gages that were capable of accurately recording the flow-field overpressures generated by the Tu- 144 at relatively close distances under the vehicle
ID-pilet teeb Tallinnas võidukäiku / Anneli Lepp
Lepp, Anneli
2006-01-01
Vt. ka Postimees : na russkom jazõke 12. jaan. lk 3. Tallinna transpordiameti peaökonomisti Mart Moosuse sõnul moodustas ID-pilet 60,7% ühistranspordi piletituludest, Tartus oli vastav näitaja aga alla 1%. Tartut teenindava bussifirma AS Connex Eesti finantsjuht Tiina Telling peab suure erinevuse põhjuseks asjaolu, et Tallinnas on ID-pilet paberpiletist 40-88% soodsam, Tartus hinnavahe aga puudub või on lausa negatiivne ID-pileti kahjuks. Lisa: ID-pilet
Directory of Open Access Journals (Sweden)
Hendro Agus Prakoso
2016-09-01
berita kedua media tersebut. Frekuensi berita berjumlah 107 di Republika.co.id dan 51 berita di Tempo.co.id Ragam berita Republika.co.id didominasi konsep Spesialisasi sebesar 22,4% dari 107 berita, sedangkan pada Tempo.co.id didominasi konsep Nama baik sebesar 23,5% dari 51 berita. Sumber berita pada Republika.co.id mayoritas berasal dari Liputan langsung sebesar 42,9% dari 107 berita sedangkan pada Tempo.co.id mayoritas berasal dari Intelektual sebesar 54,9% dari 51 berita.
Id2 reinforces TH1 cell differentiation and inhibits E2A to repress TFH cell differentiation
Shaw, Laura A.; Bélanger, Simon; Omilusik, Kyla D.; Cho, Sunglim; Scott-Browne, James P.; Nance, J. Philip; Goulding, John; Lasorella, Anna; Lu, Li-Fan; Crotty, Shane; Goldrath, Ananda W.
2016-01-01
Differentiation of T helper (TH) effector subsets is critical for host protection. E protein transcription factors and Id proteins are important arbiters of T cell development, but their role in differentiation of TH1 and TFH cells is not well understood. TH1 cells showed robust Id2 expression compared to TFH cells, and RNAi depletion of Id2 increased TFH cell frequencies. Further, TH1 cell differentiation was blocked by Id2 deficiency, leading to E protein-dependent accumulation of effector cells with mixed characteristics during viral infection and severely impaired generation of TH1 cells following Toxoplasma gondii infection. The TFH-defining transcriptional repressor Bcl6 bound the Id2 locus, providing a mechanism for the bimodal Id2 expression and reciprocal development of TH1 and TFH cell fates. PMID:27213691
People with ID as interviewers and co-researchers: experiences and reflection.
Lieshout, H. van
2012-01-01
Aim: To share the experience of working with people with intellectual disabilities (ID) as interviewers in a qualitative study about community participation of people with ID. We reflect on two perspectives: the interviewers and the researchers. Method: Eighteen people with ID were interviewed by
29 CFR 500.144 - Civil money penalties-payment and collection.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Civil money penalties-payment and collection. 500.144... LABOR REGULATIONS MIGRANT AND SEASONAL AGRICULTURAL WORKER PROTECTION Enforcement § 500.144 Civil money... promptly the amount thereof, as finally determined, to the Secretary by certified check or by money order...
Relationship between major depressive disorder and ACE gene I/D polymorphism in a Turkish population
Directory of Open Access Journals (Sweden)
Sema Inanir
2016-04-01
Full Text Available Abstract Background Major depressive disorder (MDD is a complex disease and a significant health problem that is prevalent across the world. Angiotensin-converting enzyme (ACE has an important role in renin-angiotensin system (RAS and converts inactive angiotensin I to a potent vasopressor and aldosterone-stimulating peptide angiotensin II. Levels of ACE in plasma vary according to the insertion/deletion (I/D polymorphism of ACE gene. Objective The aim of the current study was to examine the influence ACE gene I/D variations on the risk of MDD. Methods In the present case-control study, we analyzed ACE I/D polymorphism in 346 MDD patients and 210 healthy subjects using polymerase chain reaction technique. Results Comparing the two groups, no significant difference was observed with regard to either genotype distributions or allele frequencies of the I/D polymorphism of ACE gene. Discussion Our findings suggest that the ACE I/D polymorphism is not associated with MDD in Turkish case-control study. Further studies are still needed.
An online ID identification system for liquefied-gas cylinder plant
He, Jin; Ding, Zhenwen; Han, Lei; Zhang, Hao
2017-11-01
An automatic ID identification system for gas cylinders' online production was developed based on the production conditions and requirements of the Technical Committee for Standardization of Gas Cylinders. A cylinder ID image acquisition system was designed to improve the image contrast of ID regions on gas cylinders against the background. Then the ID digits region was located by the CNN template matching algorithm. Following that, an adaptive threshold method based on the analysis of local average grey value and standard deviation was proposed to overcome defects of non-uniform background in the segmentation results. To improve the single digit identification accuracy, two BP neural networks were trained respectively for the identification of all digits and the easily confusable digits. If the single digit was classified as one of confusable digits by the former BP neural network, it was further tested by the later one, and the later result was taken as the final identification result of this single digit. At last, the majority voting was adopted to decide the final identification result for the 6-digit cylinder ID. The developed system was installed on a production line of a liquefied-petroleum-gas cylinder plant and worked in parallel with the existing weighing step on the line. Through the field test, the correct identification rate for single ID digit was 94.73%, and none of the tested 2000 cylinder ID was misclassified through the majority voting.
Toxicity of 144Ce inhaled in a relatively insoluble form by immature Beagle dogs. VII
International Nuclear Information System (INIS)
Hanika-Rebar, C.; Hahn, F.F.; Boecker, B.B.; Mauderly, J.L.; McClellan, R.O.
1978-01-01
Immature Beagle dogs (approx. = 3 months of age at exposure) have been exposed by inhalation to a relatively insoluble form of 144 Ce (in fused aluminosilicate particles) to compare the resulting patterns of metabolism, dosimetry and biological effects with those seen in dogs exposed at 12 and 14 months of age and at 8 to 10.5 years of age. Five blocks of longevity animals, each consisting of 10 exposed dogs and one control, are currently being studied. The initial lung burdens of the 144 Ce-exposed dogs range from 0.004 to 140 μCi 144 Ce/kg body weight. Three dogs with initial lung burdens of 73 to 120 μCi 144 Ce/kg body weight died at 66 to 121 days after exposure with pulmonary injury and congestive heart failure. One dog with an initial lung burden of 140 μCi 144 Ce/kg body weight died at 91 days after exposure with severe radiation pneumonitis and minimal pulmonary fibrosis and another dog whose initial lung burden was 70 μCi 144 Ce/kg body weight died at 511 days after exposure with pulmonary injury that was mainly fibrotic in nature. Four dogs with initial lung burdens of 52 to 79 μCi/kg body weight had primary pulmonary hemangiosarcomas and died between 618 and 738 days, with cumulative average absorbed beta doses to lung of 23,000 to 31,000 rads. Two of these dogs, 1027S and 1024D, died within the past year. One dog with an initial lung burden of 28 μCi/kg body weight was euthanized at 1227 days after exposure with an hemangiosarcoma of the mediastinum. Within the past year, Dog 627S, with an initial lung burden of 48 μCi/kg body weight, died 1732 days after exposure with hemangiosarcoma primary in the liver or spleen. A dog with an initial lung burden of 12 μCi/kg body weight died from epilepsy at 1520 days after exposure. Serial observations are continuing on the surviving 37 exposed and five control dogs
26 CFR 1.4-4 - Short taxable year caused by death.
2010-04-01
... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Short taxable year caused by death. 1.4-4 Section... Normal Taxes and Surtaxes § 1.4-4 Short taxable year caused by death. An individual making a return for a... results from the death of the taxpayer. Tax on Corporations ...
A functionally significant polymorphism in ID3 is associated with human coronary pathology.
Directory of Open Access Journals (Sweden)
Ani Manichaikul
Full Text Available We previously identified association between the ID3 SNP rs11574 and carotid intima-media thickness in the Diabetes Heart Study, a predominantly White diabetic population. The nonsynonymous SNP rs11574 results in an amino acid substitution in the C-terminal region of ID3, attenuating the dominant negative function of ID3 as an inhibitor of basic HLH factor E12-mediated transcription. In the current investigation, we characterize the association between the functionally significant polymorphism in ID3, rs11574, with human coronary pathology.The Multi-Ethnic Study of Atherosclerosis (MESA is a longitudinal study of subclinical cardiovascular disease, including non-Hispanic White (n = 2,588, African American (n = 2,560 and Hispanic (n = 2,130 participants with data on coronary artery calcium (CAC. The Coronary Assessment in Virginia cohort (CAVA included 71 patients aged 30-80 years, undergoing a medically necessary cardiac catheterization and intravascular ultrasound (IVUS at the University of Virginia. ID3 SNP rs11574 risk allele was associated with the presence of CAC in MESA Whites (P = 0.017. In addition, the risk allele was associated with greater atheroma burden and stenosis in the CAVA cohort (P = 0.003, P = 0.04 respectively. The risk allele remained predictive of atheroma burden in multivariate analysis (Model 1: covariates age, gender, and LDL, regression coefficient = 9.578, SE = 3.657, p = 0.0110; Model 2: covariates Model 1, presence of hypertension, presence of diabetes, regression coefficient = 8.389, SE = 4.788, p = 0.0163.We present additional cohorts that demonstrate association of ID3 SNP rs11574 directly with human coronary artery pathology as measured by CAC and IVUS: one a multiethnic, relatively healthy population with low levels of diabetes and the second a predominantly White population with a higher incidence of T2DM referred for cardiac catheterization.
Schieve, Laura A.; Clayton, Heather B.; Durkin, Maureen S.; Wingate, Martha S.; Drews-Botsch, Carolyn
2015-01-01
While studies report associations between perinatal outcomes and both autism spectrum disorder (ASD) and intellectual disability (ID), there has been little study of ASD with versus without co-occurring ID. We compared perinatal risk factors among 7547 children in the 2006-2010 Autism and Developmental Disability Monitoring Network classified as…
Observation of dipole bands in 144Sm
International Nuclear Information System (INIS)
Raut, R.; Ganguly, S.; Kshetri, R.; Banerjee, P.; Bhattacharya, S.; Dasmahapatra, B.; Mukherjee, A.; Sahasarkar, M.; Goswami, A.; Basu, S.K.; Bhattacharjee, T.; Mukherjee, G.; Chakraborty, A.; Ghughre, S.S.; Krishichayan; Mukhopadhyay, S.; Gangopadhyay, G.; Singh, A.K.
2007-01-01
The nucleus 144 Sm (Z=62, N=82), with its proximity to the shell closure and possibilities of particles and holes occupying high j orbitals, following appropriate excitations, is a suitable system for observation of dipole (MR) bands
Supporting co-creation with software, the idSpace platform
Van Rosmalen, Peter; Boon, Jo; Bitter-Rijpkema, Marlies; Sie, Rory; Sloep, Peter
2014-01-01
Innovation, in general, requires teamwork among specialist of different disciplines. The idSpace project developed ideas on how teams of collaborating innovators could best be supported. These ideas were embodied in a platform that the project developed. This idSpace platform allows its users to
Picture This: How to Establish an Effective School ID Card Program
Finkelstein, David
2013-01-01
Most school districts do not have an ID card policy that everyone knows and follows, yet. many school districts are implementing ID card programs to address concerns about safety, efficiency, and convenience. A well-thought-out ID card program leads to greater security and smoother operations throughout the school and should thus be a priority.…
27 CFR 70.144 - Special rules.
2010-04-01
..., under local law, one person is subrogated to the rights of another with respect to a lien or interest, such person shall be subrogated to such rights for purposes of any lien imposed by 26 U.S.C. 6321 or... Excise and Special (Occupational) Tax Lien for Taxes § 70.144 Special rules. (a) Actual notice or...
IMI's CANCER-ID: Status of liquid biopsy standardization
Pantel, Klaus; Terstappen, Leon W. M. M.; Baggiani, Barbara; Krahn, Thomas; Schlange, Thomas
The CANCER-ID (www.cancer-id.eu) consortium was established in early 2015 with more than 30 partners as part of the Innovative Medicines Initiative (IMI), Europe's largest public-private partnership funded in equal parts by the European Union and the European Federation of Pharmaceutical Industries
Security analysis for biometric data in ID documents
Schimke, S.; Kiltz, S.; Vielhauer, C.; Kalker, A.A.C.M.
2005-01-01
In this paper we analyze chances and challenges with respect to the security of using biometrics in ID documents. We identify goals for ID documents, set by national and international authorities, and discuss the degree of security, which is obtainable with the inclusion of biometric into documents
Knoto-ID: a tool to study the entanglement of open protein chains using the concept of knotoids.
Dorier, Julien; Goundaroulis, Dimos; Benedetti, Fabrizio; Stasiak, Andrzej
2018-05-02
The backbone of most proteins forms an open curve. To study their entanglement, a common strategy consists in searching for the presence of knots in their backbones using topological invariants. However, this approach requires to close the curve into a loop, which alters the geometry of curve. Knoto-ID allows evaluating the entanglement of open curves without the need to close them, using the recent concept of knotoids which is a generalization of the classical knot theory to open curves. Knoto-ID can analyse the global topology of the full chain as well as the local topology by exhaustively studying all subchains or only determining the knotted core. Knoto-ID permits to localize topologically non-trivial protein folds that are not detected by informatics tools detecting knotted protein folds. Knoto-ID is written in C ++ and includes R (www.R-project.org) scripts to generate plots of projections maps, fingerprint matrices and disk matrices. Knoto-ID is distributed under the GNU General Public License (GPL), version 2 or any later version and is available at https://github.com/sib-swiss/Knoto-ID. A binary distribution for Mac OS X, Linux and Windows with detailed user guide and examples can be obtained from https://www.vital-it.ch/software/Knoto-ID. julien.dorier@sib.swiss.
A Neighborhood Condition for Fractional ID-[A, B]-Factor-Critical Graphs
Directory of Open Access Journals (Sweden)
Zhou Sizhong
2016-05-01
Full Text Available Let G be a graph of order n, and let a and b be two integers with 1 ≤ a ≤ b. Let h : E(G → [0, 1] be a function. If a ≤ ∑e∋x h(e ≤ b holds for any x ∈ V (G, then we call G[Fh] a fractional [a, b]-factor of G with indicator function h, where Fh = {e ∈ E(G : h(e > 0}. A graph G is fractional independent-set-deletable [a, b]-factor-critical (in short, fractional ID-[a, b]- factor-critical if G − I has a fractional [a, b]-factor for every independent set I of G. In this paper, it is proved that if for any two nonadjacent vertices x, y ∈ V (G, then G is fractional ID-[a, b]-factor-critical. Furthermore, it is shown that this result is best possible in some sense.
The diagnostic dilemma of tumor induced osteomalacia: a retrospective analysis of 144 cases.
Feng, Juan; Jiang, Yan; Wang, Ou; Li, Mei; Xing, Xiaoping; Huo, Li; Li, Fang; Yu, Wei; Zhong, Ding-Rong; Jin, Jin; Liu, Yong; Qi, Fang; Lv, Wei; Zhou, Lian; Meng, Xun-Wu; Xia, Wei-Bo
2017-07-28
Diagnostic delay of tumor induced osteomalacia (TIO) is common in clinic practice. To investigate the diagnostic condition of TIO in China and raise clinicians' awareness of TIO, we retrospectively analyzed clinical manifestations, biochemical features, and specially evaluated missed diagnoses and misdiagnoses among 144 TIO patients from Peking Union Medical College Hospital during December 1982 to December 2014. Clinical presentations of TIO mainly included bone pain, difficulty in walking, pathological fractures, muscle weakness, and height loss. TIO patients demonstrated hypophosphatemia (0.48±0.13 mmol/L), elevated serum alkaline phosphatase (277.9±152.6 U/L), reduced tubular maximum for phosphorus/glomerular filtration rate (0.39±0.14) and markedly elevated serum fibroblast growth factor 23 (FGF23) (median level 302.9 pg/mL). The average time from onset to a correct diagnosis was 2.9±2.3 years while the mean duration from onset to tumor resection was 5.4±4.2 years. The initial misdiagnosis rate was 95.1% (137/144) and 240 case-times of misdiagnoses occurred among the 144 cases. The most frequent misdiagnoses were intervertebral disc herniation, spondyloarthritis (including ankylosing spondylitis) and osteoporosis. A total of 43.1% (62/144) cases with hypophosphatemia presented on their laboratory sheets were neglected and missed diagnosed. Our study showed that TIO was frequently misdiagnosed and missed diagnosed due to its rarity, insidious onset, nonspecific clinical manifestations and clinicians' poor recognition. It is necessary to test serum phosphorus in patients with musculoskeletal symptoms and difficulty in walking. The measurement of serum FGF23 is rather valuable. Once hypophosphatemia is discovered, TIO should be suspected and it is highly recommended to search for tumors and perform curative surgery.
Guinea pig ID-like families of SINEs.
Kass, David H; Schaetz, Brian A; Beitler, Lindsey; Bonney, Kevin M; Jamison, Nicole; Wiesner, Cathy
2009-05-01
Previous studies have indicated a paucity of SINEs within the genomes of the guinea pig and nutria, representatives of the Hystricognathi suborder of rodents. More recent work has shown that the guinea pig genome contains a large number of B1 elements, expanding to various levels among different rodents. In this work we utilized A-B PCR and screened GenBank with sequences from isolated clones to identify potentially uncharacterized SINEs within the guinea pig genome, and identified numerous sequences with a high degree of similarity (>92%) specific to the guinea pig. The presence of A-tails and flanking direct repeats associated with these sequences supported the identification of a full-length SINE, with a consensus sequence notably distinct from other rodent SINEs. Although most similar to the ID SINE, it clearly was not derived from the known ID master gene (BC1), hence we refer to this element as guinea pig ID-like (GPIDL). Using the consensus to screen the guinea pig genomic database (Assembly CavPor2) with Ensembl BlastView, we estimated at least 100,000 copies, which contrasts markedly to just over 100 copies of ID elements. Additionally we provided evidence of recent integrations of GPIDL as two of seven analyzed conserved GPIDL-containing loci demonstrated presence/absence variants in Cavia porcellus and C. aperea. Using intra-IDL PCR and sequence analyses we also provide evidence that GPIDL is derived from a hystricognath-specific SINE family. These results demonstrate that this SINE family continues to contribute to the dynamics of genomes of hystricognath rodents.
La certificazione professionale I&D in Europa
Franco, Augusta
2003-01-01
The statement points out the activity of I&D European associations in the field of competences' certification, in ECIA federation's area as well as in the national one. In the statement there are references on history and outcomes of DECIDoc project; objectives and operative stages of CERTIDoc project, promoted by ECIA; and enterprises of I&D associations in France, Spain, Germany and Italy. Secondly, it is illustrated the activity of Italian librarians and archivists associatio...
Beta-spectrometer with Si-detectors for the study of 144Ce-144Pr decays
Alexeev, I. E.; Bakhlanov, S. V.; Bazlov, N. V.; Chmel, E. A.; Derbin, A. V.; Drachnev, I. S.; Kotina, I. M.; Muratova, V. N.; Pilipenko, N. V.; Semyonov, D. A.; Unzhakov, E. V.; Yeremin, V. K.
2018-05-01
Here we present the specifications of a newly developed beta-spectrometer, based on full absorption Si(Li) detector and thin transmission detector, allowing one to perform efficient separation beta-radiation and accompanying X-rays and gamma radiation. Our method is based on registration of coincident events from both detectors. The spectrometer can be used for precision measurements of various beta-spectra, namely for the beta-spectrum shape study of 144Pr, which is considered to be an advantageous anti-neutrino source for sterile neutrino searches.
The Self-Identity Protein IdsD Is Communicated between Cells in Swarming Proteus mirabilis Colonies.
Saak, Christina C; Gibbs, Karine A
2016-12-15
Proteus mirabilis is a social bacterium that is capable of self (kin) versus nonself recognition. Swarming colonies of this bacterium expand outward on surfaces to centimeter-scale distances due to the collective motility of individual cells. Colonies of genetically distinct populations remain separate, while those of identical populations merge. Ids proteins are essential for this recognition behavior. Two of these proteins, IdsD and IdsE, encode identity information for each strain. These two proteins bind in vitro in an allele-restrictive manner. IdsD-IdsE binding is correlated with the merging of populations, whereas a lack of binding is correlated with the separation of populations. Key questions remained about the in vivo interactions of IdsD and IdsE, specifically, whether IdsD and IdsE bind within single cells or whether IdsD-IdsE interactions occur across neighboring cells and, if so, which of the two proteins is exchanged. Here we demonstrate that IdsD must originate from another cell to communicate identity and that this nonresident IdsD interacts with IdsE resident in the recipient cell. Furthermore, we show that unbound IdsD in recipient cells does not cause cell death and instead appears to contribute to a restriction in the expansion radius of the swarming colony. We conclude that P. mirabilis communicates IdsD between neighboring cells for nonlethal kin recognition, which suggests that the Ids proteins constitute a type of cell-cell communication. We demonstrate that self (kin) versus nonself recognition in P. mirabilis entails the cell-cell communication of an identity-encoding protein that is exported from one cell and received by another. We further show that this intercellular exchange affects swarm colony expansion in a nonlethal manner, which adds social communication to the list of potential swarm-related regulatory factors. Copyright © 2016, American Society for Microbiology. All Rights Reserved.
Application of Sharī‘ah contracts in contemporary Islamic finance: A maqāṣid perspective
Directory of Open Access Journals (Sweden)
Younes Soualhi
2015-12-01
Full Text Available This research exposes the underlying maqāṣid embedded in Sharī‘ah contracts as applied in Islamic banking and finance. It addresses the problem of not observing maqāṣid in nominated and combined Sharī‘ah contracts as well as the problem of not sufficiently imbuing maqāṣid in products developed by Islamic financial institutions. As a benchmark of the maqāṣid of wealth, the research adopts Ibn ‘Āshūr’s classification of maqāṣid to evaluate the conformity of Sharī‘ah contracts to Maqāṣid al-Sharī‘ah namely, justice, circulation, transparency, and firmness. The study focuses on three markets related to the application of Sharī‘ah contracts, namely, banking, Islamic capital market, and takāful. The study concludes that, by and large, the application of Sharī‘ah contracts has observed Maqāṣid al-Sharī‘ah during its development and initial application stages of Islamic finance products; however, offering such products in the market has raised economic questions as to their viability and economic values. In addition, the malpractice of some Sharī‘ah contracts has long raised concerns as to the maqāṣid compliance of such products. The research recommends a de-sophistication of Islamic financial engineering to minimise the possibility of convergence with conventional finance. The research also emphasises product differentiation based on less complicated combined Sharī‘ah contracts.
Best practices for the implementation of the REAL ID Act.
2015-10-01
The REAL ID Act specifies the minimum standards that must be used to produce and issue drivers license and : identification cards that are REAL ID compliant. Beginning in 2020, if a person does not possess a form of : identification that meets REA...
OpenID Connect as a security service in cloud-based medical imaging systems.
Ma, Weina; Sartipi, Kamran; Sharghigoorabi, Hassan; Koff, David; Bak, Peter
2016-04-01
The evolution of cloud computing is driving the next generation of medical imaging systems. However, privacy and security concerns have been consistently regarded as the major obstacles for adoption of cloud computing by healthcare domains. OpenID Connect, combining OpenID and OAuth together, is an emerging representational state transfer-based federated identity solution. It is one of the most adopted open standards to potentially become the de facto standard for securing cloud computing and mobile applications, which is also regarded as "Kerberos of cloud." We introduce OpenID Connect as an authentication and authorization service in cloud-based diagnostic imaging (DI) systems, and propose enhancements that allow for incorporating this technology within distributed enterprise environments. The objective of this study is to offer solutions for secure sharing of medical images among diagnostic imaging repository (DI-r) and heterogeneous picture archiving and communication systems (PACS) as well as Web-based and mobile clients in the cloud ecosystem. The main objective is to use OpenID Connect open-source single sign-on and authorization service and in a user-centric manner, while deploying DI-r and PACS to private or community clouds should provide equivalent security levels to traditional computing model.
Interoperability for electronic ID
Zygadlo, Zuzanna
2009-01-01
Electronic Business, including eBanking, eCommerce and eGovernmental services, is today based on a large variety of security solutions, comprising electronic IDs provided by a broad community of Public Key Infrastructure (PKI) vendors. Significant differences in implementations of those solutions introduce a problem of lack of interoperability in electronic business, which have not yet been resolved by standardization and interoperability initiatives based on existing PKI trust models. It i...
ID4 promotes AR expression and blocks tumorigenicity of PC3 prostate cancer cells
International Nuclear Information System (INIS)
Komaragiri, Shravan Kumar; Bostanthirige, Dhanushka H.; Morton, Derrick J.; Patel, Divya; Joshi, Jugal; Upadhyay, Sunil; Chaudhary, Jaideep
2016-01-01
Deregulation of tumor suppressor genes is associated with tumorigenesis and the development of cancer. In prostate cancer, ID4 is epigenetically silenced and acts as a tumor suppressor. In normal prostate epithelial cells, ID4 collaborates with androgen receptor (AR) and p53 to exert its tumor suppressor activity. Previous studies have shown that ID4 promotes tumor suppressive function of AR whereas loss of ID4 results in tumor promoter activity of AR. Previous study from our lab showed that ectopic ID4 expression in DU145 attenuates proliferation and promotes AR expression suggesting that ID4 dependent AR activity is tumor suppressive. In this study, we examined the effect of ectopic expression of ID4 on highly malignant prostate cancer cell, PC3. Here we show that stable overexpression of ID4 in PC3 cells leads to increased apoptosis and decreased cell proliferation and migration. In addition, in vivo studies showed a decrease in tumor size and volume of ID4 overexpressing PC3 cells, in nude mice. At the molecular level, these changes were associated with increased androgen receptor (AR), p21, and AR dependent FKBP51 expression. At the mechanistic level, ID4 may regulate the expression or function of AR through specific but yet unknown AR co-regulators that may determine the final outcome of AR function. - Highlights: • ID4 expression induces AR expression in PC3 cells, which generally lack AR. • ID4 expression increased apoptosis and decreased cell proliferation and invasion. • Overexpression of ID4 reduces tumor growth of subcutaneous xenografts in vivo. • ID4 induces p21 and FKBP51 expression- co-factors of AR tumor suppressor activity.
ID4 promotes AR expression and blocks tumorigenicity of PC3 prostate cancer cells
Energy Technology Data Exchange (ETDEWEB)
Komaragiri, Shravan Kumar; Bostanthirige, Dhanushka H.; Morton, Derrick J.; Patel, Divya; Joshi, Jugal; Upadhyay, Sunil; Chaudhary, Jaideep, E-mail: jchaudhary@cau.edu
2016-09-09
Deregulation of tumor suppressor genes is associated with tumorigenesis and the development of cancer. In prostate cancer, ID4 is epigenetically silenced and acts as a tumor suppressor. In normal prostate epithelial cells, ID4 collaborates with androgen receptor (AR) and p53 to exert its tumor suppressor activity. Previous studies have shown that ID4 promotes tumor suppressive function of AR whereas loss of ID4 results in tumor promoter activity of AR. Previous study from our lab showed that ectopic ID4 expression in DU145 attenuates proliferation and promotes AR expression suggesting that ID4 dependent AR activity is tumor suppressive. In this study, we examined the effect of ectopic expression of ID4 on highly malignant prostate cancer cell, PC3. Here we show that stable overexpression of ID4 in PC3 cells leads to increased apoptosis and decreased cell proliferation and migration. In addition, in vivo studies showed a decrease in tumor size and volume of ID4 overexpressing PC3 cells, in nude mice. At the molecular level, these changes were associated with increased androgen receptor (AR), p21, and AR dependent FKBP51 expression. At the mechanistic level, ID4 may regulate the expression or function of AR through specific but yet unknown AR co-regulators that may determine the final outcome of AR function. - Highlights: • ID4 expression induces AR expression in PC3 cells, which generally lack AR. • ID4 expression increased apoptosis and decreased cell proliferation and invasion. • Overexpression of ID4 reduces tumor growth of subcutaneous xenografts in vivo. • ID4 induces p21 and FKBP51 expression- co-factors of AR tumor suppressor activity.
Toxicity of 144Ce inhaled in a relatively insoluble form by aged beagle dogs. VI
International Nuclear Information System (INIS)
Hahn, F.F.; Hanika-Rebar, C.; Boecker, B.B.; Hobbs, C.H.; McClellan, R.O.; Pickrell, J.A.
1977-01-01
The toxicity of 144 Ce inhaled in fused aluminosilicate particles by 8 to 10.5-year-old dogs is being investigated to provide information on age-related differences in the response of older members of the human population to accidental inhalation of radioactive aerosols. These data on aged dogs will be compared to the results of similar studies of dogs exposed at approximately 3 months or 12 to 14 months of age. Six blocks of five female dogs each have been divided into four exposure levels with mean initial lung burdens of 7.2, 14, 28 and 57 μCi 144 Ce/kg body weight. Six blocks of four male dogs each have been divided into three exposure levels with mean initial lung burdens of 7.2, 14 and 28 μCi 144 Ce/kg body weight. Controls in each block were exposed to fused aluminosilicate particles containing stable cerium. Eighteen dogs with initial lung burdens ranging from 14 to 75 μCi 144 Ce/kg body weight and cumulative doses to lung of from 22,000 to 74,000 rads have died or were euthanized 197 to 1207 days after exposure with clinicopathologic findings of radiation pneumonitis and pulmonary fibrosis
Événement, idéologie et utopie
Directory of Open Access Journals (Sweden)
Jean-Luc AMALRIC
2014-12-01
Full Text Available RESUMEL’hypothèse que tente d’esquisser cet article est que l’idée ricœurienne d’une médiatisation dynamique des contradictions de l’imaginaire social présuppose une corrélation originaire de l’idéologie et de l’utopie qui ne peut elle-même être comprise qu’à partir de l’événement de l’institution d’un imaginaire social constituant. Dans un premier temps, l’article s’efforce de cerner ce qui fait la spécificité de la théorie ricœurienne de l’idéologie et de l’utopie comme « pratiques imaginatives », en soulignant à ce titre l’influence déterminante des thèses de Jacques Ellul sur l’idéologie. Puis, dans un second temps, il s’engage dans une analyse régressive qui conduit de la réappropriation ricœurienne de la conception dialectique de l’idéologie et de l’utopie exposée par Mannheim à l’idée d’un fondement événementiel de ces deux formes opposées de l’imaginaire social.Mots-Clés : Evénement, idéologie, utopie, Ellul, Mannheim. ABSTRACTThis paper attempts to sketch out the hypothesis that the Ricœurian conception of a dynamic mediatization of the contradictions of the social imaginary presupposes an original correlation between ideology and utopia, which can itself be understood only from the event that institutes a constitutive social imaginary. The first part of the paper marks out the specificity of the Ricœurian theory of ideology and utopia in terms of “imaginative practices”, underlining the determining influence of Jacques Ellul’s theses on ideology. The second part tries to develop a regressive argument, starting from the Ricœurian re-appropriation of Mannheim’s dialectical conception of ideology and utopia, and leading back to the idea of an event foundation for these two opposed forms of the social imaginary.Keywords : Event, Ideology, Utopia, Ellul, Mannheim
CASK inhibits ECV304 cell growth and interacts with Id1
International Nuclear Information System (INIS)
Qi Jie; Su Yongyue; Sun Rongju; Zhang Fang; Luo Xiaofeng; Yang Zongcheng; Luo Xiangdong
2005-01-01
Calcium/calmodulin-dependent serine protein kinase (CASK) is generally known as a scaffold protein. Here we show that overexpression of CASK resulted in a reduced rate of cell growth, while inhibition of expression of endogenous CASK via RNA-mediated interference resulted in an increased rate of cell growth in ECV304 cells. To explore the molecular mechanism, we identified a novel CASK-interacting protein, inhibitor of differentiation 1 (Id1) with a yeast two-hybrid screening. Furthermore, endogenous CASK and Id1 proteins were co-precipitated from the lysates of ECV304 cells by immunoprecipitation. Mammalian two-hybrid protein-protein interaction assays indicated that CASK possessed a different binding activity for Id1 and its alternative splicing variant. It is known that Id proteins play important roles in regulation of cell proliferation and differentiation. Thus, we speculate that the regulation of cell growth mediated by CASK may be involved in Id1. Our findings indicate a novel function of CASK, the mechanism that remains to be further investigated
Toxicity of 144Ce fused clay particles inhaled by aged dogs. III
International Nuclear Information System (INIS)
Hahn, F.F.; Boecker, B.B.; Hobbs, C.H.; Jones, R.K.; McClellan, R.O.; Pickrell, J.A.
1974-01-01
The toxicity of 144 Ce fused clay particles inhaled by 8- to 10.5-year-old dogs is being investigated to provide information on age-related differences in the response of older members of the human population to accidental inhalation of radioactive aerosols. These data on aged dogs will be compared to the results of similar studies using dogs exposed at approximately 3 months or 12 to 14 months of age. To date, 7 blocks of 5 dogs each, divided into 4 exposure levels with mean initial lung burdens of 7.5, 14, 24, and 57 μCi/kg body weight and control dogs exposed to non-labeled fused clay particles have been entered into a longevity study. Twelve dogs with initial lung burdens ranging from 20 to 75 μCi 144 Ce/kg body weight and cumulative doses to lung of from 22,000 to 74,000 rads have died at 197 to 943 days post-inhalation with clinico-pathologic findings of radiation pneumonitis and pulmonary fibrosis. Two of these also had congestive heart failure. In addition, 4 dogs with ILBs of 8 to 14 μCi 144 Ce/kg body weight have died of mammary neoplasms or congestive heart failure but without radiation pneumonitis. One dog with an ILB of 9 μCi 144 Ce/kg body weight died with a chronic interstitial foreign body pneumonia. Two control dogs have died, one with a mammary carcinoma and one with pyometra. Pulmonary retention of the inhaled 144 Ce was similar to that observed previously in dogs exposed at 18 to 22 months of age in a radiation dose pattern study. Serial observations are continuing on the 11 surviving 144 Ce-exposed dogs and 5 controls. (U.S.)
ID card number detection algorithm based on convolutional neural network
Zhu, Jian; Ma, Hanjie; Feng, Jie; Dai, Leiyan
2018-04-01
In this paper, a new detection algorithm based on Convolutional Neural Network is presented in order to realize the fast and convenient ID information extraction in multiple scenarios. The algorithm uses the mobile device equipped with Android operating system to locate and extract the ID number; Use the special color distribution of the ID card, select the appropriate channel component; Use the image threshold segmentation, noise processing and morphological processing to take the binary processing for image; At the same time, the image rotation and projection method are used for horizontal correction when image was tilting; Finally, the single character is extracted by the projection method, and recognized by using Convolutional Neural Network. Through test shows that, A single ID number image from the extraction to the identification time is about 80ms, the accuracy rate is about 99%, It can be applied to the actual production and living environment.
Regulation of Id2 expression in EL4 T lymphoma cells overexpressing growth hormone.
Weigent, Douglas A
2009-01-01
In previous studies, we have shown that overexpression of growth hormone (GH) in cells of the immune system upregulates proteins involved in cell growth and protects from apoptosis. Here, we report that overexpression of GH in EL4 T lymphoma cells (GHo) also significantly increased levels of the inhibitor of differentiation-2 (Id2). The increase in Id2 was suggested in both Id2 promoter luciferase assays and by Western analysis for Id2 protein. To identify the regulatory elements that mediate transcriptional activation by GH in the Id2 promoter, promoter deletion analysis was performed. Deletion analysis revealed that transactivation involved a 301-132bp region upstream to the Id2 transcriptional start site. The pattern in the human GHo Jurkat T lymphoma cell line paralleled that found in the mouse GHo EL4 T lymphoma cell line. Significantly less Id2 was detected in the nucleus of GHo EL4 T lymphoma cells compared to vector alone controls. Although serum increased the levels of Id2 in control vector alone cells, no difference was found in the total levels of Id2 in GHo EL4 T lymphoma cells treated with or without serum. The increase in Id2 expression in GHo EL4 T lymphoma cells measured by Id2 promoter luciferase expression and Western blot analysis was blocked by the overexpression of a dominant-negative mutant of STAT5. The results suggest that in EL4 T lymphoma cells overexpressing GH, there is an upregulation of Id2 protein that appears to involve STAT protein activity.
Psychometrics and latent structure of the IDS and QIDS with young adult students.
González, David Andrés; Boals, Adriel; Jenkins, Sharon Rae; Schuler, Eric R; Taylor, Daniel
2013-07-01
Students and young adults have high rates of suicide and depression, thus are a population of interest. To date, there is no normative psychometric information on the IDS and QIDS in these populations. Furthermore, there is equivocal evidence on the factor structure and subscales of the IDS. Two samples of young adult students (ns=475 and 1681) were given multiple measures to test the psychometrics and dimensionality of the IDS and QIDS. The IDS, its subscales, and QIDS had acceptable internal consistencies (αs=.79-90) and favorable convergent and divergent validity correlations. A three-factor structure and two Rasch-derived subscales best fit the IDS. The samples were collected from one university, which may influence generalizability. The IDS and QIDS are desirable measures of depressive symptoms when studying young adult students. Copyright © 2013 Elsevier B.V. All rights reserved.
40 CFR 144.64 - Incapacity of owners or operators, guarantors, or financial institutions.
2010-07-01
..., guarantors, or financial institutions. 144.64 Section 144.64 Protection of Environment ENVIRONMENTAL..., or financial institutions. (a) An owner or operator must notify the Regional Administrator by... institution. The owner or operator must establish other financial assurance or liability coverage within 60...
A Cross-Layer, Anomaly-Based IDS for WSN and MANET.
Amouri, Amar; Morgera, Salvatore D; Bencherif, Mohamed A; Manthena, Raju
2018-02-22
Intrusion detection system (IDS) design for mobile adhoc networks (MANET) is a crucial component for maintaining the integrity of the network. The need for rapid deployment of IDS capability with minimal data availability for training and testing is an important requirement of such systems, especially for MANETs deployed in highly dynamic scenarios, such as battlefields. This work proposes a two-level detection scheme for detecting malicious nodes in MANETs. The first level deploys dedicated sniffers working in promiscuous mode. Each sniffer utilizes a decision-tree-based classifier that generates quantities which we refer to as correctly classified instances (CCIs) every reporting time. In the second level, the CCIs are sent to an algorithmically run supernode that calculates quantities, which we refer to as the accumulated measure of fluctuation (AMoF) of the received CCIs for each node under test (NUT). A key concept that is used in this work is that the variability of the smaller size population which represents the number of malicious nodes in the network is greater than the variance of the larger size population which represents the number of normal nodes in the network. A linear regression process is then performed in parallel with the calculation of the AMoF for fitting purposes and to set a proper threshold based on the slope of the fitted lines. As a result, the malicious nodes are efficiently and effectively separated from the normal nodes. The proposed scheme is tested for various node velocities and power levels and shows promising detection performance even at low-power levels. The results presented also apply to wireless sensor networks (WSN) and represent a novel IDS scheme for such networks.
DEFF Research Database (Denmark)
Schøsler, Jørn
2013-01-01
Der gives en analyse af begreberne 'evidens' og 'medfødte idéer' hos Descartes og Locke samt hos de franske oplysningsfilosoffer.......Der gives en analyse af begreberne 'evidens' og 'medfødte idéer' hos Descartes og Locke samt hos de franske oplysningsfilosoffer....
REFORMASI PEMAHAMAN TEORI MAQᾹṢID SYARIAH Analisis Pendekatan Sistem Jasser Auda
Directory of Open Access Journals (Sweden)
Muhammad Iqbal Fasa
2016-12-01
Full Text Available This paper attempts to offer reform ideas Jasser Auda thought related reforms theoretical understanding of maqᾱṣid sharia. The systems approach is done by Auda critize the theory of classical maqᾱṣid more likely to hierarchical and narrow mindset. The classical maqᾱṣid pressure a point more on protection and preservation. Whereas the new maqᾱṣid theory emphasizes development (construction, development and rights (rights. Thus, Auda developed the concept of human development as the main target of maslahah (public interest. Auda offers the systems approach, namely: cognitive nature; interrelated; wholeness; openness; multi dimentionality and purposefulness. At the end of the discussion in this paper, the authors develop the idea of Jasser Auda by offering Sharia Maqᾱṣid concept in the context of Islamic Economics
Ekspert : mobiil-ID kasutamine valimistel turvariske ei tekita / Holger Roonemaa
Roonemaa, Holger
2008-01-01
E-valimiste projektijuhi Taavi Martensi väitel pole põhjust kahelda mobiil-ID turvalisuses. Valimiskomisjoni esimehe Heiki Sibula meelest peaks m-ID kaarte välja andma kodakondsus- ja migratsiooniamet
Tracey, Monica W.; Unger, Kelly L.
2012-01-01
As the need for instructing a globalized workforce increases, instructional designers must embrace the constraints and the opportunities these projects provide in order to move the field of cross-cultural instructional design (ID) forward. Cross-cultural projects offer multiple avenues for growth in ID practice, overcoming cultural barriers, and a…
Id-1 is not expressed in the luminal epithelial cells of mammary glands
International Nuclear Information System (INIS)
Uehara, Norihisa; Chou, Yu-Chien; Galvez, Jose J; Candia, Paola de; Cardiff, Robert D; Benezra, Robert; Shyamala, Gopalan
2003-01-01
The family of inhibitor of differentiation/DNA binding (Id) proteins is known to regulate development in several tissues. One member of this gene family, Id-1, has been implicated in mammary development and carcinogenesis. Mammary glands contain various cell types, among which the luminal epithelial cells are primarily targeted for proliferation, differentiation and carcinogenesis. Therefore, to assess the precise significance of Id-1 in mammary biology and carcinogenesis, we examined its cellular localization in vivo using immunohistochemistry. Extracts of whole mammary glands from wild type and Id-1 null mutant mice, and tissue sections from paraffin-embedded mouse mammary glands from various developmental stages and normal human breast were subjected to immunoblot and immunohistochemical analyses, respectively. In both these procedures, an anti-Id-1 rabbit polyclonal antibody was used for detection of Id-1. In immunoblot analyses, using whole mammary gland extracts, Id-1 was detected. In immunohistochemical analyses, however, Id-1 was not detected in the luminal epithelial cells of mammary glands during any stage of development, but it was detected in vascular endothelial cells. Id-1 is not expressed in the luminal epithelial cells of mammary glands
ID Barrel installed in cryostat
Apsimon, R.; Romaniouk, A.
Wednesday 23rd August was a memorable day for the Inner Detector community as they witnessed the transport and installation of the central part of the inner detector (ID-barrel) into the ATLAS detector. Many members of the collaboration gathered to witness this moment at Point 1. After years of design, construction and commissioning, the outer two detectors (TRT and SCT) of the ID barrel were moved from the SR1 cleanroom to the ATLAS cavern. The barrel was moved across the car park from building 2175 to SX1. Although only a journey of about 100 metres, this required weeks of planning and some degree of luck as far as the weather was concerned. Accelerometers were fitted to the barrel to provide real-time monitoring and no values greater than 0.1 g were recorded, fully satisfying the transport specification for this extremely precise and fragile detector. Muriel, despite her fear of heights, bravely volunteered to keep a close eye on the detector. Swapping cranes to cross the entire parking lot, while Mur...
TUG1 promotes osteosarcoma tumorigenesis by upregulating EZH2 expression via miR-144-3p.
Cao, Jiaqing; Han, Xinyou; Qi, Xin; Jin, Xiangyun; Li, Xiaolin
2017-10-01
lncRNA-TUG1 (Taurine upregulated 1) is up-regulated and highly correlated with poor prognosis and disease status in osteosarcoma. TUG1 knockdown inhibits osteosarcoma cell proliferation, migration and invasion, and promotes apoptosis. However, its mechanism of action has not been well addressed. Growing evidence documented that lncRNA works as competing endogenous (ce)RNAs to modulate the expression and biological functions of miRNA. As a putative combining target of TUG1, miR-144-3p has been associated with the progress of osteosarcoma. To verify whether TUG1 functions through regulating miR-144-3p, the expression levels of TUG1 and miR-144-3p in osteosarcoma tissues and cell lines were determined. TUG1 was upregulated in osteosarcoma tissues and cell lines, and negatively correlated with miR-144-3p. TUG1 knockdown induced miR-144-3p expression in MG63 and U2OS cell lines. Results from dual luciferase reporter assay, RNA-binding protein immuno-precipitation (RIP) and applied biotin-avidin pull-down system confirmed TUG1 regulated miR-144-3p expression through direct binding. EZH2, a verified target of miR-144-3p was upregulated in osteosarcoma tissues and negatively correlated with miR-144-3p. EZH2 was negatively regulated by miR-144-3p and positively regulated by TUG1. Gain-and loss-of-function experiments were performed to analyze the role of TUG1, miR-144-3p and EZH2 in the migration and EMT of osteosarcoma cells. EZH2 over-expression partly abolished TUG1 knockdown or miR-144-3p overexpression induced inhibition of migration and EMT in osteosarcoma cells. In addition, TUG1 knockdown represses the activation of Wnt/β-catenin pathway, which was reversed by EZH2 over-expression. The activator of Wnt/β-catenin pathway LiCl could partially block the TUG1-knockdown induced osteosarcoma cell migration and EMT inhibition. In conclusion, our results showed that TUG1 plays an important role in osteosarcoma development through miRNA-144-3p/EZH2/Wnt/β-catenin pathway.
Toxicity of inhaled 144Ce fused clay particles in beagle dogs. VII
International Nuclear Information System (INIS)
Hahn, F.F.; Boecker, B.B.; Hobbs, C.H.; Jones, R.K.; Mauderly, J.L.; McClellan, R.O.; Pickrell, J.A.
1974-01-01
The metabolism, dosimetry, and effects of inhaled 144 Ce in fused clay particles are being investigated in the Beagle dog to aid in assessing the biological consequences of release of 144 Ce in a relatively insoluble form such as might occur in certain types of nuclear accidents. The toxicity of inhaled 144 Ce fused clay is also of general interest since it is representative of intermediate-lived beta-emitting radionuclides. Two major studies with young adult dogs (12 to 14 months of age at exposure) are involved: (1) a metabolism and dosimetry study in which 24 dogs were serially sacrificed over an extended period of time, and (2) a longevity study with 2 series of dogs; Series I with 15 dogs exposed to aerosols of 144 Ce in fused clay particles to yield initial lung burdens of 11 to 210 μCi/kg body weight and 3 control dogs exposed to nonradioactive fused clay particles and Series II with 96 dogs exposed to aerosols of 144 Ce in fused clay particles to yield initial lung burdens of 0.0024 to 66 μCi/kg body weight and 12 control dogs exposed to nonradioactive fused clay particles. Twenty-eight dogs died or were euthanized at 143 to 2396 days after inhalation of 144 Ce. The prominent findings were radiation pneumonitis in 17 dogs that died or were euthanized at early time periods and neoplastic disease in 10 of the 11 dogs that died or were euthanized at 750 days or later; 5 with hemangiosarcoma of the lung, 1 with both a hemangiosarcoma and a fibrosarcoma of the lung, 1 with both a bronchiolo-alveolar carcinoma and a hemangiosarcoma of lung, 1 with a hemangiosarcoma of lung, bronchiolo-alveolar carcinoma, and a bronchiogenic adenocarcinoma, and 1 each with a hemangiosarcoma of the mediastinum and of the spleen. The cumulative radiation dose to the lung at time of death has ranged from 22,000 to 140,000 rads. Serial observations are continuing on the 83 survivors and 15 controls. (U.S.)
idRHa+ProMod - Rail Hardening Control System
International Nuclear Information System (INIS)
Ferro, L
2016-01-01
idRHa+ProMod is the process control system developed by Primetals Technologies to foresee the thermo-mechanical evolution and micro-structural composition of rail steels subjected to slack quenching into idRHa+ Rail Hardening equipments in a simulation environment. This tool can be used both off-line or in-line, giving the user the chance to test and study the best cooling strategies or letting the automatic control system free to adjust the proper cooling recipe. Optimization criteria have been tailored in order to determine the best cooling conditions according to the metallurgical requirements imposed by the main rail standards and also taking into account the elastoplastic bending phenomena occurring during all stages of the head hardening process. The computational core of idRHa+ProMod is a thermal finite element procedure coupled with special algorithms developed to work out the main thermo-physical properties of steel, to predict the non-isothermal austenite decomposition into all the relevant phases and subsequently to evaluate the amount of latent heat of transformation released, the compound thermal expansion coefficient and the amount of plastic deformation in the material. Air mist and air blades boundary conditions have been carefully investigated by means of pilot plant tests aimed to study the jet impingement on rail surfaces and the cooling efficiency at all working conditions. Heat transfer coefficients have been further checked and adjusted directly on field during commissioning. idRHa+ is a trademark of Primetals Technologies Italy Srl (paper)
idRHa+ProMod - Rail Hardening Control System
Ferro, L.
2016-03-01
idRHa+ProMod is the process control system developed by Primetals Technologies to foresee the thermo-mechanical evolution and micro-structural composition of rail steels subjected to slack quenching into idRHa+ Rail Hardening equipments in a simulation environment. This tool can be used both off-line or in-line, giving the user the chance to test and study the best cooling strategies or letting the automatic control system free to adjust the proper cooling recipe. Optimization criteria have been tailored in order to determine the best cooling conditions according to the metallurgical requirements imposed by the main rail standards and also taking into account the elastoplastic bending phenomena occurring during all stages of the head hardening process. The computational core of idRHa+ProMod is a thermal finite element procedure coupled with special algorithms developed to work out the main thermo-physical properties of steel, to predict the non-isothermal austenite decomposition into all the relevant phases and subsequently to evaluate the amount of latent heat of transformation released, the compound thermal expansion coefficient and the amount of plastic deformation in the material. Air mist and air blades boundary conditions have been carefully investigated by means of pilot plant tests aimed to study the jet impingement on rail surfaces and the cooling efficiency at all working conditions. Heat transfer coefficients have been further checked and adjusted directly on field during commissioning. idRHa+ is a trademark of Primetals Technologies Italy Srl
Internal validation of the RapidHIT® ID system.
Wiley, Rachel; Sage, Kelly; LaRue, Bobby; Budowle, Bruce
2017-11-01
Traditionally, forensic DNA analysis has required highly skilled forensic geneticists in a dedicated laboratory to generate short tandem repeat (STR) profiles. STR profiles are routinely used either to associate or exclude potential donors of forensic biological evidence. The typing of forensic reference samples has become more demanding, especially with the requirement in some jurisdictions to DNA profile arrestees. The Rapid DNA (RDNA) platform, the RapidHIT ® ID (IntegenX ® , Pleasanton, CA), is a fully automated system capable of processing reference samples in approximately 90min with minimal human intervention. Thus, the RapidHIT ID instrument can be deployed to non-laboratory environments (e.g., booking stations) and run by trained atypical personnel such as law enforcement. In order to implement the RapidHIT ID platform, validation studies are needed to define the performance and limitations of the system. Internal validation studies were undertaken with four early-production RapidHIT ID units. Reliable and concordant STR profiles were obtained from reference buccal swabs. Throughout the study, no contamination was observed. The overall first-pass success rate with an "expert-like system" was 72%, which is comparable to another current RDNA platform commercially available. The system's second-pass success rate (involving manual interpretation on first-pass inconclusive results) increased to 90%. Inhibitors (i.e., coffee, smoking tobacco, and chewing tobacco) did not appear to affect typing by the instrument system; however, substrate (i.e., swab type) did impact typing success. Additionally, one desirable feature not available with other Rapid systems is that in the event of a system failed run, a swab can be recovered and subsequently re-analyzed in a new sample cartridge. Therefore, rarely should additional sampling or swab consumption be necessary. The RapidHIT ID system is a robust and reliable tool capable of generating complete STR profiles within
Contents of 90Sr, 137Cs and 144Ce in tea
International Nuclear Information System (INIS)
Sha Lianmao; Qiu Yundian; Wang Zhihui; Wang Fenghua
1996-01-01
The determination results of 90 Sr, 137 Cs and 144 Ce contents in 18 kinds of tea goods are reported. The tea samples were pretreated by ashing and analyzed by combined radiochemical procedure. the results showed the average contents of 90 Sr, 137 Cs and 144 Ce in tea goods available in 1985 are 17, 2.2 and 0.8 Bq/kg respectively
Id3 induces an Elk-1–caspase-8-dependent apoptotic pathway in squamous carcinoma cells
International Nuclear Information System (INIS)
Chen, You-Shin; Aubee, Joseph; DiVito, Kyle A; Zhou, Hengbo; Zhang, Weiyi; Chou, Fen-Pi; Simbulan-Rosenthal, Cynthia M; Rosenthal, Dean S
2015-01-01
Inhibitor of differentiation/DNA-binding (Id) proteins are helix–loop–helix (HLH) transcription factors. The Id protein family (Id1–Id4) mediates tissue homeostasis by regulating cellular processes including differentiation, proliferation, and apoptosis. Ids typically function as dominant negative HLH proteins, which bind other HLH proteins and sequester them away from DNA promoter regions. Previously, we have found that Id3 induced apoptosis in immortalized human keratinocytes upon UVB exposure, consistent with its role as a tumor suppressor. To investigate the role of Id3 in malignant squamous cell carcinoma (SCC) cells (A431), a tetracycline-regulated inducible system was used to induce Id3 in cell culture and mouse xenograft models. We found that upon Id3 induction, there was a decrease in cell number under low serum conditions, as well as in soft agar. Microarray, RT-PCR, immunoblot, siRNA, and inhibitor studies revealed that Id3 induced expression of Elk-1, an E-twenty-six (ETS)-domain transcription factor, inducing procaspase-8 expression and activation. Id3 deletion mutants revealed that 80 C-terminal amino acids, including the HLH, are important for Id3-induced apoptosis. In a mouse xenograft model, Id3 induction decreased tumor size by 30%. Using immunofluorescent analysis, we determined that the tumor size decrease was also mediated through apoptosis. Furthermore, we show that Id3 synergizes with 5-FU and cisplatin therapies for nonmelanoma skin cancer cells. Our studies have shown a molecular mechanism by which Id3 induces apoptosis in SCC, and this information can potentially be used to develop new treatments for SCC patients
Sputum and serum microRNA-144 levels in patients with tuberculosis before and after treatment.
Lv, Yan; Guo, Shuai; Li, Xue-Gang; Chi, Jing-Yu; Qu, Yi-Qing; Zhong, Hai-Lai
2016-02-01
To measure the expression levels of sputum and serum microRNA-144 (miR-144) before and after the treatment of patients with tuberculosis (TB). Details of the cases of a total of 124 TB patients were collected at Qilu Hospital of Shandong University between April 2014 and April 2015. Fifty-three of these patients had sputum positive for bacteria and a cavity on imaging (group A), 20 patients had sputum negative for bacteria and a cavity on imaging (group B), and 51 patients had sputum negative for bacteria and no cavity on imaging (group C). One hundred seventeen healthy people who attended the hospital for a physical examination were recruited as controls. Quantitative real-time PCR (qRT-PCR) was used to measure the levels of sputum and serum miR-144 before anti-TB treatment and at 1 month after treatment. Before treatment, sputum and serum miR-144 expression levels in the TB patients were both higher than those of the controls (both p<0.05). After treatment, sputum and serum miR-144 levels in the TB patients were significantly lower than those measured before treatment (both p<0.05). The levels of sputum and serum miR-144 in the improved TB patients decreased significantly after treatment compared to those measured before treatment (both p<0.001). Significant differences were found in sputum and serum miR-144 levels in the TB patients, with or without improvement, compared with the healthy controls (all p<0.05). Sputum and serum miR-144 levels were significantly upregulated in the TB patients, but were found to decrease significantly after anti-TB treatment. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.
40 CFR 144.86 - What are the definitions I need to know?
2010-07-01
... systems that provide water to schools, day care centers, government/military installations, manufacturers... 40 Protection of Environment 22 2010-07-01 2010-07-01 false What are the definitions I need to know? 144.86 Section 144.86 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER...
40 CFR 144.89 - How do I close my Class V injection well?
2010-07-01
... well? 144.89 Section 144.89 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER... cesspool or motor vehicle waste disposal well, you must plug or otherwise close the well in a manner that..., sludge, liquids, or other materials removed from or adjacent to your well in accordance with all...
40 CFR 144.66 - State assumption of responsibility.
2010-07-01
... PROGRAMS (CONTINUED) UNDERGROUND INJECTION CONTROL PROGRAM Financial Responsibility: Class I Hazardous Waste Injection Wells § 144.66 State assumption of responsibility. (a) If a State either assumes legal... 40 Protection of Environment 22 2010-07-01 2010-07-01 false State assumption of responsibility...
Bio-fortification and shelf-life extension of idli batter using curry leaves (Murraya koenigii).
Chelliah, R; Ramakrishnan, S R; Premkumar, D; Antony, U
2016-06-01
Among several traditional foods of India, idli is one of the most popular and commonly consumed steamed products. A new method of adding Murraya koenigii (curry leaves) to idli batter as a vehicle for fortification and extension of shelf-life has been developed. Dried curry leaves powder was incorporated with other ingredients like rice and dehusked black gram in different proportions to optimize the most palatable formulation. Rate of fermentation and microbial changes in the batter; nutritional qualities, texture and sensory properties of the prepared product were assessed. Incorporation of curry leaves powder (5 %) in idli batter increased the shelf-life and also increased the flavour, texture and appearance of the idli. The calcium content of the prepared idli was 10 times more than that of the control idli, while dietary fiber content increased by 18.6 %. Anti-microbial activity of the curry leaves in idli batter extended the shelf-life from 2 to 5 days when stored at 30 °C.
To ID or Not to ID? Changes in Classification Rates of Intellectual Disability Using "DSM-5"
Papazoglou, Aimilia; Jacobson, Lisa A.; McCabe, Marie; Kaufmann, Walter; Zabel, T. Andrew
2014-01-01
The "Diagnostic and Statistical Manual of Mental Disorders-Fifth Edition" ("DSM-5") diagnostic criteria for intellectual disability (ID) include a change to the definition of adaptive impairment. New criteria require impairment in one adaptive domain rather than two or more skill areas. The authors examined the diagnostic…
Tang, Yi-Wei; Lowery, Kristin S; Valsamakis, Alexandra; Schaefer, Virginia C; Chappell, James D; White-Abell, Jill; Quinn, Criziel D; Li, Haijing; Washington, Cicely A; Cromwell, Jenna; Giamanco, Chantel M; Forman, Michael; Holden, Jeffery; Rothman, Richard E; Parker, Michelle L; Ortenberg, Elaine V; Zhang, Lei; Lin, Yea-Lin; Gaydos, Charlotte A
2013-01-01
Respiratory tract infections caused by influenza A and B viruses often present nonspecifically, and a rapid, high-throughput laboratory technique that can identify influenza viruses is clinically and epidemiologically desirable. The PLEX-ID Flu assay (Abbott Molecular Inc., Des Plaines, IL) incorporates multilocus PCR and electrospray ionization-mass spectrometry to detect and differentiate influenza A 2009 H1N1 (H1N1-p), seasonal H1N1 (H1N1-s), influenza A H3N2, and influenza B viruses in nasopharyngeal swab (NPS) specimens. The clinical performance characteristics of the PLEX-ID Flu assay in symptomatic patients were determined in this multicenter trial. A total of 2,617 prospectively and retrospectively collected NPS specimens from patients with influenza-like illness between February 2008 and 28 May 2010 were eligible for inclusion in the study. Each specimen was tested in parallel by the PLEX-ID Flu assay and by the Prodesse ProFLU+ assay (Prodesse Inc., Madison, WI), to detect influenza A and B viruses. Specimens testing positive for influenza A virus by ProFLU+ were subtyped as H1N1-p, H1N1-s, or H3N2 by using the ProFAST+ assay (Gen-Probe Prodesse Inc.). The reproducibility of the PLEX-ID Flu assay ranged from 98.3 to 100.0%, as determined by testing a nine-specimen panel at three clinical sites on each of 5 days. Positive percent agreements (PPAs) and negative percent agreements (NPAs) of the PLEX-ID Flu assay were 94.5% and 99.0% for influenza A virus and 96.0% and 99.9% for influenza B virus, respectively. For the influenza A virus subtyping characterization, the PLEX-ID Flu assay had PPAs and NPAs of 98.3% and 97.5% for H1N1-p, 88.6% and 100.0% for H1N1-s, and 98.0% and 99.9% for H3N2, respectively. The overall agreements between the PLEX-ID and Prodesse ProFLU+/ProFAST+ assays were 97.1 to 100.0%. Bidirectional Sanger sequencing analysis revealed that 87.5% of 96 discrepant results between the PLEX-ID Flu and ProFLU+/ProFAST+ assays were found upon
Energy Technology Data Exchange (ETDEWEB)
Gando, A; Gando, Y; Hayashida, S; Ikeda, H; Inoue, K; Ishidoshiro, K; Ishikawa, H; Koga, M; Matsuda, R; Matsuda, S; Mitsui, T; Motoki, D; Nakamura, K; Oki, Y; Otani, M; Shimizu, I; Shirai, J; Suekane, F; Suzuki, A; Takemoto, Y; Tamae, K; Ueshima, K; Watanabe, H; Xu, BD; Yamada, S; Yamauchi, Y; Yoshida, H; Cribier, M; Durero, M; Fischer, V; Gaffiot, J; Jonqueres, N; Kouchner, A; Lasserre, T; Leterme, D; Letourneau, A; Lhuillier, D; Mention, G; Rampal, G; Scola, L; Veyssiere, C; Vivier, M; Yala, P; Berger, BE; Kozlov, A; Banks, T; Dwyer, D; Fujikawa, BK; Han, K; Kolomensky, YG; Mei, Y; O' Donnell, T; Decowski, P; Markoff, DM; Yoshida, S; Kornoukhov, VN; Gelis, TVM; Tikhomirov, GV; Learned, JG; Maricic, J; Matsuno, S; Milincic, R; Karwowski, HJ; Efremenko, Y; Detwiler, A; Enomoto, S
2017-05-12
The reactor neutrino and gallium anomalies can be tested with a 3-4 PBq (75-100 kCi scale) 144Ce-144Pr antineutrino beta-source deployed at the center or next to a large low-background liquid scintillator detector. The antineutrino generator will be produced by the Russian reprocessing plant PA Mayak as early as 2014, transported to Japan, and deployed in the Kamioka Liquid Scintillator Anti-Neutrino Detector (KamLAND) as early as 2015. KamLAND's 13 m diameter target volume provides a suitable environment to measure the energy and position dependence of the detected neutrino flux. A characteristic oscillation pattern would be visible for a baseline of about 10 m or less, providing a very clean signal of neutrino disappearance into a yet-unknown, sterile neutrino state. This will provide a comprehensive test of the electron dissaperance neutrino anomalies and could lead to the discovery of a 4th neutrino state for Δm$2\\atop{new}$ ≳ 0.1 eV2 and sin2(2θnew) > 0.05.
A Plan to Optimize the Management of Weld ID SSN Numbering System for Nuclear Power Plants in Korea
International Nuclear Information System (INIS)
Yoo, Hyun Ju; Cho, Chan Hee; Kim, Jin Hoi; Park, Dong Min
2016-01-01
Summary Sheet Number(SSN) in the current LTP is an ID which means a weldment in a nuclear power plant. However, the SSN ID, which is unique on in a nuclear power plant, is not unique one if the weldments of entire nuclear power plant in Korea are treated in one system. Therefore, it is hard to manage the data during life time using the existing SSN ID system. It is also hard to configure the characteristics of weldment in mind because IDs implying Alloy600 and overlay weld do not exist in the existing SSN ID System. An optimized SSN numbering system managing weldments for the life time is introduced in this paper. Moreover, it is explained how to manage the SSN numbering system in the computer program system, too. The problem, which the weld is not harmoniously managed, would be solved provided adapting the new SSN ID introduced in this paper. A weld is managed during its life time from creation to extinction. The inquiry of inspection history of a concerned weld and the reference of statistics would be performed easily and rightly because the concerned weld can be accessed from anywhere connected to KHNP network such as KHNP headquater, plants and CRI
International Nuclear Information System (INIS)
Muggenburg, B.A.; Hahn, F.F.; Boecker, B.B.; Mauderly, J.L.; McClellan, R.O.
1977-01-01
The efficacy of lung lavage to remove a relatively insoluble form of 144 Ce from the lung as a means to prevent or alter serious biological effects was evaluated in 21 Beagle dogs. The dogs were divided into five groups. Eight dogs (Group 1) were treated with a series of ten lung lavages between day 2 and day 56 after exposure to 144 Ce. Three dogs (Group 2) were treated with 20 lung lavages from day 2 to day 82 after exposure to 144 Ce. The third group consisted of four dogs and was exposed to 144 Ce but was not treated. Four dogs (Group 4) were given ten lung lavages as in Group 1 but were not exposed to 144 Ce. Two dogs (Group 5) were given 20 lung lavages like the Group 2 dogs but were not exposed to 144 Ce. All but one of the exposed untreated dogs died between 209 to 240 days after inhalation exposure with radiation pneumonitis. The remaining dog died 1072 days after inhalation exposure with a pulmonary carcinoma. All of the treated dogs (Groups 1 and 2) have died except for one dog. Two dogs died with radiation pneumonitis at 170 and 296 days after 144 Ce exposure. The remaining dogs died from 815 to 1773 days after exposure with malignant tumors. The unexposed treated dogs are all alive. Lung lavage appeared to prolong life in the treated dogs and most dogs died with neoplasia rather than with any acute or chronic inflammatory disease
11 CFR 100.144 - Office building for State, local, or district party committees or organizations.
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Office building for State, local, or district party committees or organizations. 100.144 Section 100.144 Federal Elections FEDERAL ELECTION COMMISSION GENERAL SCOPE AND DEFINITIONS (2 U.S.C. 431) Exceptions to Expenditures § 100.144 Office building for...
Energy Technology Data Exchange (ETDEWEB)
Jared Verba; Michael Milvich
2008-05-01
Current Intrusion Detection System (IDS) technology is not suited to be widely deployed inside a Supervisory, Control and Data Acquisition (SCADA) environment. Anomaly- and signature-based IDS technologies have developed methods to cover information technology-based networks activity and protocols effectively. However, these IDS technologies do not include the fine protocol granularity required to ensure network security inside an environment with weak protocols lacking authentication and encryption. By implementing a more specific and more intelligent packet inspection mechanism, tailored traffic flow analysis, and unique packet tampering detection, IDS technology developed specifically for SCADA environments can be deployed with confidence in detecting malicious activity.
49 CFR 572.144 - Thorax assembly and test procedure.
2010-10-01
...-year-Old Child Crash Test Dummy, Alpha Version § 572.144 Thorax assembly and test procedure. (a) Thorax... displacement (compression) relative to the spine, measured with the chest deflection transducer (SA-572-S50...
7 CFR 1260.144 - Nominee's agreement to serve.
2010-01-01
....144 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE BEEF PROMOTION AND RESEARCH Beef Promotion and Research Order Cattlemen's Beef Promotion and Research Board...
Directory of Open Access Journals (Sweden)
Finn Hedefalk
2014-09-01
Full Text Available The Intermediate Data Structure (IDS is a standardised database structure for longitudinal historical databases. Such a common structure facilitates data sharing and comparative research. In this study, we propose an extended version of IDS, named IDS-Geo, that also includes geographic data. The geographic data that will be stored in IDS-Geo are primarily buildings and/or property units, and the purpose of these geographic data is mainly to link individuals to places in space. When we want to assign such detailed spatial locations to individuals (in times before there were any detailed house addresses available, we often have to create tailored geographic datasets. In those cases, there are benefits of storing geographic data in the same structure as the demographic data. Moreover, we propose the export of data from IDS-Geo using an eXtensible Markup Language (XML Schema. IDS-Geo is implemented in a case study using historical property units, for the period 1804 to 1913, stored in a geographically extended version of the Scanian Economic Demographic Database (SEDD. To fit into the IDS-Geo data structure, we included an object lifeline representation of all of the property units (based on the snapshot time representation of single historical maps and poll-tax registers. The case study verifies that the IDS-Geo model is capable of handling geographic data that can be linked to demographic data.
ACE I/D genotype, adiposity, and blood pressure in children
Directory of Open Access Journals (Sweden)
Rothschild Max
2009-03-01
Full Text Available Abstract Background Angiotensin converting enzyme (ACE is a possible candidate gene that may influence both body fatness and blood pressure. Although several genetic studies have been conducted in adults, relatively few studies have examined the contribution of potential candidate genes, and specifically ACE I/D, on adiposity and BP phenotypes in childhood. Such studies may prove insightful for the development of the obesity-hypertension phenotype early in life. The purpose of this study was to examine differences in body fatness and resting blood pressure (BP by ACE I/D genotype, and determine if the association between adiposity and BP varies by ACE I/D genotype in children. Methods 152 children (75 girls, 77 boys were assessed for body composition (% body fat using dual energy x-ray absorbtiometry and resting BP according to American Heart Association recommendations. Buccal cell samples were genotyped using newly developed PCR-RFLP tests for two SNPs (rs4341 and rs4343 in complete linkage disequilibrium with the ACE I/D polymorphism. Partial correlations were computed to assess the ociations between % body fat and BP in the total sample and by genotype. ANCOVA was used to examine differences in resting BP by ACE I/D genotype and fatness groups. Results Approximately 39% of youth were overfat based on % body fat (>30% fat in girls, 25% fat in boys. Body mass, body mass index, and fat-free mass were significantly higher in the ACE D-carriers compared to the II group (p Conclusion ACE D-carriers are heavier than ACE II children; however, BP did not differ by ACE I/D genotype but was adversely influenced in the overfat D-carriers. Further studies are warranted to investigate the genetics of fatness and BP phenotypes in children.
Muon Identification performance: hadron mis-Id measurements and RPC Muon selections
CMS Collaboration
2014-01-01
Pion, kaon, proton mis-identification probabilities as muons have been measured for different Muon ID algorithms. Results from two independent analyses are presented. The performance of a new muon ID algorithm based on matching of inner tracks with hits in muon RPC chambers is also presented.
DEFF Research Database (Denmark)
Johansen, P; Andersen, J D; Børsting, Claus
2013-01-01
on the peak height and the signal to noise data exported from the TYPER 4.0 software. With the forensic analysis parameters, all inconsistencies were eliminated in reactions with ≥10ng DNA. However, the average call rate decreased to 69.9%. The iPLEX(®) Sample ID Plus Panel was tested on 10 degraded samples......Sequenom launched the first commercial SNP typing kit for human identification, named the iPLEX(®) Sample ID Plus Panel. The kit amplifies 47 of the 52 SNPs in the SNPforID panel, amelogenin and two Y-chromosome SNPs in one multiplex PCR. The SNPs were analyzed by single base extension (SBE......) and Matrix Assisted Laser Desorption/Ionization-Time of Flight Mass Spectrometry (MALDI-TOF MS). In this study, we evaluated the accuracy and sensitivity of the iPLEX(®) Sample ID Plus Panel by comparing the typing results of the iPLEX(®) Sample ID Plus Panel with those obtained with our ISO 17025 accredited...
78 FR 65555 - Establishment of Class E Airspace; Salmon, ID
2013-11-01
...-0531; Airspace Docket No. 13-ANM-20] Establishment of Class E Airspace; Salmon, ID AGENCY: Federal... at the Salmon VHF Omni-Directional Radio Range/Distance Measuring Equipment (VOR/DME) navigation aid, Salmon, ID, to facilitate vectoring of Instrument Flight Rules (IFR) aircraft under control of Salt Lake...
Directory of Open Access Journals (Sweden)
Squires KE
2017-03-01
Full Text Available Kathleen E Squires,1 Benjamin Young,2,3 Lizette Santiago,4 Robin H Dretler,5 Sharon L Walmsley,6 Henry H Zhao,7 Gary E Pakes,8 Lisa L Ross,8 Mark S Shaefer8 On behalf of the ARIES Study Team 1Thomas Jefferson University, Philadelphia, PA, 2Apex Family Medicine and Research, Denver, CO, 3International Association of Physicians in AIDS Care, Washington DC, USA; 4HOPE Clinic and Wellness Center, San Juan, Puerto Rico; 5ID Specialists of Atlanta, Decatur, GA, USA; 6University Health Network, Toronto, ON, Canada; 7GlaxoSmithKline, 8ViiV Healthcare, Research Triangle Park, NC, USA Purpose: The 144-week results of the open-label, multicenter Atazanavir/Ritonavir Induction with Epzicom Study (ARIES were stratified by gender to compare treatment responses.Methods: A total of 369 HIV-infected, antiretroviral-naïve subjects receiving once-daily abacavir/lamivudine + atazanavir/ritonavir (ATV/r whose HIV-1 RNA was <50 copies/mL by week 30 were randomized 1:1 at week 36 to maintain or discontinue ritonavir for 108 subsequent weeks. Between- and within-treatment gender-related efficacy and safety differences were analyzed.Results: Subjects were 85% male; 64% white; and had a mean age of 39 years, baseline median HIV-1 RNA of 114,815 copies/mL, and median CD4+ cell count of 198 cells/mm3. Gender (ATV [n=189]: 29 females/160 males; ATV/r [n=180]: 25 females/155 males and most other demographics were similar between groups; more females than males were black (65% vs 25% and fewer females had baseline HIV-1 RNA ≥100,000 copies/mL (41% vs 58%. At week 144, no significant differences between genders were observed in proportion maintaining HIV-1 RNA <50 copies/mL (ATV, 79% vs 77%; ATV/r, 60% vs 75% or <400 copies/mL (ATV, 83% vs 84%; ATV/r, 68% vs 82% (intent-to-treat-exposed: time to loss of virologic response analysis; median CD4+ change from baseline (ATV, +365 vs +300 cells/mm3; ATV/r, +344 vs +301 cells/mm3; proportion with treatment-related grade 2–4
OpenID connect as a security service in Cloud-based diagnostic imaging systems
Ma, Weina; Sartipi, Kamran; Sharghi, Hassan; Koff, David; Bak, Peter
2015-03-01
The evolution of cloud computing is driving the next generation of diagnostic imaging (DI) systems. Cloud-based DI systems are able to deliver better services to patients without constraining to their own physical facilities. However, privacy and security concerns have been consistently regarded as the major obstacle for adoption of cloud computing by healthcare domains. Furthermore, traditional computing models and interfaces employed by DI systems are not ready for accessing diagnostic images through mobile devices. RESTful is an ideal technology for provisioning both mobile services and cloud computing. OpenID Connect, combining OpenID and OAuth together, is an emerging REST-based federated identity solution. It is one of the most perspective open standards to potentially become the de-facto standard for securing cloud computing and mobile applications, which has ever been regarded as "Kerberos of Cloud". We introduce OpenID Connect as an identity and authentication service in cloud-based DI systems and propose enhancements that allow for incorporating this technology within distributed enterprise environment. The objective of this study is to offer solutions for secure radiology image sharing among DI-r (Diagnostic Imaging Repository) and heterogeneous PACS (Picture Archiving and Communication Systems) as well as mobile clients in the cloud ecosystem. Through using OpenID Connect as an open-source identity and authentication service, deploying DI-r and PACS to private or community clouds should obtain equivalent security level to traditional computing model.
Lung lavage therapy to lessen the biological effects of inhaled 144Ce in dogs
International Nuclear Information System (INIS)
Muggenburg, B.A.; Boecker, B.B.; Hahn, F.F.; McClellan, R.O.
1990-01-01
To evaluate the therapeutic effects of removal of an internally deposited radionuclide on long-term biological effects, lung lavage was used to treat dogs that had inhaled 144Ce in a relatively insoluble form, in fused aluminosilicate particles. Either 10 lung lavages were performed between Days 2 and 56 after exposure or 20 lung lavages were performed between Days 2 and 84 after exposure. Approximately one-half of the 144Ce was removed by the lavages, resulting in a corresponding reduction in the total absorbed beta dose to lung. The mean survival time of the treated dogs was 1270 days compared to 370 days for untreated dogs whose initial pulmonary burdens of 144Ce were similar. Treated dogs died late from cancers of the lung or liver, whereas the untreated dogs died at much earlier times from radiation pneumonitis. Dogs treated with lung lavage but not exposed to 144Ce had a mean survival of 4770 days. We concluded that removal of 144Ce from the lung by lavage resulted in increased survival time and in a change in the biological effects from inhaled 144Ce from early-occurring inflammatory disease to late-occurring effects, principally cancer. In addition, the biological effects occurring in the treated dogs could be better predicted from the total absorbed beta dose in the lung and the dose rate after treatment rather than from the original dose rate to the lung. Therefore, we concluded that prompt treatment to remove radioactive materials could be of significant benefit to persons accidentally exposed to high levels of airborne, relatively insoluble, radioactive particles
MiR-144 Increases Intestinal Permeability in IBS-D Rats by Targeting OCLN and ZO1
Directory of Open Access Journals (Sweden)
Qiuke Hou
2017-12-01
Full Text Available Background/Aims: Irritable bowel syndrome with diarrhoea (IBS-D is a chronic, functional bowel disorder characterized by abdominal pain or diarrhoea and altered bowel habits, which correlate with intestinal hyperpermeability. MicroRNAs (miRNAs are involved in regulating intestinal permeability in IBS-D. However, the role of miRNAs in regulating intestinal permeability and protecting the epithelial barrier remains unclear. Our goals were to (i identify differential expression of miRNAs and their targets in the distal colon of IBS-D rats; (ii verify in vitro whether occludin (OCLN and zonula occludens 1 (ZO1/TJP1 were direct targets of miR-144 and were down-regulated in IBS-D rats; and (iii determine whether down-regulation of miR-144 in vitro could reverse the pathological hallmarks of intestinal hyperpermeability via targeting OCLN and ZO1. Methods: The IBS-D rat model was established using 4% acetic acid and evaluated by haematoxylin-eosin (HE staining. The distal colon was obtained in order to perform miRNA microarray analysis and to isolate and culture colonic epithelial cells. When differential expression of miRNA was found, the results were verified by qRT-PCR, and the target genes were further explored by bioinformatics analysis. Correlation analyses were carried out to compare the expression of miRNA and target genes. Then, mutants, miRNA mimics and inhibitors of the target genes were constructed and transfected to colonic epithelial cells. qRT-PCR, western blotting, enzyme-linked immunosorbent assays (ELISAs and dual-luciferase assays were used to investigate the expression of miR-144 and OCLN, ZO1 in IBS-D rats. Results: There were 8 up-regulated and 18 down-regulated miRNAs identified in the IBS-D rat model. Of these, miR-144 was markedly up-regulated and resulted in the down-regulation of OCLN and ZO1 expression. Overexpression of miR-144 by transfection of miR-144 precursor markedly inhibited the expression of OCLN and ZO1. Further
Directory of Open Access Journals (Sweden)
Cǎtǎlin NAE
2010-03-01
Full Text Available This paper is dedicated to a very specific type of analysis tool (VLM - Vortex Lattice Method to be integrated in a IDS - Integrated Design System, tailored for the usage of small aircraft industry. The major interest is to have the possibility to simulate at very low computational costs a preliminary set of aerodynamic characteristics for basic aerodynamic global characteristics (Lift, Drag, Pitching Moment and aerodynamic derivatives for longitudinal and lateral-directional stability analysis. This work enables fast investigations of the influence of configuration changes in a very efficient computational environment. Using experimental data and/or CFD information for a specific calibration of VLM method, reliability of the analysis may me increased so that a first type (iteration zero aerodynamic evaluation of the preliminary 3D configuration is possible. The output of this tool is basic state aerodynamic and associated stability and control derivatives, as well as a complete set of information on specific loads on major airframe components.The major interest in using and validating this type of methods is coming from the possibility to integrate it as a tool in an IDS system for conceptual design phase, as considered for development for CESAR project (IP, UE FP6.
Efficient coding and detection of ultra-long IDs for visible light positioning systems.
Zhang, Hualong; Yang, Chuanchuan
2018-05-14
Visible light positioning (VLP) is a promising technique to complement Global Navigation Satellite System (GNSS) such as Global positioning system (GPS) and BeiDou Navigation Satellite System (BDS) which features the advantage of low-cost and high accuracy. The situation becomes even more crucial for indoor environments, where satellite signals are weak or even unavailable. For large-scale application of VLP, there would be a considerable number of Light emitting diode (LED) IDs, which bring forward the demand of long LED ID detection. In particular, to provision indoor localization globally, a convenient way is to program a unique ID into each LED during manufacture. This poses a big challenge for image sensors, such as the CMOS camera in everybody's hands since the long ID covers the span of multiple frames. In this paper, we investigate the detection of ultra-long ID using rolling shutter cameras. By analyzing the pattern of data loss in each frame, we proposed a novel coding technique to improve the efficiency of LED ID detection. We studied the performance of Reed-Solomon (RS) code in this system and designed a new coding method which considered the trade-off between performance and decoding complexity. Coding technique decreases the number of frames needed in data processing, significantly reduces the detection time, and improves the accuracy of detection. Numerical and experimental results show that the detected LED ID can be much longer with the coding technique. Besides, our proposed coding method is proved to achieve a performance close to that of RS code while the decoding complexity is much lower.
ACE insertion/deletion (I/D) polymorphism and diabetic nephropathy.
Rahimi, Zohreh
2012-10-01
Angiotensin converting enzyme (ACE) gene encodes ACE, a key component of renin angiotensin system (RAS), plays an important role in blood pressure homeostasis by generating the vasoconstrictor peptide angiotensin II. Directory of Open Access Journals (DOAJ), Google Scholar, Pubmed (NLM), LISTA (EBSCO) and Web of Science have been searched. The presence of ACE insertion/deletion (I/D) polymorphism affects the plasma level of ACE. ACE DD genotype is associated with the highest systemic and renal ACE levels compared with the lowest ACE activity in carriers of II genotype. In this review focus has been performed on the study of ACE I/D polymorphism in various populations and its influence on the risk of onset and progression of diabetic nephropathy. Also, association between ACE I/D polymorphism and response to ACE inhibitor and angiotensin II receptor antagonists will be reviewed. Further, synergistic effect of this polymorphism and variants of some genes on the risk of development of diabetic nephropathy will be discussed.
ID.alistic: identificatie met een touch voor de patiënt
M. Wilschut; M. Zijlmans; Dr. L.S.G.L Wauben
2017-01-01
ID.alistic is een conceptuele patiëntidentificatie methode (middels een vingerafdrukscanner), ter vervanging van het polsbandjessysteem van het Albert Schweitzer ziekenhuis (ASz) dialysecentrum. Dit onderzoek bepaalt de implementeerbaarheid van ID.alistic binnen het dialysecentrum door
International Nuclear Information System (INIS)
Maw, Min Khine; Fujimoto, Jiro; Tamaya, Teruhiko
2009-01-01
The inhibitor of DNA-binding (ID) has been involved in cell cycle regulation, apoptosis and angiogenesis. This prompted us to study ID functions in tumor advancement of ovarian cancers. Sixty patients underwent surgery for ovarian cancers. In ovarian cancers, the levels of ID-1, ID-2 and ID-3 mRNAs were determined by real-time reverse transcription-polymerase chain reaction. The histoscore with the localization of ID-1 was determined by immunohistochemistry. Patient prognosis was analyzed with a 36-month survival rate. Microvessel counts were determined by immunohistochemistry for CD34 and factor VIII-related antigen. ID-1 histoscores and mRNA levels both significantly (p < 0.001) increased in ovarian cancers according to clinical stage, regardless of histopathological type. Furthermore, 30 patients with high ID-1 expression had a lower survival rate (53%) compared to patients with low ID-1 expression (80%). ID-1 histoscores and mRNA levels significantly (p < 0.0001) correlated with microvessel counts in ovarian cancers. ID-1 increased in ovarian cancer cells during tumor progression. Moreover, ID-1 expression levels correlated with microvessel counts. Therefore, ID-1 might work on tumor advancement via angiogenesis and is considered to be a candidate for a prognostic indicator in ovarian cancers
Toward operation of series IDs at BL43LXU of SPring-8
Energy Technology Data Exchange (ETDEWEB)
Baron, A. Q. R.; Tanaka, T.; Soutome, K.; Takao, M.; Nakamura, T.; Kobayashi, K.; Fujita, T.; Takahashi, S.; Aoyagi, H.; Shimosaki, Y.; Seike, T.; Uchiyama, H.; Ishikawa, D.; Chuang, T.-H.; Kimura, H.; Tanaka, H.; Kitamura, H.; Ishikawa, T. [SPring-8, 1-1-1 Kouto, Sayo, Hyogo, 679 (Japan)
2016-07-27
This paper discusses two issues relating to using 3 small gap insertion devices in series at BL43LXU of SPring-8 to make a uniquely powerful source in the 15-26 keV region of the x-ray spectrum. The issues discussed are (1) damage to the covers of the downstream IDs by radiation from the upstream IDs and (2) proper steering of the electron beam to get the best photon beam properties. After tests in several configurations, including one where an ID was run without an impedance-reducing cover, the damage issue was solved by installing a distributed absorber in the most downstream ID. The steering issues were mostly resolved by the introduction of appropriate corrector magnets and feedback. The paper is written from the viewpoint of an interested beamline scientist impressed with the cooperation of different groups to make a source for new science possible.
Mapping of Id locus for dermal shank melanin in a Chinese ...
Indian Academy of Sciences (India)
JIGUO XU
2017-12-08
Dec 8, 2017 ... Information on the SNPs used for the association analysis. ID. Position (galGal3) .... using Bio-Rad Manager software, and the data were nor- malized to the ..... This work was supported by the High Technology Research.
International Nuclear Information System (INIS)
Li, Butian; Zhang, Shengping; Shen, Hao; Li, Chenglong
2017-01-01
MicroRNAs are aberrantly expressed in a wide variety of human cancers. The present study aims to elucidate the effects and molecular mechanisms of miR-144-3p that underlie gastric cancer (GC) development. It was observed that miR-144-3p expression was significantly decreased in GC tissues compared to that in paired non-tumor tissues; moreover, its expression was lower in tissues of advanced stage and larger tumor size, as well as in lymph node metastasis tissues compared to that in control groups. miR-144-3p expression was associated with depth of invasion (P = 0.030), tumor size (P = 0.047), lymph node metastasis (P = 0.047), and TNM stage (P = 0.048). Additionally, miR-144-3p significantly inhibited proliferation, migration, and invasion in GC cells. It also reduced F-actin expression and suppressed epithelial-to-mesenchymal transition (EMT) in GC cells. Furthermore, pre-leukemia transcription factor 3 (PBX3) was a direct target gene of miR-144-3p. PBX3 was overexpressed in GC tissues and promoted EMT in GC cells. The effects of miR-144-3p mimics or inhibitors on cell migration, invasion, and proliferation were reversed by PBX3 overexpression or downregulation respectively. These results suggest that miR-144-3p suppresses GC progression by inhibiting EMT through targeting PBX3. - Highlights: • miR-144-3p is downregulated in gastric cancer tissues and associated with malignant clinical factors. • miR-144-3p inhibits proliferation, migration, and invasion in gastric cancer cells. • PBX3 is a direct target of miR-144-3p and promotes EMT in gastric cancer. • miR-144-3p suppresses EMT in gastric cancer by regulating PBX3.
New long-wavelength Nd:YAG laser at 1.44 micron: effect on brain.
Martiniuk, R; Bauer, J A; McKean, J D; Tulip, J; Mielke, B W
1989-02-01
A wavelength-shifted Nd:YAG laser, tuned to coincide with the infrared absorption peak of water at 1.44 microns, was used to make lesions in normal rabbit brain. A total of 48 lesions were made with power up to 20 W, with energy up to 40 joules, and with two different spot sizes. These lesions were compared to lesions made with 1.06 microns radiation from an Nd:YAG laser under identical operating conditions. Measurements of blood-brain barrier damage and width, depth, and volume of tissue affected were obtained 30 minutes after placement of the lesions. It was found that 1.44-microns lesions produced photoevaporative tissue loss at the highest intensities used. The layer of coagulated tissue remaining after photovaporization had a mean thickness of 0.6 mm irrespective of the volume of tissue removed. There was no photovaporization in the 1.06-microns lesions. In addition, the amount of peripheral edema per unit volume of tissue coagulated was approximately half at the 1.44-microns wavelength. These findings suggest that the 1.44-microns Nd:YAG laser may be a useful surgical instrument since it combines the photoevaporative effect of the CO2 laser while maintaining the advantages of the conventional Nd:YAG laser (quartz fiber delivery and effective hemostasis).
Vibrational measurements in 3-ID-B
International Nuclear Information System (INIS)
Sutter, J.; Alp, E.; Barraza, J.; Shu, D.
1998-04-01
The authors have undertaken a series of vibrational measurements in hutch 3-ID-B. Their motivation was to compare two different methods of mounting an interferometer for effectiveness in vibrational isolation and stability. In addition they were able to compare the stability of the optical table with and without its eight large bolts inserted
FDIC Institution Directory (ID) -- Insured Insitution Download File
Federal Deposit Insurance Corporation — The FDIC's Institution Directory (ID) download file provides a list of all FDIC-insured institutions. The file includes demographic information related to the...
2013-02-06
... Services Group, Inc., Commercial/Actuarial/ Information Delivery Services (IDS)/Corporate & Financial... workers and former workers of Hartford Financial Services Group, Inc., Commercial/Actuarial/Information Delivery Services (IDS)/Corporate & Financial Reporting group, Hartford, Connecticut (The Hartford-IDS...
Wicked ID: Conceptual Framework for Considering Instructional Design as a Wicked Problem
Directory of Open Access Journals (Sweden)
Katrin Becker
2007-02-01
Full Text Available The process of instructional design has parallels in other design disciplines. Software design is one that has experienced intense attention in the last 30 or so years, and many lessons learned there can be applied to ID. Using software design as a springboard, this concept paper seeks to propose a new approach to ID. It suggests that instructional design is almost always a Wicked Problem. The connection is formed between Wicked Problems as first described by Rittel and Webber in 1973, and the models in and processes of instructional design. The areas of social planning, organizational management and software design all posses some accepted and tested approaches to the solution of Wicked Problems. These will be described, and how they can be applied to ID will be explained. Finally, this paper will propose a meta-model for ID and explain how it can be used in the current context. Résumé : Le processus de conception pédagogique a des similitudes avec d’autres disciplines. La conception de logiciels a fait l’objet d’une grande attention dans les trente dernières années et de nombreuses leçons tirées peuvent s’appliquer à la conception pédagogique. En se basant sur la conception de logiciels, cet article cherche à proposer une nouvelle méthode à la conception pédagogique. Il laisse entendre que la conception pédagogique constitue presque toujours un problème épineux. Le lien est formé entre les problèmes épineux tels que décrits par Rittel et Webber en 1973 et les modèles et processus de la conception pédagogique. Les secteurs de l’organisation sociale, de la gestion des organisations et de la conception de logiciels comptent des méthodes acceptées et validées à la résolution de problèmes épineux. Nous les décrirons et expliquerons comment ils peuvent servir à la conception pédagogique. Enfin, l’article proposera un meta-modèle de la conception pédagogique et expliquera comment il peut servir dans le
International Nuclear Information System (INIS)
Zhang, Long; Shi, Songting; Zhang, Juan; Zhou, Fangfang; Dijke, Peter ten
2012-01-01
Highlights: ► Expression of Id3 but not Id1 is induced by Wnt3a stimulation in C2C12 cells. ► Wnt3a induces Id3 expression via canonical Wnt/β-catenin pathway. ► Wnt3a-induced Id3 expression does not depend on BMP signaling activation. ► Induction of Id3 expression is critical determinant in Wnt3a-induced cell proliferation and differentiation. -- Abstract: Canonical Wnt signaling plays important roles in regulating cell proliferation and differentiation. In this study, we report that inhibitor of differentiation (Id)3 is a Wnt-inducible gene in mouse C2C12 myoblasts. Wnt3a induced Id3 expression in a β-catenin-dependent manner. Bone morphogenetic protein (BMP) also potently induced Id3 expression. However, Wnt-induced Id3 expression occurred independent of the BMP/Smad pathway. Functional studies showed that Id3 depletion in C2C12 cells impaired Wnt3a-induced cell proliferation and alkaline phosphatase activity, an early marker of osteoblast cells. Id3 depletion elevated myogenin induction during myogenic differentiation and partially impaired Wnt3a suppressed myogenin expression in C2C12 cells. These results suggest that Id3 is an important Wnt/β-catenin induced gene in myoblast cell fate determination.
ID'ing innate and innate-like lymphoid cells.
Verykokakis, Mihalis; Zook, Erin C; Kee, Barbara L
2014-09-01
The immune system can be divided into innate and adaptive components that differ in their rate and mode of cellular activation, with innate immune cells being the first responders to invading pathogens. Recent advances in the identification and characterization of innate lymphoid cells have revealed reiterative developmental programs that result in cells with effector fates that parallel those of adaptive lymphoid cells and are tailored to effectively eliminate a broad spectrum of pathogenic challenges. However, activation of these cells can also be associated with pathologies such as autoimmune disease. One major distinction between innate and adaptive immune system cells is the constitutive expression of ID proteins in the former and inducible expression in the latter. ID proteins function as antagonists of the E protein transcription factors that play critical roles in lymphoid specification as well as B- and T-lymphocyte development. In this review, we examine the transcriptional mechanisms controlling the development of innate lymphocytes, including natural killer cells and the recently identified innate lymphoid cells (ILC1, ILC2, and ILC3), and innate-like lymphocytes, including natural killer T cells, with an emphasis on the known requirements for the ID proteins. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
40 CFR 144.51 - Conditions applicable to all permits.
2010-07-01
... PROGRAMS (CONTINUED) UNDERGROUND INJECTION CONTROL PROGRAM Permit Conditions § 144.51 Conditions applicable... permit. Any permit noncompliance constitutes a violation of the Safe Drinking Water Act and is grounds... denial of a permit renewal application; except that the permittee need not comply with the provisions of...
Toxicity of 144Ce fused clay particles inhaled by immature beagle dogs. III
International Nuclear Information System (INIS)
Boecker, B.B.; McClellan, R.O.; Hahn, F.F.; Hobbs, C.H.; Mauderly, J.L.
1974-01-01
The metabolism, dosimetry, and biological effects of 144 Ce fused clay particles inhaled by immature Beagle dogs (approximately 3 months of age at exposure) are being investigated for comparison with studies of dogs exposed at 12 to 14 months of age and 8 to 10.5 years of age. These studies will assess possible age-related differences in the biological behavior and effects of inhaled radionuclides, differences that may be of significance in predicting the response of accidentally-exposed human populations that include individuals of different ages. Eighteen immature dogs have been entered into a radiation dose pattern study to be serially sacrificed at different intervals after inhalation exposure. During the first 2 months post-exposure, lung clearance and uptake by the tracheobronchial lymph nodes appeared to be greater in the immature dogs than in young adult dogs. Also, skeletal uptake was greater than hepatic uptake in the immature dogs. Three blocks of longevity animals, 10 per block, with graded initial lung burdens ranging from 0.004 to 120 μCi 144 Ce/kg body weight and 1 control, are currently on experiment. Three dogs with initial lung burdens of 73 to 120 μCi 144 Ce/kg body weight died at 66 to 121 days after exposure with pulmonary injury and congestive heart failure. Another dog with an initial lung burden of 70 μCi 144 Ce/kg body weight died at 511 days after exposure with pulmonary injury. Serial observations are continuing on the surviving 26 144 Ce-exposed and 3 control dogs. (U.S.)
Identity Management ToolKit (IdM TK)
Department of Veterans Affairs — With the IdM TK, authorized users can search and view identity and exception information from the Administrative Data Repository (ADR). Specifically, users can view...
Determination of local chromatin composition by CasID.
Schmidtmann, Elisabeth; Anton, Tobias; Rombaut, Pascaline; Herzog, Franz; Leonhardt, Heinrich
2016-09-02
Chromatin structure and function are determined by a plethora of proteins whose genome-wide distribution is typically assessed by immunoprecipitation (ChIP). Here, we developed a novel tool to investigate the local chromatin environment at specific DNA sequences. We combined the programmable DNA binding of dCas9 with the promiscuous biotin ligase BirA* (CasID) to biotinylate proteins in the direct vicinity of specific loci. Subsequent streptavidin-mediated precipitation and mass spectrometry identified both known and previously unknown chromatin factors associated with repetitive telomeric, major satellite and minor satellite DNA. With super-resolution microscopy, we confirmed the localization of the putative transcription factor ZNF512 at chromocenters. The versatility of CasID facilitates the systematic elucidation of functional protein complexes and locus-specific chromatin composition.
Overestimation of the 25(OH)D serum concentration with the automated IDS EIA kit.
Cavalier, Etienne; Huberty, Véronique; Cormier, Catherine; Souberbielle, Jean-Claude
2011-02-01
We have recently observed an increasing number of patients presenting very high serum levels of 25-hydroxyvitamin D [25(OH)D] (> 150 ng/mL), which, in all cases, had been measured with the IDS EIA kit adapted on different "open" automated platforms. We performed a comparison between the IDS EIA kit adapted on two different "open"automated platforms and the DiaSorin RIA. We found a systematic bias (higher levels with the IDS EIA kit) for concentrations more than 50-60 ng/mL that was less obvious when the IDS EIA was used in its manual procedure. We thus suggest to use the IDS EIA kit in its manual procedure rather than to adapt it on an automated platform, and to interpret cautiously a 25(OH)D greater than 100 ng/mL with this kit. Copyright © 2011 American Society for Bone and Mineral Research.
Young, Vicky J; Ahmad, Syed F; Brown, Jeremy K; Duncan, W Colin; Horne, Andrew W
2015-11-18
VEGF-A, an angiogenic factor, is increased in the peritoneal fluid of women with endometriosis. The cytokine TGF-β1 is thought to play a role in the establishment of endometriosis lesions. Inhibitor of DNA binding (ID) proteins are transcriptional targets of TGF-β1 and ID1 has been implicated in VEGF-A regulation during tumor angiogenesis. Herein, we determined whether peritoneal expression of VEGF-A is regulated by TGF-β1 through the ID1 pathway in women with endometriosis. VEGF-A was measured in peritoneal fluid by ELISA (n = 16). VEGF-A and ID1 expression was examined in peritoneal biopsies (n = 13), and primary peritoneal and immortalized mesothelial cells (MeT5A) by immunohistochemistry, qRT-PCR and ELISA. VEGF-A was increased in peritoneal fluid from women with endometriosis and levels correlated with TGF-β1 concentrations (P peritoneal mesothelium and TGF-β1 increased VEGFA mRNA (P endometriosis and TGF-β1 increased concentrations of ID1 mRNA (P endometriosis, as an effector of TGFβ1 dependent upregulation of VEGF-A, and highlights a novel potential therapeutic target.
A estabilização heterodoxa no brasil: idéias e redes políticas
Directory of Open Access Journals (Sweden)
Pio Carlos
2001-01-01
Full Text Available O artigo discute o papel das idéias e das "redes políticas" na explicação do conteúdo de políticas de estabilização no Brasil. As idéias heterodoxas dos economistas da Pontifícia Universidade Católica do Rio de Janeiro (PUC-RJ são apresentadas e comparadas ao conteúdo de dois programas de estabilização implementados no país: o Plano Cruzado (1986 e o Plano Real (desde 1993. Variáveis políticas são apontadas para explicar por que o segundo programa apresenta maior semelhança com as idéias originais dos economistas do que o primeiro, o que, segundo o autor, explica, em grande medida, seu maior êxito em reduzir a inflação.
Security and Privacy Improvements for the Belgian eID Technology
Verhaeghe, Pieter; Lapon, Jorn; de Decker, Bart; Naessens, Vincent; Verslype, Kristof
The Belgian Electronic Identity Card enables Belgian citizens to prove their identity digitally and to sign electronic documents. At the end of 2009, every Belgian citizen older than 12 years will have such an eID card. In the future, usage of the eID card may be mandatory. However, irresponsible use of the card may cause harm to individuals.
78 FR 25406 - Proposed Modification of Class E Airspace; Twin Falls, ID
2013-05-01
...) Global Positioning System (GPS) and the Instrument Landing System (ILS) or Localizer (LOC) standard... the earth. * * * * * ANM ID E5 Twin Falls, ID [Modified] Twin Falls Joslin Field-Magic Valley Regional...
21 CFR 133.144 - Granular and stirred curd cheese.
2010-04-01
... 133.144 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... this section or by any other procedure which produces a finished cheese having the same physical and... hydrogen peroxide/catalase, and is subjected to the action of a lactic acid-producing bacterial culture...
78 FR 45478 - Proposed Establishment of Class E Airspace; Salmon, ID
2013-07-29
...-0531; Airspace Docket No. 13-ANM-20] Proposed Establishment of Class E Airspace; Salmon, ID AGENCY... action proposes to establish Class E airspace at the Salmon VHF Omni-Directional Radio Range/Distance Measuring Equipment (VOR/DME) navigation aid, Salmon, ID, to facilitate vectoring of Instrument Flight Rules...
International Nuclear Information System (INIS)
Kurooka, Hisanori; Sugai, Manabu; Mori, Kentaro; Yokota, Yoshifumi
2013-01-01
Highlights: •Sodium arsenite induces cytoplasmic accumulation of Id3. •Arsenite binds to closely spaced N-terminal cysteine residues of Id3. •N-terminal cysteines are essential for arsenite-induced nuclear export of Id3. •Nuclear export of Id3 counteracts its transcriptional repression activity. -- Abstract: Ids are versatile transcriptional repressors that regulate cell proliferation and differentiation, and appropriate subcellular localization of the Id proteins is important for their functions. We previously identified distinct functional nuclear export signals (NESs) in Id1 and Id2, but no active NES has been reported in Id3. In this study, we found that treatment with the stress-inducing metalloid arsenite led to the accumulation of GFP-tagged Id3 in the cytoplasm. Cytoplasmic accumulation was impaired by a mutation in the Id3 NES-like sequence resembling the Id1 NES, located at the end of the HLH domain. It was also blocked by co-treatment with the CRM1-specific nuclear export inhibitor leptomycin B (LMB), but not with the inhibitors for mitogen-activated protein kinases (MAPKs). Importantly, we showed that the closely spaced N-terminal cysteine residues of Id3 interacted with the arsenic derivative phenylarsine oxide (PAO) and were essential for the arsenite-induced cytoplasmic accumulation, suggesting that arsenite induces the CRM1-dependent nuclear export of Id3 via binding to the N-terminal cysteines. Finally, we demonstrated that Id3 significantly repressed arsenite-stimulated transcription of the immediate-early gene Egr-1 and that this repression activity was inversely correlated with the arsenite-induced nuclear export. Our results imply that Id3 may be involved in the biological action of arsenite
37 CFR 1.144 - Petition from requirement for restriction.
2010-07-01
... Inventions in One Application; Restriction § 1.144 Petition from requirement for restriction. After a final..., may petition the Director to review the requirement. Petition may be deferred until after final action on or allowance of claims to the invention elected, but must be filed not later than appeal. A...
DNA origami-based shape IDs for single-molecule nanomechanical genotyping
Zhang, Honglu; Chao, Jie; Pan, Dun; Liu, Huajie; Qiang, Yu; Liu, Ke; Cui, Chengjun; Chen, Jianhua; Huang, Qing; Hu, Jun; Wang, Lianhui; Huang, Wei; Shi, Yongyong; Fan, Chunhai
2017-04-01
Variations on DNA sequences profoundly affect how we develop diseases and respond to pathogens and drugs. Atomic force microscopy (AFM) provides a nanomechanical imaging approach for genetic analysis with nanometre resolution. However, unlike fluorescence imaging that has wavelength-specific fluorophores, the lack of shape-specific labels largely hampers widespread applications of AFM imaging. Here we report the development of a set of differentially shaped, highly hybridizable self-assembled DNA origami nanostructures serving as shape IDs for magnified nanomechanical imaging of single-nucleotide polymorphisms. Using these origami shape IDs, we directly genotype single molecules of human genomic DNA with an ultrahigh resolution of ~10 nm and the multiplexing ability. Further, we determine three types of disease-associated, long-range haplotypes in samples from the Han Chinese population. Single-molecule analysis allows robust haplotyping even for samples with low labelling efficiency. We expect this generic shape ID-based nanomechanical approach to hold great potential in genetic analysis at the single-molecule level.
Independence Day 2004 (ID04) / Raul Hindov
Hindov, Raul
2004-01-01
Ülevaade 20.-22. veebruarini 2004 toimunud kaugluurepatrullide rännaku ja sõdurioskuste kompleksõppusest ID04 (Independence Day 2004 - Iseseisvuspäev 2004), millel osales 25 patrullvõistlusteks valmistuvat meest ja naist
On the validity of Ksub(Id)-measurements in instrumented impact tests
International Nuclear Information System (INIS)
Kalthoff, J.F.; Winkler, S.; Klemm, W.; Beinert, J.
1979-01-01
The influence of inertia effects in determining the dynamic fracture toughness Ksub(Id) by instrumented impact testing is investigated. Model experiments in the brittle fracture regime are carried out with precracked bend specimens machined from the epoxy resin Araldite B. As is usual in these tests, the loads at the tup of the impinging striker are recorded as a function of time during the impact process. For reference purposes, the dynamic fracture toughness value Ksub(Id)sup(m1) is derived from the measured maximum load utilizing static stress intensity factor formulas. In addition to this conventional procedure, the actual stress intensity factors are measured directly at the tip of the crack by means of the shadow optical method of caustics applied in combination with high speed photography. The critical value of these optically measured stress intensity factors (for onset of crack propagation), Ksub(Id)sup(opt), is the true dynamic fracture toughness. In the experiments, the specimen size and the impact velocity were varied. In accordance with expectations, it is found that the hammer load signal is not correlated with the actual crack tip stress intensity factor values by a simple proportionality. The conventionally determined Ksub(Id)sup(m1)-value overestimates the true dynamic fracture toughness Ksub(Id)sup(opt). This overestimation becomes larger for larger specimen sizes and larger impact velocities. The results demonstrate the dominating influence inertia effects can have on hammer load measurements and emphasize the importance of eliminating these effects in order to determine non-erroneous dynamic fracture toughness values. (orig.)
Identification of an active ID-like group of SINEs in the mouse.
Kass, David H; Jamison, Nicole
2007-09-01
The mouse genome consists of five known families of SINEs: B1, B2, B4/RSINE, ID, and MIR. Using RT-PCR we identified a germ-line transcript that demonstrates 92.7% sequence identity to ID (excluding primer sequence), yet a BLAST search identified numerous matches of 100% sequence identity. We analyzed four of these elements for their presence in orthologous genes in strains and subspecies of Mus musculus as well as other species of Mus using a PCR-based assay. All four analyzed elements were identified either only in M. musculus or exclusively in both M. musculus and M. domesticus, indicative of recent integrations. In conjunction with the identification of transcripts, we present an active ID-like group of elements that is not derived from the proposed BC1 master gene of ID elements. A BLAST of the rat genome indicated that these elements were not in the rat. Therefore, this family of SINEs has recently evolved, and since it has thus far been observed mainly in M. musculus, we refer to this family as MMIDL.
Cloning and shake flask expression of hrIDS- Like in Pichia pastoris ...
African Journals Online (AJOL)
The human Iduronate-2-sulfate sulfatase (hIDS-Like) was cloned into the methylotrophic yeast Pichia pastoris under the control of alcohol oxidase promoter (AOX1) and the -mating factor signal peptide (a-factor). Six clones were identified by PCR. Using clone IDS28, the enzyme was secreted into the culture medium, ...
Alía, P; Mañá, J; Capdevila, O; Alvarez, A; Navarro, M A
2005-01-01
Serum angiotensin converting enzyme (SACE) concentration is considered a marker of sarcoidosis activity. This concentration is influenced by an insertion/deletion (I/D) polymorphism of the ACE gene, such that SACE levels follow the pattern DD>ID>II. The aim of our work was to study the relationship between I/D polymorphism and susceptibility to sarcoidosis, as well as the relation between this polymorphism and the clinical presentation and evolution of the disease in 177 sarcoidosis patients. A group of 104 individuals without sarcoidosis was included as control. Genotyping was done by a polymerase chain reaction (PCR) method, and SACE concentration at diagnosis was determined by a kinetic method. No differences were observed in genotype or allele distributions between patients and controls, nor between patients considering the type of presentation (Löfgren versus non-Löfgren) and evolution of the disease (acute versus chronic). As reported for healthy populations, SACE concentrations followed the pattern DD>ID>II in sarcoidosis patients, but significant differences between genotypes existed only in the Löfgren group (p = 0.003) and in acute patients (p = 0.02). SACE concentrations at diagnosis were lower in acute patients (p = 0.05) and in Löfgren's syndrome (p = 0.04), but this seemed to occur only in ID individuals (p = 0.02 and p = 0.01, respectively). No relation was thus found between I/D polymorphism and susceptibility to sarcoidosis, but ACE I/D genotyping may improve the assessment of disease activity, both at diagnosis and during the follow-up of treated and untreated patients.
An enhanced dynamic ID-based authentication scheme for telecare medical information systems
Directory of Open Access Journals (Sweden)
Ankita Chaturvedi
2017-01-01
Full Text Available The authentication schemes for telecare medical information systems (TMIS try to ensure secure and authorized access. ID-based authentication schemes address secure communication, but privacy is not properly addressed. In recent times, dynamic ID-based remote user authentication schemes for TMIS have been presented to protect user’s privacy. The dynamic ID-based authentication schemes efficiently protect the user’s privacy. Unfortunately, most of the existing dynamic ID-based authentication schemes for TMIS ignore the input verifying condition. This makes login and password change phases inefficient. Inefficiency of the password change phase may lead to denial of service attack in the case of incorrect input in the password change phase. To overcome these weaknesses, we proposed a new dynamic ID-based authentication scheme using a smart card. The proposed scheme can quickly detect incorrect inputs which makes the login and password change phase efficient. We adopt the approach with the aim to protect privacy, and efficient login and password change phases. The proposed scheme also resists off-line password guessing attack and denial of service attack. We also demonstrate the validity of the proposed scheme by utilizing the widely-accepted BAN (Burrows, Abadi, and Needham logic. In addition, our scheme is comparable in terms of the communication and computational overheads with relevant schemes for TMIS.
Zircaloy cladding ID/OD oxidation studies. Final report
International Nuclear Information System (INIS)
Westerman, R.E.; Hesson, G.M.
1977-11-01
The ID/OD oxide ratio that forms on Zircaloy tubing at temperatures relevant to postulated LOCA conditions was measured as a function of time, temperature, and distance from the rupture. The average ratio at the rupture position was less than unity, and decreased with decreasing test time and increasing distance from the point of rupture. The maximum observed ID/OD oxide ratio was 1.4. Ratios in excess of unity were typically found to be a consequence of the OD oxide being thinner than would have been anticipated from the nominal test conditions. Confirmatory data were also obtained on the isothermal oxidation kinetics of Zircaloy. These data are in good agreement with those obtained by other investigators and confirm the conservative nature of the Baker-Just equation that is required for use in licensing calculations
Directory of Open Access Journals (Sweden)
García-Carpintero, Esther
2014-06-01
Full Text Available The development and improvement of cooperation between the industrial sector and the public R&D system can produce competitive advantages for the companies. The present work describes experiences and perceptions of Spanish biotechnology companies in their collaboration with the public R&D system. Results show that almost all the biotechnological companies with R&D activities (93.6% have cooperated with the public R&D system. The main barriers found by the companies are the excess of bureaucracy and the slow response of public researchers. Results obtained also suggest the need to establish public policies and programmes to promote knowledge and technology transfer from public research centres to companies, with a special focus on encouraging researchers from the public R&D system and on improving how Technology Transfer Offices work.El desarrollo y la mejora de la cooperación entre el sector productivo y el sistema público de I+D puede generar un conjunto de ventajas competitivas para estas empresas. El presente trabajo describe las experiencias y percepciones de las empresas biotecnológicas españolas en su colaboración con el sistema público de I+D. Los resultados muestran que prácticamente la totalidad de empresas biotecnológicas españolas con actividades de I+D (un 93,6% han mantenido algún tipo de colaboración con el sistema público de I+D. Los principales obstáculos percibidos por estas empresas en su colaboración con el sistema público de I+D son el exceso de burocracia y la respuesta lenta de los investigadores. Los resultados obtenidos sugieren la conveniencia de establecer políticas y programas públicos para fomentar la transferencia de conocimiento y tecnología desde el sistema público de I+D a las empresas, fundamentalmente centrados en la necesidad de incentivar a los investigadores del sistema público de I+D y mejorar el funcionamiento de las Oficinas de Transferencia de Tecnología.
Search for superdeformation in {sup 144,145}Gd
Energy Technology Data Exchange (ETDEWEB)
Rzaca-Urban, T [Warsaw Univ. (Poland); Lieder, R M; Strahle, K; Utzelmann, S; Gast, W; Kutchin, D; Schnare, H [Forschungszentrum Juelich GmbH (Germany). Inst. fuer Kernphysik; Georgiev, A [Sofia Univ. (Bulgaria); Marti, G [Comision Nacional de Energia Atomica, Buenos Aires (Argentina). Dept. de Fisica; Spohr, K [Forschungszentrum Juelich GmbH (Germany). Inst. fuer Kernphysik; [Hahn-Meitner-Institut Berlin GmbH (Germany); Brentano, P; Eberth, J; Eschenauer, M; Freund, S; Ott, E; Theuerkauf, J; Wolters, H; Zell, K O [Koeln Univ. (Germany). Inst. fuer Kernphysik; Maier, K H; Grave, H; Bach, C; Heese, J; Kluge, H; Schramm, M; Schubarth, R [Hahn-Meitner-Institut Berlin GmbH (Germany)
1992-08-01
Two experiments were performed and analyzed to search for superdeformation band in {sup 144,145}Gd by bombarding {sup 108,110}Pd targets with {sup 40A}r ions with energies of 182 and 189 MeV respectively, at the VICKSI accelerator of the Hahn-Meitner Institut, Berlin. The gamma radiation was measured with the OSIRIS spectrometer. An extended level system was proposed. 8 refs., 2 figs.
miR-342 regulates BRCA1 expression through modulation of ID4 in breast cancer.
Directory of Open Access Journals (Sweden)
Elisabetta Crippa
Full Text Available A miRNAs profiling on a group of familial and sporadic breast cancers showed that miRNA-342 was significantly associated with estrogen receptor (ER levels. To investigate at functional level the role of miR-342 in the pathogenesis of breast cancer, we focused our attention on its "in silico" predicted putative target gene ID4, a transcription factor of the helix-loop-helix protein family whose expression is inversely correlated with that of ER. ID4 is expressed in breast cancer and can negatively regulate BRCA1 expression. Our results showed an inverse correlation between ID4 and miR-342 as well as between ID4 and BRCA1 expression. We functionally validated the interaction between ID4 and miR-342 in a reporter Luciferase system. Based on these findings, we hypothesized that regulation of ID4 mediated by miR-342 could be involved in the pathogenesis of breast cancer by downregulating BRCA1 expression. We functionally demonstrated the interactions between miR-342, ID4 and BRCA1 in a model provided by ER-negative MDA-MB-231 breast cancer cell line that presented high levels of ID4. Overexpression of miR-342 in these cells reduced ID4 and increased BRCA1 expression, supporting a possible role of this mechanism in breast cancer. In the ER-positive MCF7 and in the BRCA1-mutant HCC1937 cell lines miR-342 over-expression only reduced ID4. In the cohort of patients we studied, a correlation between miR-342 and BRCA1 expression was found in the ER-negative cases. As ER-negative cases were mainly BRCA1-mutant, we speculate that the mechanism we demonstrated could be involved in the decreased expression of BRCA1 frequently observed in non BRCA1-mutant breast cancers and could be implicated as a causal factor in part of the familial cases grouped in the heterogeneous class of non BRCA1 or BRCA2-mutant cases (BRCAx. To validate this hypothesis, the study should be extended to a larger cohort of ER-negative cases, including those belonging to the BRCAx class.
Monetizing a Meme: YouTube, Content ID, and the Harlem Shake
Directory of Open Access Journals (Sweden)
Michael Soha
2016-01-01
Full Text Available This article analyzes the creation, evolution, and monetization of the Harlem Shake meme on YouTube to explore contemporary implementation of copyright and understanding of authorship in regard to monetization of works with distributed authorship. This article has three main findings: first, we highlight the collection of digital labor that comprises the “Harlem Shake” meme, its rise in popularity, and the subsequent rise in popularity of Baauer, the composer of the song which forms the backbone of the meme; second, we examine how YouTube’s “new bargain” of Content ID, as a departure from the site’s origins creates coercive control mechanisms, shedding new light on the concept of and debate over “digital sharecropping.” Finally, we argue for a “Fair(er use” system by exploring how memes might be understood outside of the contemporary copyright system, rethinking the rights of users engaged in collective production. The article is significant in that it challenges the current distribution of Content ID payments solely to copyright holders in an attempt to rethink a system that acknowledges the creative labor of memetic phenomena and collective authorship.
Cytochrome P450-mediated metabolism of the synthetic cannabinoids UR-144 and XLR-11
DEFF Research Database (Denmark)
Nielsen, Line Marie; Holm, Niels Bjerre; Olsen, Lars
2016-01-01
In recent years, synthetic cannabinoids have emerged in the illicit drug market, in particular via the Internet, leading to abuse of these drugs. There is currently limited knowledge about the specific enzymes involved in the metabolism of these drugs. In this study, we investigated the cytochrome...... of UR-144 and XLR-11, while inhibition of the other CYP enzymes in HLM had only minor effects. Thus, CYP3A4 is the major contributor to the CYP mediated metabolism of UR-144 and XLR-11 with minor contributions from CYP1A2. Users of UR-144 and XLR-11 are thus subject to the influence of potential drug-drug...... interactions, if they are concomitantly medicated with CYP3A4 inducers (e.g. some antiepileptics) or inhibitors (e.g. some antifungal drugs). Copyright © 2015 John Wiley & Sons, Ltd....
Hussain, Misbah; Awan, Fazli Rabbi; Gujjar, Amna; Hafeez, Shakir; Islam, Mehboob
2018-01-01
Angiotensin converting enzyme (ACE) is a key component of renin angiotensin aldosterone system. It converts angiotensin I to angiotensin II. Insertion/deletion (I/D) polymorphism of ACE gene is found associated with several complications. However, its association with hypertension and related metabolic diseases is still controversial. So, the aim of the present study was to check this association for Punjabi population from Faisalabad, Pakistan. For this purpose, blood samples (patients = 100, controls = 48) were collected and several biochemical parameters were measured. Genotyping for ACE (I/D) polymorphism was performed by polymerase chain reaction (PCR) assay. ID genotype is found prevalent in the studied population as 41% in control subjects and 61% in patients. Furthermore, chi-square analysis showed significant (p = 0.005) difference for genotypic frequencies between both groups. One-way ANOVA for association of II, ID, and DD genotypes with anthropometric, clinical, and biochemical parameters showed that in patient group, DD genotype is significantly (p = 0.041) associated with systolic blood pressure (SBP). Moreover, ID genotype is found associated with the presence of cardiovascular diseases. This study concludes that DD genotype is strongly associated with higher SBP in hypertensive patients.
The paradox of IDs: an account of an ethnographic experience in the US
Directory of Open Access Journals (Sweden)
Mariza Peirano
2008-01-01
Full Text Available In the modern world, IDs are indispensable objects, without which we cannot prove that we are who we say we are. We need material substantiation that attests to the authenticity of our self-identification. This paper is an account of an ethnographic experience about IDs and identification processes in the US, based on the examination of two events in which Eliot Spitzer, the New York State governor from January 2007 to March 2008, was a central figure. A comparison with the Brazilian scenario is present throughout the paper, and it ends by focusing on the ID theft phenomenon.
Prevention of radiation pneumonitis from inhaled 144Ce by lung lavage in beagle dogs
International Nuclear Information System (INIS)
Muggenburg, B.A.; Mauderly, J.L.; Boecker, B.B.; Hahn, F.F.; McClellan, R.O.
1975-01-01
This study was performed to evaluate bronchopulmonary lavage and chelation therapy as a treatment method to prevent the development of radiation pneumonitis after inhalation of a radioactive aerosol. Twelve beagle dogs were exposed to an aerosol of cerium-144 in fused clay particles resulting in initial lung burdens from 47 to 64 μCi of 144 Ce per kg of body weight. Eight of the dogs were treated with a series of 10 bronchopulmonary lavages and 10 intravenous injections of calcium diethylenetriamine pentaacetate acid during the first 56 days after exposure to remove the deposited 144 Ce; the remaining 4 exposed dogs received no treatment. An additional 4 dogs were exposed to stable cerium and were given the course of treatment as an additional control group. Three of the 4 untreated dogs and 2 of the 8 treated dogs died 171 to 246 days after exposure with radiation pneumonitis or pulmonary fibrosis, or both. All but one of the remaining dogs were alive and apparently in good clinical health 550 days after exposure; the one dog had radiographic indications of pulmonary fibrosis by 365 days after exposure. The relative distribution of 144 Ce in the lungs and other major organs was similar in the treated and untreated dogs that died
Implementasi Cell ID dan GPS dalam Pencarian Lokasi Fasilitas Kesehatan Terdekat
Directory of Open Access Journals (Sweden)
Fahmi Candra Permana
2017-07-01
Full Text Available Cell ID dan GPS merupakan layanan berbasis lokasi dan teknologi yang banyak membantu manusia dalam hal navigasi dan penemuan tempat-tempat yang bermanfaat di sekitarnya. Salah satu komponen utama dari teknologi ini dapat diterapkan pada telepon seluler. Dalam penelitian ini, dirancang sebuah aplikasi dengan memanfaatkan teknologi berdasar implementasi dari Cell ID dan GPS untuk mengetahui posisi user dan lokasi fasilitas kesehatan terdekat di sekitar user dan penggunaan JSON sebagai sarana untuk menyimpan database pada web. Aplikasi ini diimplementasikan pada telepon seluler dengan sistem operasi Android. Hasil dari penelitian ini menunjukkan bahwa Cell ID dan GPS dapat diimplementasikan dengan baik dengan memanfaatkan akses Internet dan Google Maps untuk mencari fasilitas kesehatan terdekat dan menggambarkan daerah sekitar user.
Aguilar, Patricia V; Adams, A Paige; Suárez, Victor; Beingolea, Luis; Vargas, Jorge; Manock, Stephen; Freire, Juan; Espinoza, Willan R; Felices, Vidal; Diaz, Ana; Liang, Xiaodong; Roca, Yelin; Weaver, Scott C; Kochel, Tadeusz J
2009-09-15
Venezuelan equine encephalitis virus (VEEV) has been responsible for hundreds of thousands of human and equine cases of severe disease in the Americas. A passive surveillance study was conducted in Peru, Bolivia and Ecuador to determine the arboviral etiology of febrile illness. Patients with suspected viral-associated, acute, undifferentiated febrile illness of Peru, and more recently (2005), in Madre de Dios, Peru. We performed phylogenetic analyses with VEEV from Bolivia, Ecuador and Peru and compared their relationships to strains from other parts of South America. We found that VEEV subtype ID Panama/Peru genotype is the predominant one circulating in Peru. We also demonstrated that VEEV subtype ID strains circulating in Ecuador belong to the Colombia/Venezuela genotype and VEEV from Madre de Dios, Peru and Cochabamba, Bolivia belong to a new ID genotype. In summary, we identified a new major lineage of enzootic VEEV subtype ID, information that could aid in the understanding of the emergence and evolution of VEEV in South America.
Role of ID Proteins in BMP4 Inhibition of Profibrotic Effects of TGF-β2 in Human TM Cells.
Mody, Avani A; Wordinger, Robert J; Clark, Abbot F
2017-02-01
Increased expression of TGF-β2 in primary open-angle glaucoma (POAG) aqueous humor (AH) and trabecular meshwork (TM) causes deposition of extracellular matrix (ECM) in the TM and elevated IOP. Bone morphogenetic proteins (BMPs) regulate TGF-β2-induced ECM production. The underlying mechanism for BMP4 inhibition of TGF-β2-induced fibrosis remains undetermined. Bone morphogenic protein 4 induces inhibitor of DNA binding proteins (ID1, ID3), which suppress transcription factor activities to regulate gene expression. Our study will determine whether ID1and ID3 proteins are downstream targets of BMP4, which attenuates TGF-β2 induction of ECM proteins in TM cells. Primary human TM cells were treated with BMP4, and ID1 and ID3 mRNA, and protein expression was determined by quantitative PCR (Q-PCR) and Western immunoblotting. Intracellular ID1 and ID3 protein localization was studied by immunocytochemistry. Transformed human TM cells (GTM3 cells) were transfected with ID1 or ID3 expression vectors to determine their potential inhibitory effects on TGF-β2-induced fibronectin and plasminogen activator inhibitor-I (PAI-1) protein expression. Basal expression of ID1-3 was detected in primary human TM cells. Bone morphogenic protein 4 significantly induced early expression of ID1 and ID3 mRNA (P protein in primary TM cells, and a BMP receptor inhibitor blocked this induction. Overexpression of ID1 and ID3 significantly inhibited TGF-β2-induced expression of fibronectin and PAI-1 in TM cells (P protein 4 induced ID1 and ID3 expression suppresses TGF-β2 profibrotic activity in human TM cells. In the future, targeting specific regulators may control the TGF-β2 profibrotic effects on the TM, leading to disease modifying IOP lowering therapies.
Papaspyridonos, Marianna; Matei, Irina; Huang, Yujie; do Rosario Andre, Maria; Brazier-Mitouart, Helene; Waite, Janelle C; Chan, April S; Kalter, Julie; Ramos, Ilyssa; Wu, Qi; Williams, Caitlin; Wolchok, Jedd D; Chapman, Paul B; Peinado, Hector; Anandasabapathy, Niroshana; Ocean, Allyson J; Kaplan, Rosandra N; Greenfield, Jeffrey P; Bromberg, Jacqueline; Skokos, Dimitris; Lyden, David
2015-04-29
A central mechanism of tumour progression and metastasis involves the generation of an immunosuppressive 'macroenvironment' mediated in part through tumour-secreted factors. Here we demonstrate that upregulation of the Inhibitor of Differentiation 1 (Id1), in response to tumour-derived factors, such as TGFβ, is responsible for the switch from dendritic cell (DC) differentiation to myeloid-derived suppressor cell expansion during tumour progression. Genetic inactivation of Id1 largely corrects the myeloid imbalance, whereas Id1 overexpression in the absence of tumour-derived factors re-creates it. Id1 overexpression leads to systemic immunosuppression by downregulation of key molecules involved in DC differentiation and suppression of CD8 T-cell proliferation, thus promoting primary tumour growth and metastatic progression. Furthermore, advanced melanoma patients have increased plasma TGFβ levels and express higher levels of ID1 in myeloid peripheral blood cells. This study reveals a critical role for Id1 in suppressing the anti-tumour immune response during tumour progression and metastasis.
Kang, Hui-Yuan; Wang, Xin-Rong; Gao, Li; Wang, Wei; Li, Mian-Yang; Wang, Li-Li; Wang, Cheng-Bin; Yu, Li
2015-04-01
To evaluate significance of ID4 gene mehtylation in demethylating myelodysplastic syndrome(MDS) cell Line MUTZ1 and 2 patients with MDS. The methylation-specific PCR (MS-PCR) and reverse transcription-PCR (RT-PCR) were applied to identify the methylation status and gene expression of ID4 gene in MDS cell line MUTZ1, a patient with aplastic anemia(AA) and a donor with normal bone marrow (NBM). RT-PCR was applied to detect the ID4 gene expression status in MUTZ1 cell line treated with decitabine at 3 different concentrations. Then bisulfite sequencing PCR (BSP) was applied to detect ID4 gene methylation status in 2 MDS parients treated with decitabine. The MDS cell line MUTZ-1 displayed a complete methylation of ID4 gene promoter with little mRNA expression. Inversely, bone marrow of an AA patient and NBM showed complete unmethylation of this gene with intensity mRNA expression. With the increase of decitabine concentration, ID4 gene mRNA expression was more and more increased. After decitabine treatment, ID4 gene methylation-positive frequencies of both the 2 MDS patients were much more decreased than that of the first treatment. So, ID4 gene mRNA expression inhibited by promoter hypemethylation could be recovered by using demethylation medicine. ID4 as a new potential anti-oncogene suggests that its methylation may become a marker for selection and assessment of therapeutic schedules in patients with MDS.
77 FR 68065 - Amendment of Class D and Class E Airspace; Lewiston, ID
2012-11-15
... Measuring Equipment (VOR/ DME), and the Lewiston-Nez Perce Instrument Landing System (ILS) Localizer... feet or more above the surface of the earth. * * * * * ANM ID E5 Lewiston, ID [Modified] Lewiston-Nez...
Suurnimed jäid müümata / Maria-Kristiina Soomre
Soomre, Maria-Kristiina, 1978-
2001-01-01
9. mai Christie' oksjonist, müümata jäänud Picasso, Degas', Cezanne'i tööd. 8. mai Sotheby oksjonist, kus edukalt müüdi töid S. J. Seegeri kogust, 3,85 miljoni dollari eest M. Beckmanni "Perseuse viimane katsumus". Sotheby kaasaegse kunsti oksjonil New Yorgis müüdi 5,6 miljoni dollari eest J. Koonsi skulptuur M. Jacksonist. Müümata jäid A. Warholi "Viis supipurki", A. Calderi 3 skulptuuri
78 FR 40382 - Modification of Class D and E Airspace; Twin Falls, ID
2013-07-05
... using the Navigation (RNAV) Global Positioning System (GPS) and the Instrument Landing System (ILS) or... or more above the surface of the earth. * * * * * ANM ID E5 Twin Falls, ID [Modified] Twin Falls...
Search for superdeformation in 144Gd
International Nuclear Information System (INIS)
Vivien, J.P.; Nourreddine, A.; Beck, F.A.; Byrski, T.; Gehringer, C.; Haas, B.; Merdinger, J.C.; Dudek, J.; Nazarewicz, W.
1986-01-01
Quasi-continuum γ-decay studies of 144 Gd have been performed using the 120 Sn( 28 Si,4n)reaction at 125, 135, 145 and 155 MeV bombarding energies. Angular distribution and multiplicity measurements have been done at the above energies. At 145 MeV bombarding energy a lifetime measurement has also been performed. Although a collective behaviour has been observed, the present data do not give evidence for population of superdeformed rotational bands. Theoretical interpretation using the cranking model with the Woods-Saxon field is given. The effects of temperature and pairing on the superdeformed configuration are discussed; superdeformation effects are predicted to disappear below I ∼ 60-70 ℎ when temperature exceeds ∼ 500 KeV
Kohr, Mark J; Evangelista, Alicia M; Ferlito, Marcella; Steenbergen, Charles; Murphy, Elizabeth
2014-04-01
Oxidative stress and membrane damage following myocardial ischemia/reperfusion injury are important contributors to cardiomyocyte death and the loss of myocardial function. Our previous study identified cysteine 144 (C144) of tripartite motif-containing protein 72 (TRIM72) as a potential site for S-nitrosylation (SNO). TRIM72 is a cardioprotective membrane repair protein that can be both activated and targeted for degradation by different oxidative modifications. Consistent with the potential regulation of TRIM72 by various oxidative modifications, we found that SNO levels increased at C144 of TRIM72 with ischemic preconditioning. Therefore, to investigate the role of C144 in the regulation of TRIM72 function, we mutated C144 of TRIM72 to a serine residue (TRIM72(C144S)), and expressed either TRIM72(WT) or TRIM72(C144S) in HEK-293 cells, which lack endogenous TRIM72, in order to examine the effect of this mutation on the functional stability of TRIM72 and on cell survival. We hypothesized that SNO of TRIM72 stabilizes the protein, thus allowing for membrane repair and enhanced cell survival. Upon treatment with hydrogen peroxide (H2O2), we found that TRIM72(WT) levels were decreased, but not TRIM72(C144S) and this correlated with increased H2O2-induced cell death in TRIM72(WT) cells. Additionally, we found that treatment with the cardioprotective S-nitrosylating agent S-nitrosoglutathione (GSNO), was able to preserve TRIM72(WT) protein levels and enhance TRIM72(WT)-mediated cell survival, but had no effect on TRIM72(C144S) levels. Consistent with our hypothesis, GSNO was also found to increase SNO levels and inhibit H2O2-induced irreversible oxidation for TRIM72(WT) without affecting TRIM72(C144S). In further support of our hypothesis, GSNO blocked the ischemia/reperfusion-induced decrease in TRIM72 levels and reduced infarct size in a Langendorff-perfused heart model. The results of these studies have important implications for cardioprotection and suggest that
The Implementation of C-ID, R2D2 Model on Learning Reading Comprehension
Rayanto, Yudi Hari; Rusmawan, Putu Ngurah
2016-01-01
The purposes of this research are to find out, (1) whether C-ID, R2D2 model is effective to be implemented on learning Reading comprehension, (2) college students' activity during the implementation of C-ID, R2D2 model on learning Reading comprehension, and 3) college students' learning achievement during the implementation of C-ID, R2D2 model on…
Anmeldung in ILIAS ohne Uni-Login-ID
Schanz, Nadja
2016-01-01
Gewusst wie...! Online-Tutorial der Universitätsbibliothek Tübingen. Erklärt die Anmeldung in Ilias zu Führungen ohne Uni-Login-ID Online Tutorial from university library tuebingen. teaches how to register in Ilias for courses and guided tours without university login
Directory of Open Access Journals (Sweden)
van Karnebeek Clara D M
2012-07-01
Full Text Available Abstract Background Intellectual disability (ID is a devastating and frequent condition, affecting 2-3% of the population worldwide. Early recognition of treatable underlying conditions drastically improves health outcomes and decreases burdens to patients, families and society. Our systematic literature review identified 81 such inborn errors of metabolism, which present with ID as a prominent feature and are amenable to causal therapy. The WebAPP translates this knowledge of rare diseases into a diagnostic tool and information portal. Methods & results Freely available as a WebAPP via http://www.treatable-id.org and end 2012 via the APP store, this diagnostic tool is designed for all specialists evaluating children with global delay / ID and laboratory scientists. Information on the 81 diseases is presented in different ways with search functions: 15 biochemical categories, neurologic and non-neurologic signs & symptoms, diagnostic investigations (metabolic screening tests in blood and urine identify 65% of all IEM, therapies & effects on primary (IQ/developmental quotient and secondary outcomes, and available evidence For each rare condition a ‘disease page’ serves as an information portal with online access to specific genetics, biochemistry, phenotype, diagnostic tests and therapeutic options. As new knowledge and evidence is gained from expert input and PubMed searches this tool will be continually updated. The WebAPP is an integral part of a protocol prioritizing treatability in the work-up of every child with global delay / ID. A 3-year funded study will enable an evaluation of its effectiveness. Conclusions For rare diseases, a field for which financial and scientific resources are particularly scarce, knowledge translation challenges are abundant. With this WebAPP technology is capitalized to raise awareness for rare treatable diseases and their common presenting clinical feature of ID, with the potential to improve health outcomes
2012-01-01
Background Intellectual disability (ID) is a devastating and frequent condition, affecting 2-3% of the population worldwide. Early recognition of treatable underlying conditions drastically improves health outcomes and decreases burdens to patients, families and society. Our systematic literature review identified 81 such inborn errors of metabolism, which present with ID as a prominent feature and are amenable to causal therapy. The WebAPP translates this knowledge of rare diseases into a diagnostic tool and information portal. Methods & results Freely available as a WebAPP via http://www.treatable-id.org and end 2012 via the APP store, this diagnostic tool is designed for all specialists evaluating children with global delay / ID and laboratory scientists. Information on the 81 diseases is presented in different ways with search functions: 15 biochemical categories, neurologic and non-neurologic signs & symptoms, diagnostic investigations (metabolic screening tests in blood and urine identify 65% of all IEM), therapies & effects on primary (IQ/developmental quotient) and secondary outcomes, and available evidence For each rare condition a ‘disease page’ serves as an information portal with online access to specific genetics, biochemistry, phenotype, diagnostic tests and therapeutic options. As new knowledge and evidence is gained from expert input and PubMed searches this tool will be continually updated. The WebAPP is an integral part of a protocol prioritizing treatability in the work-up of every child with global delay / ID. A 3-year funded study will enable an evaluation of its effectiveness. Conclusions For rare diseases, a field for which financial and scientific resources are particularly scarce, knowledge translation challenges are abundant. With this WebAPP technology is capitalized to raise awareness for rare treatable diseases and their common presenting clinical feature of ID, with the potential to improve health outcomes. This innovative digital
International Nuclear Information System (INIS)
Mulmule, Manoj D.; Shimmy, Shankar M.; Bambole, Vaishali; Jamdar, Sahayog N.; Rawat, K.P.; Sarma, K.S.S.
2017-01-01
Idli, a steam-cooked breakfast food item consumed in India, is famous as a staple food for its spongy texture and unique fermented taste. Idli preparation is a time consuming process; although instant Idli pre-mixes as powder or batter are available in the market, they do not have the distinctive taste and aroma similar to the Idli prepared at home. Hence ready-to-eat (RTE) form of this food is in demand. Therefore, an attempt was made to prepare RTE Idli bearing similar taste as home-cooked Idli with an extended shelf-life of up to two months at an ambient temperature using Electron Beam Irradiation (EBI) at dosages 2.5 kGy, 5 kGy and 7.5 kGy and combination processing comprised of EBI dosage at 2.5 kGy and thermal treatment (80 °C for 20 min). The treated Idli's were microbiologically and sensorially evaluated at storage periods of zero day, 14 days, 30 days and 60 days. Idli's irradiated at 7.5 kGy and subjected to combination processing at 2.5 kGy and thermal treatment were shelf-stable for 60 days. 2.5 kGy and 5 kGy radiation dosages alone were not sufficient to preserve Idli samples for more than 14 days. Undesirable change in sensory properties of Idli was observed at an EBI dosage of 7.5 kGy. Sensory properties of combination processed Idli's were found to undergo minor change over the storage period. The present work suggests that lowest radiation dosage in combination with thermal treatment could be useful to achieve the extended shelf-life without considerably impairing the organoleptic quality of Ready-to-Eat Idli. - Highlights: • Idli (traditional Indian fermented food) was prepared in ready-to-eat (RTE) form. • Ready-to-eat Idli was then subjected to combination processing comprised of lowest irradiation dosage of 2.5 kGy with mild heat treatment to extend its shelf life. • Increase in hardness and decrease in brightness of combination processed Idli was observed. • Combination processed Idli was microbiologically safe and
Effect of 144Ce inhaled in fused-clay particles on the tracheobronchial lymph nodes
International Nuclear Information System (INIS)
Hahn, F.F.; Boecker, B.B.; Hobbs, C.H.; Jones, R.K.; Muggenburg, B.A.
1976-01-01
Tracheobronchial lymph node changes and lymphopenia are sequelae of inhalation of relatively insoluble radioactive aerosols by beagle dogs. The tracheobronchial lymph nodes from dogs that inhaled 144 Ce in fused-clay particles were examined at intervals from 2 to 730 days after exposure to assess the development of these lesions. Initial lung burdens in the dogs studied ranged from 33 to 63 μCi/kg of body weight. The concentration of radioisotope in the tracheobronchial lymph nodes increased during the first year after exposure and exceeded that in the lung about 100 days after exposure. Autoradiographs of the lymph nodes showed that 144 Ce particles were present in macrophages in the paracortical zone two days after exposure and that concentrations continued to increase in the paracortical zone and medullary cords. Histologic changes in the nodes included atrophy of the germinal centers and lymphocytic follicles, loss of lymphocytes and accumulation of macrophages in the paracortical zone, accumulation of pigment and isotope-laden macrophages in the medullary cords, occasional infiltrates of neutrophils in the medullary cords, and at later time periods focal fibrosis of the medullary cords. Tracheobronchial lymph node weights of the dogs exposed to 144 Ce in fused clay were not decreased until 512 days after exposure. These findings indicate that tracheobronchial lymph nodes accumulate relatively high burdens of 144 Ce after 144 Ce is inhaled in a relatively insoluble form and that the pathologic changes resulting from these burdens are basically atrophy of the nodes. Primary neoplasms in lymph nodes were not observed in dogs with initial lung burdens of 0.0024 to more than 30 μCi/kg of body weight followed for up to 2000 days after exposure. At the higher levels, however, a high incidence of primary pulmonary neoplasia was observed
International Nuclear Information System (INIS)
Boecker, B.B.; Hahn, F.F.; Muggenburg, B.A.; McClellan, R.O.; Mauderly, J.L.; Pickrell, J.A.
1980-01-01
Beagle dogs were exposed repeatedly to a relatively insoluble form of 144 Ce (in fused aluminosilicate particles) to study the deposition, retention, and long-term biological effects for comparison with data from dogs that were exposed only once to a similar aerosol. Four groups of nine dogs each were exposed once every 8 weeks for 2 years (13 exposures) to achieve specified exposure goals. These goals were: to increase the lung burden by 2.5 μCi 144 Ce/kg body weight with each exposure; to reestablish lung burdens of 9 or 4.5 μCi 144 Ce/kg body weight and to expose controls to fused aluminosilicate particles containing nonradioactive cerium. To date, 19 exposed dogs and 2 control dogs have died or were euthanized. The most prevalent findings to date have been pulmonary carcinomas (7 dogs) and hemangiosarcomas in the tracheobronchial lymph nodes (3 dogs). Observations are continuing on the surviving 8 144 Ce-exposed and 7 control dogs who are now at approximately 2500 days (6.8 years) after the first exposure
Fraudulent ID using face morphs: Experiments on human and automatic recognition.
Robertson, David J; Kramer, Robin S S; Burton, A Mike
2017-01-01
Matching unfamiliar faces is known to be difficult, and this can give an opportunity to those engaged in identity fraud. Here we examine a relatively new form of fraud, the use of photo-ID containing a graphical morph between two faces. Such a document may look sufficiently like two people to serve as ID for both. We present two experiments with human viewers, and a third with a smartphone face recognition system. In Experiment 1, viewers were asked to match pairs of faces, without being warned that one of the pair could be a morph. They very commonly accepted a morphed face as a match. However, in Experiment 2, following very short training on morph detection, their acceptance rate fell considerably. Nevertheless, there remained large individual differences in people's ability to detect a morph. In Experiment 3 we show that a smartphone makes errors at a similar rate to 'trained' human viewers-i.e. accepting a small number of morphs as genuine ID. We discuss these results in reference to the use of face photos for security.
VIPP-LD: A promising Video Feedback intervention program for parents with ID
Hodes, M.W.; Kef, S.; Meppelder, H.M.; Schuengel, C.
2012-01-01
Aim: Parenting support has been shown to be of benefit to parents with intellectual disabilities (ID) on several outcomes; however, effects on parent-child interaction in the form of sensitive responsiveness and positive inductive discipline are still under debate. This study tested the effects of an
International Nuclear Information System (INIS)
Meng, Qingzhen; Jia, Zhuqing; Wang, Weiping; Li, Binhong; Ma, Kangtao; Zhou, Chunyan
2011-01-01
Highlights: → Id1 was upregulated during the cardiac differentiation process of P19CL6 cells. → Id1 upregulated expression of cardiac specific genes Gata4, α-MHC and ISL1. → Id1 promoted proliferation of P19CL6 cells. → Overexpression of Id1 increased activity of TOP flash. → Wnt3a or LiCl treatment promoted Id1 expression in P19CL6 cells. -- Abstract: The inhibitor of DNA binding (Id) family of genes encodes negative regulators of basic helix-loop-helix transcription factors and has been implicated in such diverse cellular processes as differentiation, proliferation, apoptosis and migration. Id knockout mouse embryos display multiple cardiac defects but the specific role of Id1 in cardiac differentiation is unclear. In the present study, we investigated the function of Id1 in DMSO-induced P19CL6 cells, a widely-accepted cell model of cardiac differentiation. We found that Id1 was upregulated during the cardiac differentiation of P19CL6 cells. The expression of cardiac specific marker genes, Gata4, α-MHC and ISL1, was upregulated in P19CL6 cells stably transfected with Id1 (P19CL6-Id1) during cardiac differentiation. The overexpression of Id1 reduced the number of cells in G1 phase and increased the cell population in G2, M and S phases, while knockdown of Id1 increased the number of cells in G1 phase from 48.6 ± 2.51% to 62.2 ± 1.52% at day 0 of cardiac induction, and from 52.5 ± 3.41% to 63.7 ± 1.02% at day 3 after cardiac induction, indicating that Id1 promoted proliferation of P19CL6 cells. Luciferase assays showed that the activity of TOP flash was higher in P19CL6-Id1 cells than wildtype P19CL6 cells, while Id1 expression was also upregulated in P19CL6 cells treated with Wnt3a or LiCl. This indicates that there may be positive feedback between Id1 and Wnt signaling which plays an important role in cardiac differentiation.
Automatic spent fuel ID number reader (I)
International Nuclear Information System (INIS)
Tanabe, S.; Kawamoto, H.; Fujimaki, K.; Kobe, A.
1991-01-01
An effective and efficient technique has been developed for facilitating identification works of LWR spent fuel stored in large scale spent fuel storage pools of such as processing plants. Experience shows that there are often difficulties in the implementation of operator's nuclear material accountancy and control works as well as safeguards inspections conducted on spent fuel assemblies stored in deep water pool. This paper reports that the technique is realized as an automatic spent fuel ID number reader system installed on fuel handling machine. The ID number reader system consists of an optical sub-system and an image processing sub-system. Thousands of spent fuel assemblies stored in under water open racks in each storage pool could be identified within relatively short time (e.g. within several hours) by using this combination. Various performance tests were carried out on image processing sub-system in 1990 using TV images obtained from different types of spent fuel assemblies stored in various storage pools of PWR and BWR power stations
Directory of Open Access Journals (Sweden)
G. Biasotto
2010-01-01
Full Text Available CaBi4Ti4O15 (CBTi144 thin films were grown on Pt/Ti/SiO2/Si substrates using a soft chemical solution and spin-coating method. Structure and morphology of the films were characterized by the X-ray Diffraction (XRD, Fourier-transform infrared spectroscopy (FT-IR, Raman analysis, X-ray photoemission spectroscopy (XPS, and transmission electron microscopy (TEM. The films present a single phase of layered-structured perovskite with polar axis orient. The a/b-axis orientation of the ferroelectric film is considered to be associated with the preferred orientation of the Pt bottom electrode. XPS measurements were employed to understand the nature of defects on the retention behavior of CBTi144 films. We have observed that the main source of retention-free characteristic of the capacitors is the oxygen environment in the CBTi144 lattice.
40 CFR 144.32 - Signatories to permit applications and reports.
2010-07-01
... Class II wells (see paragraph (b) of this section), shall be signed as follows: (1) For a corporation... for the corporation, or (ii) the manager of one or more manufacturing, production, or operating... applications submitted for Class II wells under § 144.31 shall be signed by a person described in paragraph (a...
ACE Gene I/D Polymorphism and Obesity in 1,574 Patients with Type 2 Diabetes Mellitus.
Pan, Yan-Hong; Wang, Min; Huang, Yan-Mei; Wang, Ying-Hui; Chen, Yin-Ling; Geng, Li-Jun; Zhang, Xiao-Xi; Zhao, Hai-Lu
2016-01-01
Association between ACE gene I/D polymorphism and the risk of overweight/obesity remains controversial. We investigated the possible relationship between ACE gene I/D polymorphism and obesity in Chinese type 2 diabetes mellitus (T2DM) patients. In this study, obesity was defined as a body mass index (BMI) value ≥ 25 kg/m 2 and subjects were classified into 4 groups (lean, normal, overweight, and obese). PCR (polymerase chain reaction) was used to detect the ACE gene I/D polymorphism in T2DM patients. Metabolic measurements including blood glucose, lipid profile, and blood pressure were obtained. Frequencies of the ACE genotypes (DD, ID, and II) were not significant among the 4 groups of BMI-defined patients ( P = 0.679) while ACE II carriers showed higher systolic blood pressure (SBP) and pulse pressure (PP) (all P ACE gene I/D polymorphism with obesity is insignificant in Chinese patients with T2DM. SBP and PP might be higher in the ACE II carriers than in the DD and ID carriers.
DeID – A Data Sharing Tool for Neuroimaging Studies
Directory of Open Access Journals (Sweden)
Xuebo eSong
2015-09-01
Full Text Available Funding institutions and researchers increasingly expect that data will be shared to increase scientific integrity and provide other scientists with the opportunity to use the data with novel methods that may advance understanding in a particular field of study. In practice, sharing human subject data can be complicated because data must be de-identified prior to sharing. Moreover, integrating varied data types collected in a study can be challenging and time consuming. For example, sharing data from structural imaging studies of a complex disorder requires the integration of imaging, demographic and/or behavioral data in a way that no subject identifiers are included in the de-identified dataset and with new subject labels or identification values that cannot be tracked back to the original ones. We have developed a Java program that users can use to remove identifying information in neuroimaging datasets, while still maintaining the association among different data types from the same subject for further studies. This software provides a series of user interaction wizards to allow users to select data variables to be de-identified, implements functions for auditing and validation of de-identified data, and enables the user to share the de-identified data in a single compressed package through various communication protocols, such as FTPS and SFTP. DeID runs with Windows, Linux, and Mac operating systems and its open architecture allows it to be easily adapted to support a broader array of data types, with the goal of facilitating data sharing. DeID can be obtained at http://www.nitrc.org/projects/deid.
Liu, Yanhua; Wang, Xinjing; Jiang, Jing; Cao, Zhihong; Yang, Bingfen; Cheng, Xiaoxing
2011-05-01
microRNAs have a critical role in regulating innate and adaptive immunity. To understand whether microRNAs play roles in regulating immune responses to Mycobacterium tuberculosis infection in humans, microRNA expression profiling was performed in PBMCs from pulmonary tuberculosis patients and healthy controls. Analysis of expression profiles showed that expression of 30 microRNAs was significantly altered during active TB as compared with healthy controls, 28 microRNAs were up-regulated and 2 microRNAs down-regulated. miR-144* was one of the microRNAs that were overexpressed in active TB patients. Real-time RT-PCR analysis showed that miR-144* was mainly expressed in T cells. Transfection of T cells with miR-144* precursor demonstrated that miR-144* could inhibit TNF-α and IFN-γ production and T cell proliferation. It is concluded that miR-144* might involve in regulation of anti-TB immunity through modification of cytokine production and cell proliferation of T cells. Copyright © 2011 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Aeberhardt, A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1958-07-01
From the study of the means of transport of cerium in the blood of various laboratory animals, after intra-venous injection of {sup 144}Ce-{sup 144}Pr without carrier, we have been able to show up the part played by the white cells in the transport of this fission product during its passage in the blood. This observation has led to the study, in vitro, of the methods of cerium fixation on the white cells, with a view to determining the possibilities of using this property for white cell labelling, the methods used up to the present not being entirely satisfactory. Using the method for the separation of the known constituents of the blood proposed by us in 1956, we have studied the cerium fixation under various conditions: - on suspensions of white cells from the rabbit, - on a suspension of human white cells, - on the white cells in whole from the rabbit. (author) [French] L'etude du mode de transport du cerium dans le sang chez differents animaux de laboratoire, apres injection intra-veineuse de {sup 144}Ce-{sup 144}Pr sans entraineur, nous a permis de mettre en evidence le rale des globules blancs dans le transport de ce produit de fission au cours de son passage dans le sang. Cette constatation nous a conduit a etudier, in vitro, les modalites de la fixation du cerium sur les globules blancs afin de preciser les possibilites d'utilisation de cette propriete pour le marquage des globules blancs, les methodes employees jusqu'ici ne donnant pas entiere satisfaction. Disposant de la methode de separation des elements figures du sang que nous avons proposee en 1956, nous avons etudie la fixation du cerium, dans diverses conditions: - sur des suspensions de globules blancs de lapin, - sur une suspension de globules blancs humains, - sur les globules blancs dans le sang total de lapin. (auteur)
Sun, Feifei; He, Ning; Zhang, Keyong; Wu, Nan; Zhao, Jingbo; Qiu, Changchun
2018-01-01
Angiotensin converting enzyme (ACE) gene, as a strong candidate gene for essential hypertension(EH), has been extensively studied. In this study, we carried out a population-based case-control study to explore whether ACE gene I/D and A2350G polymorphisms could consider to be risk factors for EH. A total of 2040 subjeces were recruited from Chinese Han in this study, out of which 1010 were cases and 1030 were normotensive individuals. ACE gene A2350G and I/D polymorphisms were amplified by polymerase chain reaction (PCR) and A2350G polymorphism was detected after restriction enzyme digestion with BstuI. Besides, we choosed 10% samples randomly sequencing to verify the accuracy of results. Genotype and allele frequencies distribution of I/D and A2350G in EH and control groups were significantly different. After grouped by sex or age, there were still statistical significances for two polymorphisms. In dominant and recessive model of A2350G, we found significant differences between two groups, respectively. For ACE I/D polymorphism, we observed that the existence of dramatical difference in dominant model between two groups, while in recessive model, marginally significant difference was found. Among the four haplotypes composed by ACE gene A2350G and I/D, haplotype G-D reached the statistical significance in two groups, and exhibited to be a risk factor for the development of EH, whose P ACE gene A2350G and I/D polymorphisms were associated with increasing the risk of suffering from EH in the northernmost province of China individuals, with D allele and G allele individuals had a higher risk of EH(OR = 1.443, 95%CI = 1.273-1.636 and OR = 1.481, 95%CI = 1.303-1.684).
47 CFR 25.144 - Licensing provisions for the 2.3 GHz satellite digital audio radio service.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Licensing provisions for the 2.3 GHz satellite digital audio radio service. 25.144 Section 25.144 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Applications and Licenses Space Stations § 25...
ID-1 mass storage system for mainframe by using FDDI network
International Nuclear Information System (INIS)
Morita, Y.; Fujii, H.; Inoue, E.; Kodama, H. Manabe, A.; Miyamoto, A.; Nomachi, M.; Watase, Y.; Yasu, Y.
1994-01-01
The authors have developed an ID-1 mass storage system as a distributed data server for Fujitsu mainframe computers. The system consists of a SONY ID-1 recorder DIR-1000, a tape robot system DMS-24 and a SCSI-II interface DFC-1500, which are connected to Spar Station 10 with an FDDI interface. The maximum speed of 7.5 Mbytes/sec is achieved for data transfer between Sparc Station 10 memory and DIR-1000 with a buffer size of 1 Mbytes. The system has been used successfully since last October to migrate more than 1 Tbytes data
Mulmule, Manoj D.; Shimmy, Shankar M.; Bambole, Vaishali; Jamdar, Sahayog N.; Rawat, K. P.; Sarma, K. S. S.
2017-02-01
Idli, a steam-cooked breakfast food item consumed in India, is famous as a staple food for its spongy texture and unique fermented taste. Idli preparation is a time consuming process; although instant Idli pre-mixes as powder or batter are available in the market, they do not have the distinctive taste and aroma similar to the Idli prepared at home. Hence ready-to-eat (RTE) form of this food is in demand. Therefore, an attempt was made to prepare RTE Idli bearing similar taste as home-cooked Idli with an extended shelf-life of up to two months at an ambient temperature using Electron Beam Irradiation (EBI) at dosages 2.5 kGy, 5 kGy and 7.5 kGy and combination processing comprised of EBI dosage at 2.5 kGy and thermal treatment (80 °C for 20 min). The treated Idli's were microbiologically and sensorially evaluated at storage periods of zero day, 14 days, 30 days and 60 days. Idli's irradiated at 7.5 kGy and subjected to combination processing at 2.5 kGy and thermal treatment were shelf-stable for 60 days. 2.5 kGy and 5 kGy radiation dosages alone were not sufficient to preserve Idli samples for more than 14 days. Undesirable change in sensory properties of Idli was observed at an EBI dosage of 7.5 kGy. Sensory properties of combination processed Idli's were found to undergo minor change over the storage period. The present work suggests that lowest radiation dosage in combination with thermal treatment could be useful to achieve the extended shelf-life without considerably impairing the organoleptic quality of Ready-to-Eat Idli.
Directory of Open Access Journals (Sweden)
Retha Arjadi
Full Text Available Depression screening and examination in Indonesia are highly challenging due to the disproportionately low number of mental health professionals in comparison to the Indonesian population. Self-report questionnaires on depression are cost-effective and time-efficient. The current study investigates the psychometric properties of the Indonesian Inventory of Depressive Symptomatology Self Report (IDS-SR.The participants were 904 Indonesians (aged 16-61; 50.2% female, recruited via an online survey using Qualtrics. Confirmatory factor analysis of the one-factor, three-factor, and four-factor model were explored. Convergent and divergent validity of the total score of the Indonesian IDS-SR and each factor were examined, as well as the Cronbach's Alpha reliability. In addition, an optimal cut-off score for the Indonesian IDS-SR was established using ROC curve analysis.The three-factor model of "cognitive/mood", "anxiety/arousal", and "sleep disturbance" was the best fit with the Indonesian IDS-SR data. Convergent and divergent validity were good. Cronbach's Alpha reliability was excellent for the total score, good for the factors "cognitive/mood" and "anxiety/arousal", but insufficient for the factor "sleep disturbance". The optimal cut-off score of the Indonesian IDS-SR was 14, with 87% sensitivity and 86% specificity.As a multifactorial instrument to measure depression that has good validity and reliability, the Indonesian IDS-SR can be used to assess depressive symptoms for the purpose of research and clinical practice. The optimal cut-off score of the Indonesian IDS-SR is in accordance with the internationally used cut-off score.
Screening of Lactobacillus plantarum isolated from fermented idli ...
African Journals Online (AJOL)
Probiotics are defined as live microorganisms which when administered in adequate amounts confer a health benefit on the host. The objective of this study was to screen eight potential probiotic Lactobacillus plantarum strains from fermented idli batter using in vitro assays such as bile tolerance, acid tolerance, transit ...
Directory of Open Access Journals (Sweden)
Daniela Annibali
Full Text Available The transcription factor ID2 is an important repressor of neural differentiation strongly implicated in nervous system cancers. MicroRNAs (miRNAs are increasingly involved in differentiation control and cancer development. Here we show that two miRNAs upregulated on differentiation of neuroblastoma cells--miR-9 and miR-103--restrain ID2 expression by directly targeting the coding sequence and 3' untranslated region of the ID2 encoding messenger RNA, respectively. Notably, the two miRNAs show an inverse correlation with ID2 during neuroblastoma cell differentiation induced by retinoic acid. Overexpression of miR-9 and miR-103 in neuroblastoma cells reduces proliferation and promotes differentiation, as it was shown to occur upon ID2 inhibition. Conversely, an ID2 mutant that cannot be targeted by either miRNA prevents retinoic acid-induced differentiation more efficient than wild-type ID2. These findings reveal a new regulatory module involving two microRNAs upregulated during neural differentiation that directly target expression of the key differentiation inhibitor ID2, suggesting that its alteration may be involved in neural cancer development.
Desprez, Pierre-Yves; Campisi, Judith
2014-08-19
A method for treatment of breast cancer and other types of cancer. The method comprises targeting and modulating Id-1 gene expression, if any, for the Id-1 gene, or gene products in breast or other epithelial cancers in a patient by delivering products that modulate Id-1 gene expression. When expressed, Id-1 gene is a prognostic indicator that cancer cells are invasive and metastatic.
Directory of Open Access Journals (Sweden)
Chmaisse Hania
2009-01-01
Full Text Available Type-2 diabetes mellitus (T2DM is a chronic disorder characterized by a varying range of predominant insulin resistance with relative insulin deficiency, to predominant insulin secretory defect with or without insulin resistance. Familial clustering as well as epidemiological studies has shown that genetic factors play a role in the development and progression of the disease. Among the genetic factors found to be associated with development of T2DM is the angiotensin-I converting enzyme (ACE gene, which is located on chromosome 17q23. This study was conducted to study the association between ACE gene insertion/deletion (I/D polymorphism and T2DM in a Lebanese diabetic cohort. Fifty-one patients with T2DM and 40 control subjects from different parts of Lebanon underwent genotyping for the ACE I/D, which was performed by PCR using specific primers. Chi-square and analysis of variance (ANOVA were used for asso-ciation studies and to assess the differences in the values among the groups. The distribution of the genotypes in the patients was as follows: 15/51 (29.4% were homozygous for deletion allele (DD genotype, 24/51 (47.1% were heterozygous (ID genotype, and 12/51 (23.5% were homo-zygous for insertion allele (II genotype. Among the control subjects, 16/40 (40% were homo-zygous for deletion (DD genotype, 13/40 (32.5% were heterozygous (ID genotype, and 11/40 (27.5% were homozygous for insertion (II genotype. The prevalence of the D-allele in T2DM patients (52.9% was not significantly different from that in the controls (56.3%. Thus, ACE I/D dimorphism cannot be considered a risk factor for T2DM in the Lebanese population.
Zhu, Ming; Zhang, Jie; Nie, Shaofa; Yan, Weirong
2012-09-01
There have been many studies concerning the associations of angiotensin-converting enzyme (ACE) I/D, angiotensinogen (AGT) M235T polymorphisms with pregnancy induced hypertension (PIH) among Chinese populations. However, the results were inconsistent, prompting the necessity of meta-analysis. Studies published in English and Chinese were mainly searched in EMbase, PubMed and CBM up to January 2012. Twenty-three studies with 3,551 subjects for ACE I/D and seven studies with 1,296 subjects for AGT M235T were included. Significant associations were found between ACE I/D and PIH under dominant, recessive and allelic models. A separate analysis confined to preeclampsia suggested that ACE I/D was associated with preeclampsia under recessive model and allelic model, but not dominant model. Stratified analyses were conducted as meta-regression analysis indicated that the sample size of case group was a significant source of heterogeneity, which suggested no significant association between ACE I/D and PIH in the subgroup of more than 100 cases. Associations were found between AGT M235T and PIH under dominant genetic model (OR = 1.59; 95 %CI: 1.04-2.42), recessive genetic model (OR = 1.60; 95 %CI: 1.07-2.40), and allelic model (OR = 1.40; 95 %CI: 1.17-1.68). No publication bias was found in either meta-analysis. The present meta-analysis suggested significant associations between ACE I/D, AGT M235T and PIH in Chinese populations. However, no significant association was found between ACE I/D and PIH in the subgroup of more than 100 cases. Studies with larger sample sizes are necessary to investigate the associations between gene polymorphisms and PIH in Chinese populations.
Chemical synthesis and structure elucidation of bovine κ-casein (1-44)
International Nuclear Information System (INIS)
Bansal, Paramjit S.; Grieve, Paul A.; Marschke, Ronald J.; Daly, Norelle L.; McGhie, Emily; Craik, David J.; Alewood, Paul F.
2006-01-01
The caseins (α s1 , α s2 , β, and κ) are phosphoproteins present in bovine milk that have been studied for over a century and whose structures remain obscure. Here we describe the chemical synthesis and structure elucidation of the N-terminal segment (1-44) of bovine κ-casein, the protein which maintains the micellar structure of the caseins. κ-Casein (1-44) was synthesised by highly optimised Boc solid-phase peptide chemistry and characterised by mass spectrometry. Structure elucidation was carried out by circular dichroism and nuclear magnetic resonance spectroscopy. CD analysis demonstrated that the segment was ill defined in aqueous medium but in 30% trifluoroethanol it exhibited considerable helical structure. Further, NMR analysis showed the presence of a helical segment containing 26 residues which extends from Pro 8 to Arg 34 . This is First report which demonstrates extensive secondary structure within the casein class of proteins
Drug evaluation: FavId, a patient-specific idiotypic vaccine for non-Hodgkin's lymphoma.
Czech Academy of Sciences Publication Activity Database
Reiniš, Milan
2007-01-01
Roč. 9, č. 3 (2007), s. 291-298 ISSN 1464-8431 Institutional research plan: CEZ:AV0Z50520514 Keywords : non-Hodgkin's lymphoma * lymphoma vaccine FavId Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.526, year: 2007
dall'Acqua, Luisa
2011-08-01
The teleology of our research is to propose a solution to the request of "innovative, creative teaching", proposing a methodology to educate creative Students in a society characterized by multiple reference points and hyper dynamic knowledge, continuously subject to reviews and discussions. We apply a multi-prospective Instructional Design Model (PENTHA ID Model), defined and developed by our research group, which adopts a hybrid pedagogical approach, consisting of elements of didactical connectivism intertwined with aspects of social constructivism and enactivism. The contribution proposes an e-course structure and approach, applying the theoretical design principles of the above mentioned ID Model, describing methods, techniques, technologies and assessment criteria for the definition of lesson modes in an e-course.
The ubiquitin ligase ASB4 promotes trophoblast differentiation through the degradation of ID2.
Directory of Open Access Journals (Sweden)
W H Davin Townley-Tilson
Full Text Available Vascularization of the placenta is a critical developmental process that ensures fetal viability. Although the vascular health of the placenta affects both maternal and fetal well being, relatively little is known about the early stages of placental vascular development. The ubiquitin ligase Ankyrin repeat, SOCS box-containing 4 (ASB4 promotes embryonic stem cell differentiation to vascular lineages and is highly expressed early in placental development. The transcriptional regulator Inhibitor of DNA binding 2 (ID2 negatively regulates vascular differentiation during development and is a target of many ubiquitin ligases. Due to their overlapping spatiotemporal expression pattern in the placenta and contrasting effects on vascular differentiation, we investigated whether ASB4 regulates ID2 through its ligase activity in the placenta and whether this activity mediates vascular differentiation. In mouse placentas, ASB4 expression is restricted to a subset of cells that express both stem cell and endothelial markers. Placentas that lack Asb4 display immature vascular patterning and retain expression of placental progenitor markers, including ID2 expression. Using JAR placental cells, we determined that ASB4 ubiquitinates and represses ID2 expression in a proteasome-dependent fashion. Expression of ASB4 in JAR cells and primary isolated trophoblast stem cells promotes the expression of differentiation markers. In functional endothelial co-culture assays, JAR cells ectopically expressing ASB4 increased endothelial cell turnover and stabilized endothelial tube formation, both of which are hallmarks of vascular differentiation within the placenta. Co-transfection of a degradation-resistant Id2 mutant with Asb4 inhibits both differentiation and functional responses. Lastly, deletion of Asb4 in mice induces a pathology that phenocopies human pre-eclampsia, including hypertension and proteinuria in late-stage pregnant females. These results indicate that
Eisenman, Laura T.; Farley-Ripple, Elizabeth; Culnane, Mary; Freedman, Brian
2013-01-01
Social networks of persons with intellectual disabilities (ID) have been characterized as smaller and less diverse than those of typical peers. Advocates have focused on strengthening those social networks by expanding circles of social support, protection, and friendship. As young adults with ID experience increasing levels of community…
2013-01-04
... Services Group, Inc., Commercial/Actuarial/ Information Delivery Services (IDS)/Corporate & Financial... Assistance (TAA) applicable to workers and former workers of Hartford Financial Services Group, Inc., Commercial/ Actuarial/Information Delivery Services (IDS)/Corporate & Financial Reporting group, Hartford...
Ko, Jupil; Rosen, Adam B; Brown, Cathleen N
2017-09-12
To cross-culturally adapt the Identification Functional Ankle Instability for use with Korean-speaking participants. The English version of the IdFAI was cross-culturally adapted into Korean based on the guidelines. The psychometric properties in the Korean version of the IdFAI were measured for test-retest reliability, internal consistency, criterion-related validity, discriminative validity, and measurement error 181 native Korean-speakers. Intra-class correlation coefficients (ICC 2,1 ) between the English and Korean versions of the IdFAI for test-retest reliability was 0.98 (standard error of measurement = 1.41). The Cronbach's alpha coefficient was 0.89 for the Korean versions of IdFAI. The Korean versions of the IdFAI had a strong correlation with the SF-36 (r s = -0.69, p 10 was the optimal cutoff score to distinguish between the group memberships. The minimally detectable change of the Korean versions of the IdFAI score was 3.91. The Korean versions of the IdFAI have shown to be an excellent, reliable, and valid instrument. The Korean versions of the IdFAI can be utilized to assess the presence of Chronic Ankle Instability by researchers and clinicians working among Korean-speaking populations. Implications for rehabilitation The high recurrence rate of sprains may result into Chronic Ankle Instability (CAI). The Identification of Functional Ankle Instability Tool (IdFAI) has been validated and recommended to identify patients with Chronic Ankle Instability (CAI). The Korean version of the Identification of Functional Ankle Instability Tool (IdFAI) may be also recommend to researchers and clinicians for assessing the presence of Chronic Ankle Instability (CAI) in Korean-speaking population.
Le traitement de l’idéologie dans la sociologie de Luc Boltanski
Directory of Open Access Journals (Sweden)
David Vrydaghs
2006-10-01
Full Text Available IntroductionLe concept d’idéologie apparaît dans la sociologie de Luc Boltanski à partir du Nouvel Esprit du capitalisme, publié en 1999. L’auteur y revient dans La Condition fœtale, paru en 2004. On aurait donc pu se contenter de ces ouvrages pour examiner le traitement réservé à l’idéologie dans la sociologie de Luc Boltanski. On préférera pourtant revenir aux travaux antérieurs du sociologue, et ce pour deux raisons.D’abord parce que le concept d’idéologie tel qu’il est employé dans Le Nou...
Evaluation of the Micro-ID system for the identification of Yersinia pestis.
Harrison, D N; Williams, J E
1985-01-01
One hundred isolates of Yersinia pestis identified by conventional means were tested by the Micro-ID system to assess its reliability for distinguishing Y. pestis from other members of the family Enterobacteriaceae. The Micro-ID system gave Y. pestis as a choice for the identification of 89 of these cultures, although not always as the first choice. Most nitrate-negative strains of Y. pestis keyed out with Yersinia pseudotuberculosis as first choice and Y. pestis as second or fourth choice.
Group-ID based RFID Mutual Authentication
Directory of Open Access Journals (Sweden)
LEE, Y.
2013-11-01
Full Text Available For passive type RFID tags, EPCglobal Class 1 Generation-2 Revision is used widely as a de facto standard. As it was designed for low cost, it is quite vulnerable to security issues, such as privacy concerns. This paper presents a new RFID mutual authentication protocol, which is designed to be configured on EPC Gen2 platform and to meet various security requirements while providing efficiency using PRNG (Pseudo Random Number Generator. Group-ID is used to minimize the authentication time. Security analysis of the proposed protocol is discussed.
Kim, Jin Kyung; Lee, Hye-Mi; Park, Ki-Sun; Shin, Dong-Min; Kim, Tae Sung; Kim, Yi Sak; Suh, Hyun-Woo; Kim, Soo Yeon; Kim, In Soo; Kim, Jin-Man; Son, Ji-Woong; Sohn, Kyung Mok; Jung, Sung Soo; Chung, Chaeuk; Han, Sang-Bae; Yang, Chul-Su; Jo, Eun-Kyeong
2017-02-01
Autophagy is an important antimicrobial effector process that defends against Mycobacterium tuberculosis (Mtb), the human pathogen causing tuberculosis (TB). MicroRNAs (miRNAs), endogenous noncoding RNAs, are involved in various biological functions and act as post-transcriptional regulators to target mRNAs. The process by which miRNAs affect antibacterial autophagy and host defense mechanisms against Mtb infections in human monocytes and macrophages is largely uncharacterized. In this study, we show that Mtb significantly induces the expression of MIR144*/hsa-miR-144-5p, which targets the 3'-untranslated region of DRAM2 (DNA damage regulated autophagy modulator 2) in human monocytes and macrophages. Mtb infection downregulated, whereas the autophagy activators upregulated, DRAM2 expression in human monocytes and macrophages by activating AMP-activated protein kinase. In addition, overexpression of MIR144* decreased DRAM2 expression and formation of autophagosomes in human monocytes, whereas inhibition of MIR144* had the opposite effect. Moreover, the levels of MIR144* were elevated, whereas DRAM2 levels were reduced, in human peripheral blood cells and tissues in TB patients, indicating the clinical significance of MIR144* and DRAM2 in human TB. Notably, DRAM2 interacted with BECN1 and UVRAG, essential components of the autophagic machinery, leading to displacement of RUBCN from the BECN1 complex and enhancement of Ptdlns3K activity. Furthermore, MIR144* and DRAM2 were critically involved in phagosomal maturation and enhanced antimicrobial effects against Mtb. Our findings identify a previously unrecognized role of human MIR144* in the inhibition of antibacterial autophagy and the innate host immune response to Mtb. Additionally, these data reveal that DRAM2 is a key coordinator of autophagy activation that enhances antimicrobial activity against Mtb.
25 CFR 170.144 - What are eligible highway safety projects?
2010-04-01
... RESERVATION ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Highway Safety Functions... management system; (g) Education and outreach highway safety programs, such as use of child safety seats... 25 Indians 1 2010-04-01 2010-04-01 false What are eligible highway safety projects? 170.144...
MicroRNA-Mediated Rescue of Fear Extinction Memory by miR-144-3p in Extinction-Impaired Mice.
Murphy, Conor P; Li, Xiang; Maurer, Verena; Oberhauser, Michael; Gstir, Ronald; Wearick-Silva, Luis Eduardo; Viola, Thiago Wendt; Schafferer, Simon; Grassi-Oliveira, Rodrigo; Whittle, Nigel; Hüttenhofer, Alexander; Bredy, Timothy W; Singewald, Nicolas
2017-06-15
MicroRNA (miRNA)-mediated control of gene expression suggests that miRNAs are interesting targets and/or biomarkers in the treatment of anxiety- and trauma-related disorders, where often memory-associated gene expression is adversely affected. The role of miRNAs in the rescue of impaired fear extinction was assessed using the 129S1/SvlmJ (S1) mouse model of impaired fear extinction. miRNA microarray analysis, reverse transcription polymerase chain reaction, fluorescent in situ hybridization, lentiviral overexpression, and Luciferase reporter assays were used to gain insight into the mechanisms underlying miRNA-mediated normalization of deficient fear extinction. Rescuing impaired fear extinction via dietary zinc restriction was associated with differential expression of miRNAs in the amygdala. One candidate, miR-144-3p, robustly expressed in the basolateral amygdala, showed specific extinction-induced, but not fear-induced, increased expression in both extinction-rescued S1 mice and extinction-intact C57BL/6 (BL6) mice. miR-144-3p upregulation and effects on subsequent behavioral adaption was assessed in S1 and BL6 mice. miR-144-3p overexpression in the basolateral amygdala rescued impaired fear extinction in S1 mice, led to enhanced fear extinction acquisition in BL6 mice, and furthermore protected against fear renewal in BL6 mice. miR-144-3p targets a number of genes implicated in the control of plasticity-associated signaling cascades, including Pten, Spred1, and Notch1. In functional interaction studies, we revealed that the miR-144-3p target, PTEN, colocalized with miR-144-3p in the basolateral amygdala and showed functional downregulation following successful fear extinction in S1 mice. These findings identify a fundamental role of miR-144-3p in the rescue of impaired fear extinction and suggest this miRNA as a viable target in developing novel treatments for posttraumatic stress disorder and related disorders. Copyright © 2017 Society of Biological
Nd:YAG 1.44 laser ablation of human cartilage
Cummings, Robert S.; Prodoehl, John A.; Rhodes, Anthony L.; Black, Johnathan D.; Sherk, Henry H.
1993-07-01
This study determined the effectiveness of a Neodymium:YAG 1.44 micrometers wavelength laser on human cartilage. This wavelength is strongly absorbed by water. Cadaveric meniscal fibrocartilage and articular hyaline cartilage were harvested and placed in normal saline during the study. A 600 micrometers quartz fiber was applied perpendicularly to the tissues with a force of 0.098 N. Quantitative measurements were then made of the ablation rate as a function of fluence. The laser energy was delivered at a constant repetition rate of 5 Hz., 650 microsecond(s) pulsewidth, and energy levels ranging from 0.5 joules to 2.0 joules. Following the ablation of the tissue, the specimens were fixed in formalin for histologic evaluation. The results of the study indicate that the ablation rate is 0.03 mm/mj/mm2 for hyaline cartilage and fibrocartilage. Fibrocartilage was cut at approximately the same rate as hyaline cartilage. There was a threshold fluence projected to be 987 mj/mm2 for hyaline cartilage and fibrocartilage. Our results indicate that the pulsed Nd:YAG laser operating at 1.44 micrometers has a threshold fluence above which it will ablate human cartilage, and that its ablation rate is directly proportional to fluence over the range of parameters tested. Fibrocartilage and hyaline cartilage demonstrated similar threshold fluence and ablation rates which is related to the high water content of these tissues.
Angiotensin-I converting enzyme gene and I/D polymorphism ...
Indian Academy of Sciences (India)
Angiotensin-I converting enzyme gene and I/D polymorphism distribution in the Greek population and a comparison with other European populations. Sekerli Eleni Katsanidis Dimitrios Papadopoulou Vaya Makedou Areti Vavatsi Norma Gatzola Magdalini. Research Note Volume 87 Issue 1 April 2008 pp 91-93 ...
Development of the PARA-ID Program to Simulate a Unified Viscoplasticity Behaviour
International Nuclear Information System (INIS)
Koo, Gyeong Hoi
2009-01-01
The PARA-ID code is a general purpose computer simulation program for a nonlinear cyclic material behavior with and without viscous effects, which can simulate various constitutive models such as - Prager Model - Armstrong and Frederick Model - Chaboche 3-decomposed rule Model - Chaboche 4-decomposed rule Model - Ohno and Wang Model - Unified Chaboche Viscoplastic Model In this paper, the unified Chaboche viscoplasticity model is investigated with some examples of application for a cyclic hardening material of 316L
Rodriguez Viales, Rebecca; Diotel, Nicolas; Ferg, Marco; Armant, Olivier; Eich, Julia; Alunni, Alessandro; März, Martin; Bally-Cuif, Laure; Rastegar, Sepand; Strähle, Uwe
2015-03-01
The teleost brain has the remarkable ability to generate new neurons and to repair injuries during adult life stages. Maintaining life-long neurogenesis requires careful management of neural stem cell pools. In a genome-wide expression screen for transcription regulators, the id1 gene, encoding a negative regulator of E-proteins, was found to be upregulated in response to injury. id1 expression was mapped to quiescent type I neural stem cells in the adult telencephalic stem cell niche. Gain and loss of id1 function in vivo demonstrated that Id1 promotes stem cell quiescence. The increased id1 expression observed in neural stem cells in response to injury appeared independent of inflammatory signals, suggesting multiple antagonistic pathways in the regulation of reactive neurogenesis. Together, we propose that Id1 acts to maintain the neural stem cell pool by counteracting neurogenesis-promoting signals. © 2014 AlphaMed Press.
Enhancing privacy of users in eID schemes
Shrishak, Kris; Erkin, Z.; Schaar, Remco
2016-01-01
In todays world transactions are increasingly being performed over the internetbut require identication of users as in face-to-face transactions. In order to facilitate eGovernance as well as other eCommerce services Electronic Identiation(eID) schemes, which intend to provide unique and reliable
Revocable ID-Based Signature with Short Size over Lattices
Directory of Open Access Journals (Sweden)
Ying-Hao Hung
2017-01-01
Full Text Available In the past, many ID-based signature (IBS schemes based on the integer factorization or discrete logarithm problems were proposed. With the progress on the development of quantum technology, IBS schemes mentioned above would become vulnerable. Recently, several IBS schemes over lattices were proposed to be secure against attacks in the quantum era. As conventional public-key settings, ID-based public-key settings have to offer a revocation mechanism to revoke misbehaving or malicious users. However, in the past, little work focuses on the revocation problem in the IBS schemes over lattices. In this article, we propose a new revocable IBS (RIBS scheme with short size over lattices. Based on the short integer solution (SIS assumption, we prove that the proposed RIBS scheme provides existential unforgeability against adaptive chosen-message attacks. As compared to the existing IBS schemes over lattices, our RIBS scheme has better performance in terms of signature size, signing key size, and the revocation mechanism with public channels.
Oberste, M S; Weaver, S C; Watts, D M; Smith, J F
1998-01-01
Venezuelan equine encephalitis (VEE) virus was isolated in 1993, 1994, and 1995 from human cases of acute, undifferentiated, febrile illness in the Peruvian Amazon Basin. Two virus isolates were recovered in 1994 from Peruvian soldiers at a jungle outpost near Pantoja in northern Peru, and 10 isolates were obtained from military personnel and civilians in 1993-1995 in Iquitos, an urban center in northeastern Peru. The genetic relationship of these isolates to other VEE virus strains was determined by sequencing 856-867 nucleotide reverse transcription-polymerase chain reaction fragments derived from the PE2 glycoprotein gene. The sequences were compared with those of other VEE virus strains, including representatives of the IAB, IC, ID, IE, II, and IIIC subtypes. The two Pantoja isolates were most closely related to subtype IC and ID viruses previously isolated in Colombia and Venezuela, and to the ID viruses isolated during the 1970s in Iquitos. All of the recent Iquitos isolates were similar to one another, but they were more closely related to Panamanian ID strains than to isolates previously obtained in Iquitos, Peru, or in Colombia and Venezuela. The recent Iquitos VEE viral isolates were the first Panama-genotype VEE ID virus strains identified outside of the Republic of Panama.
DEFF Research Database (Denmark)
Gibbs-Seymour, Ian; Oka, Yasuyoshi; Rajendra, Eeson
2015-01-01
We show that central components of the Fanconi anemia (FA) DNA repair pathway, the tumor suppressor proteins FANCI and FANCD2 (the ID complex), are SUMOylated in response to replication fork stalling. The ID complex is SUMOylated in a manner that depends on the ATR kinase, the FA ubiquitin ligase...
Behaviour of 144Gd at very high angular momentum. Study of the continuum
International Nuclear Information System (INIS)
Nourreddine, A.
1984-01-01
The specific physical concepts that dictated the choice of 144 Gd for the present high spin study are presented in the first part of this work. The second part describes the various formalisms and techniques used to extract the multiplicities, multipolarities and moments of inertia from continuous γ ray spectra. The third part relates the results of the quasi-continuum γ ray of 144 Gd formed in the fusion-evaporation reaction 120 Sn( 28 Si, 4nγ) with four bombarding energies. A detailed balance of energy and angular momentum of the compound nucleus desexcitation has been given. Finally the evolution of the nuclear shape as a function of spin has been determined from the experimental data and interpreted by a combined micro and macroscopic theoretical calculations using a Woods-Saxon potential [fr
Identification of clinical yeasts by Vitek MS system compared with API ID 32 C.
Durán-Valle, M Teresa; Sanz-Rodríguez, Nuria; Muñoz-Paraíso, Carmen; Almagro-Moltó, María; Gómez-Garcés, José Luis
2014-05-01
We performed a clinical evaluation of the Vitek MS matrix-assisted laser desorption ionization-time-of-flight mass spectrometry (MALDI-TOF MS) system with the commercial database version 2.0 for rapid identification of medically important yeasts as compared with the conventional phenotypic method API ID 32 C. We tested 161 clinical isolates, nine isolates from culture collections and five reference strains. In case of discrepant results or no identification with one or both methods, molecular identification techniques were employed. Concordance between both methods was observed with 160/175 isolates (91.42%) and misidentifications by both systems occurred only when taxa were not included in the respective databases, i.e., one isolate of Candida etchellsii was identified as C. globosa by Vitek MS and two isolates of C. orthopsilosis were identified as C. parapsilosis by API ID 32 C. Vitek MS could not identify nine strains (5.14%) and API ID 32 C did not identify 13 (7.42%). Vitek MS was more reliable than API ID 32 C and reduced the time required for the identification of clinical isolates to only a few minutes.
Pugliese, Cara E.; Kenworthy, Lauren; Bal, Vanessa Hus; Wallace, Gregory L.; Yerys, Benjamin E.; Maddox, Brenna B.; White, Susan W.; Popal, Haroon; Armour, Anna Chelsea; Miller, Judith; Herrington, John D.; Schultz, Robert T.; Martin, Alex; Anthony, Laura Gutermuth
2015-01-01
Recent updates have been proposed to the Autism Diagnostic Observation Schedule-2 Module 4 diagnostic algorithm. This new algorithm, however, has not yet been validated in an independent sample without intellectual disability (ID). This multi-site study compared the original and revised algorithms in individuals with ASD without ID. The revised…
The Danish eID Case: Twenty years of Delay
DEFF Research Database (Denmark)
Hoff, Jens Villiam; Hoff, Frederik Villiam
2010-01-01
the technological, organizational and legal dimensions of eID in Denmark, and comparing these with a number of other European countries made it possible to explain this paradox. Thus, the three main reasons for the special route development has taken in Denmark seems to be concerns over privacy, lack...
Quantitative measurement of XLR11 and UR-144 in oral fluid by LC-MS-MS.
Amaratunga, Piyadarsha; Thomas, Christopher; Lemberg, Bridget Lorenz; Lemberg, Dave
2014-01-01
Availability and consumption of synthetic cannabinoids have risen recently in the USA and Europe. These drugs have adverse effects, including acute psychosis and bizarre behavior. In 2012, the United States Drug Enforcement Agency permanently banned five of the synthetic cannabinoids and in 2013, temporarily added XLR11, UR-144 and AKB48 to Schedule I of the Controlled Substances Act. As synthetic cannabinoid strains are added to the Schedule I list, new strains are being introduced into the market. XLR11 and UR-144 are two of the most recent additions to the synthetic cannabinoid drug class. To test collected oral fluid samples for XLR11 and UR-144, we developed a bioanalytical method that initially purifies the sample with solid-phase extraction and then quantitatively identifies the drugs with ultra-high-performance liquid chromatography-tandem mass spectrometry. The method was validated according to United States Food and Drug Administration guidelines and Scientific Working Group for Forensic Toxicology guidelines and the validation data showed that the method is an accurate, precise, robust and efficient method suited for high-throughput toxicological screening applications. We tested human subject samples with the developed method and found the presence of parent drugs (XLR11 and UR-144), their metabolites and their pyrolysis products in oral fluid. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Large angular momentum shape transitions in 144Gd and 152Dy
International Nuclear Information System (INIS)
Nourreddine, A.
1986-09-01
In this work dealing principally with superdeformed states of nuclear matter, it has been shown that nuclei like 144 64 Gd 80 and 152 66 Dy 86 situated near the closed shells Z = 64 and N = 82 exhibit low spin (I [fr
Towards fraud-proof ID documents using multiple data hiding technologies and biometrics
Picard, Justin; Vielhauer, Claus; Thorwirth, Niels
2004-06-01
Identity documents, such as ID cards, passports, and driver's licenses, contain textual information, a portrait of the legitimate holder, and eventually some other biometric characteristics such as a fingerprint or handwritten signature. As prices for digital imaging technologies fall, making them more widely available, we have seen an exponential increase in the ease and the number of counterfeiters that can effectively forge documents. Today, with only limited knowledge of technology and a small amount of money, a counterfeiter can effortlessly replace a photo or modify identity information on a legitimate document to the extent that it is very diffcult to differentiate from the original. This paper proposes a virtually fraud-proof ID document based on a combination of three different data hiding technologies: digital watermarking, 2-D bar codes, and Copy Detection Pattern, plus additional biometric protection. As will be shown, that combination of data hiding technologies protects the document against any forgery, in principle without any requirement for other security features. To prevent a genuine document to be used by an illegitimate user,biometric information is also covertly stored in the ID document, to be used for identification at the detector.
Pugliese, Cara E.; Kenworthy, Lauren; Bal, Vanessa Hus; Wallace, Gregory L; Yerys, Benjamin E; Maddox, Brenna B.; White, Susan W.; Popal, Haroon; Armour, Anna Chelsea; Miller, Judith; Herrington, John D.; Schultz, Robert T.; Martin, Alex; Anthony, Laura Gutermuth
2015-01-01
Recent updates have been proposed to the Autism Diagnostic Observation Schedule-2 Module 4 diagnostic algorithm. This new algorithm, however, has not yet been validated in an independent sample without intellectual disability (ID). This multi-site study compared the original and revised algorithms in individuals with ASD without ID. The revised algorithm demonstrated increased sensitivity, but lower specificity in the overall sample. Estimates were highest for females, individuals with a verb...
Chen, B; Han, B H; Sun, X H; Lim, R W
1997-01-15
We have examined the role of an Id-like protein, Id3 (also known as HLH462), in the regulation of muscle-specific gene expression. Id proteins are believed to block expression of muscle-specific genes by preventing the dimerization between ubiquitous bHLH proteins (E proteins) and myogenic bHLH proteins such as MyoD. Consistent with its putative role as an inhibitor of differentiation, Id3 mRNA was detected in proliferating skeletal muscle cells, was further induced by basic fibroblast growth factor (bFGF) and was down-regulated in differentiated muscle cultures. Overexpression of Id3 efficiently inhibited the MyoD-mediated activation of the muscle-specific creatine kinase (MCK) reporter gene. Deletion analysis indicated that the C-terminal 15 amino acids of Id3 are critical for the full inhibitory activity while deleting up to 42 residues from the C-terminus of the related protein, Id2, did not affect its ability to inhibit the MCK reporter gene. Chimeric protein containing the N-terminal region of Id3 and the C-terminus of Id2 was also non-functional in transfected cells. In contrast, wild-type Id3, the C-terminal mutants, and the Id3/Id2 chimera could all interact with the E-protein E47in vitro. Additional studies indicated that truncation of the Id3 C-terminus might have adversely affected the expression level of the mutant proteins but the Id3/Id2 chimera was stably expressed. Taken together, our results revealed a more complex requirement for the expression and proper function of the Id family proteins than was hitherto expected.
Evaluation of n + 144,148,154Sm reaction data
International Nuclear Information System (INIS)
Ming Jianchuan; Zhuang Youxiang
2000-01-01
The neutron cross section data were evaluated for n + 144,148,154 Sm reaction in the energy range 10 -5 eV to 20 MeV. Spline function was used in the experimental data fit calculation. The corresponding JENDL-3 data are accepted in the energy range of 0.025 to 100 Kev. The comparisons among calculation data and experimental data, JENDL-3 data ENDF/B-6 data are presented
Energy Technology Data Exchange (ETDEWEB)
Liu, Chen; Jin, Rong [Department of Immunology, Peking University Health Science Center, Beijing (China); Wang, Hong-Cheng [Oklahoma Medical Research Foundation, Oklahoma City, OK (United States); Tang, Hui; Liu, Yuan-Feng; Qian, Xiao-Ping; Sun, Xiu-Yuan; Ge, Qing [Department of Immunology, Peking University Health Science Center, Beijing (China); Sun, Xiao-Hong, E-mail: sunx@omrf.org [Oklahoma Medical Research Foundation, Oklahoma City, OK (United States); Zhang, Yu, E-mail: zhangyu007@bjmu.edu.cn [Department of Immunology, Peking University Health Science Center, Beijing (China)
2013-06-21
Highlights: •Id1 expression enables naïve T cell proliferation without anti-CD28 co-stimulation. •Id1 expression facilitates T cells survival when stimulated with anti-CD3. •Elevation of IL-2 production by Id1 contributes increased proliferation and survival. •Id1 potentiates NF-κB activation by anti-CD3 stimulation. -- Abstract: Although the role of E proteins in the thymocyte development is well documented, much less is known about their function in peripheral T cells. Here we demonstrated that CD4 promoter-driven transgenic expression of Id1, a naturally occurring dominant-negative inhibitor of E proteins, can substitute for the co-stimulatory signal delivered by CD28 to facilitate the proliferation and survival of naïve CD4{sup +} cells upon anti-CD3 stimulation. We next discovered that IL-2 production and NF-κB activity after anti-CD3 stimulation were significantly elevated in Id1-expressing cells, which may be, at least in part, responsible for the augmentation of their proliferation and survival. Taken together, results from this study suggest an important role of E and Id proteins in peripheral T cell activation. The ability of Id proteins to by-pass co-stimulatory signals to enable T cell activation has significant implications in regulating T cell immunity.
The development and psychometric evaluation of the Internet Disorder Scale (IDS-15).
Pontes, Halley M; Griffiths, Mark D
2017-01-01
Previously published research suggests that improvement in the assessment of Internet addiction (IA) is paramount in advancing the field. However, little has been done to address inconsistencies in the assessment of IA using a more updated framework. The aim of the present study was to develop a new instrument to assess IA based on a modification of the nine Internet Gaming Disorder (IGD) criteria as suggested by the American Psychiatric Association in the latest (fifth) edition of the Diagnostic and Statistical Manual of Mental Disorders (DSM-5), and to provide a taxonomy of the potential risk of IA risk among participants. A heterogeneous sample of Internet users (n=1105) was recruited online (61.3% males, mean age 33years). Construct validity of the new instrument - Internet Disorder Scale (IDS-15) - was assessed by means of factorial, convergent, and discriminant validity. Criterion-related validity and reliability were also investigated. Additionally, latent profile analysis (LPA) was carried out to differentiate and characterize Internet users based on their potential IA risk. The construct and criterion-related validity of the IDS-15 were both warranted. The IDS-15 proved to be a valid and reliable tool. Using the LPA, participants were classed as "low addiction risk" (n=183, 18.2%), "medium addiction risk" (n=456, 41.1%), and "high addiction risk" (n=455, 40.77%). Furthermore, key differences emerged among these classes in terms of age, relationship status, cigarette consumption, weekly Internet usage, age of Internet use initiation, and IDS-15 total scores. The present findings support the viability of using adapted IGD criteria as a framework to assess IA. Copyright © 2015 Elsevier Ltd. All rights reserved.
Peters, Bradley J.; Carlson, Richard W.; Day, James M. D.; Horan, Mary F.
2018-03-01
Active volcanic hotspots can tap into domains in Earth’s deep interior that were formed more than two billion years ago. High-precision data on variability in tungsten isotopes have shown that some of these domains resulted from differentiation events that occurred within the first fifty million years of Earth history. However, it has not proved easy to resolve analogous variability in neodymium isotope compositions that would track regions of Earth’s interior whose composition was established by events occurring within roughly the first five hundred million years of Earth history. Here we report 142Nd/144Nd ratios for Réunion Island igneous rocks, some of which are resolvably either higher or lower than the ratios in modern upper-mantle domains. We also find that Réunion 142Nd/144Nd ratios correlate with helium-isotope ratios (3He/4He), suggesting parallel behaviour of these isotopic systems during very early silicate differentiation, perhaps as early as 4.39 billion years ago. The range of 142Nd/144Nd ratios in Réunion basalts is inconsistent with a single-stage differentiation process, and instead requires mixing of a conjugate melt and residue formed in at least one melting event during the Hadean eon, 4.56 billion to 4 billion years ago. Efficient post-Hadean mixing nearly erased the ancient, anomalous 142Nd/144Nd signatures, and produced the relatively homogeneous 143Nd/144Nd composition that is characteristic of Réunion basalts. Our results show that Réunion magmas tap into a particularly ancient, primitive source compared with other volcanic hotspots, offering insight into the formation and preservation of ancient heterogeneities in Earth’s interior.
ACE I/D polymorphism in Indian patients with hypertrophic cardiomyopathy and dilated cardiomyopathy
DEFF Research Database (Denmark)
Rai, Taranjit Singh; Dhandapany, Perundurai Subramaniam; Ahluwalia, Tarun Veer Singh
2008-01-01
The study was carried to determine the association of angiotensin converting enzyme (ACE) insertion/deletion (I/D) polymorphism with the risk of hypertrophic cardiomyopathy (HCM), dilated cardiomyopathy (DCM), and restrictive cardiomyopathy (RCM).......The study was carried to determine the association of angiotensin converting enzyme (ACE) insertion/deletion (I/D) polymorphism with the risk of hypertrophic cardiomyopathy (HCM), dilated cardiomyopathy (DCM), and restrictive cardiomyopathy (RCM)....
Assessment of the relationship between ACE I/D gene polymorphism and renal allograft survival.
Yang, Chun-Hua; Lu, Yi; Chen, Xue-Xia; Xian, Wen-Feng; Tu, Wei-Feng; Li, Hong-Yan
2015-12-01
The relationship between the angiotensin-converting enzyme (ACE) insertion/deletion (I/D) gene polymorphism and renal allograft survival after renal transplantation from the published reports are still debatable. This study was performed to evaluate the relationship between the ACE I/D gene polymorphism and renal allograft survival after renal transplantation using meta-analysis. Eligible studies were identified from PubMed and Cochrane Library on 1 November 2014, and eligible studies were recruited and synthesized using a meta-analysis methodology. Twelve investigations were included in this meta-analysis for the assessment of the relationship between the ACE I/D gene polymorphism and renal allograft survival. In this meta-analysis, the ACE I/D gene polymorphism was not associated with renal allograft survival after renal transplantation for overall populations, Caucasians, Brazilians and Africans. Interestingly, the ACE D allele and DD genotype were associated with renal allograft survival after renal transplantation in the Asian population. ACE D allele and DD genotype were associated with renal allograft survival after renal transplantation in the Asian population. However, more studies should be performed to confirm this association. © The Author(s) 2015.
Olszowski, Tomasz; Adler, Grażyna; Janiszewska-Olszowska, Joanna; Safranow, Krzysztof; Chlubek, Dariusz
2015-01-01
The aim of the study was to examine the frequencies of the genotypes and alleles of ACE insertion/deletion (I/D) polymorphism and their association with dental caries in a sample of Polish children. The study subjects were 120 children with dental caries experience (cases) and 41 caries-free individuals (controls). The genotyping was performed using polymerase chain reaction. The genotype distributions of ACE I/D polymorphism were not statistically different between carious and control children. However, we found a borderline overrepresentation of the II + ID genotypes versus the DD genotype in the carious compared to the control group (69.2% and 51.2%, respectively, p = 0.057). Logistic regression analysis adjusted for age and sex revealed that I allele carriage was a significant predictor of dental caries susceptibility (OR = 2.14, 95% CI = 1.02-4.49, p = 0.041). In conclusion, the DD genotype of ACE I/D polymorphism might be protective against dental caries in Polish children. © 2015 S. Karger AG, Basel.
Secure OpenID Authentication Model by Using Trusted Computing
Directory of Open Access Journals (Sweden)
E. Ghazizadeh
2014-01-01
Full Text Available The growth of Internet online services has been very quick in recent years. Each online service requires Internet users to create a new account to use the service. The problem can be seen when each user usually needs more than one service and, consequently, has numerous accounts. These numerous accounts have to be managed in a secure and simple way to be protected against identity theft. Single sign-on (SSO and OpenID have been used to decrease the complexity of managing numerous accounts required in the Internet identity environment. Trusted Platform Module (TPM and Trust Multitenancy are great trusted computing-based technologies to solve security concerns in the Internet identity environment. Since trust is one of the pillars of security in the cloud, this paper analyzes the existing cloud identity techniques in order to investigate their strengths and weaknesses. This paper proposes a model in which One Time Password (OTP, TPM, and OpenID are used to provide a solution against phishing as a common identity theft in cloud environment.
Time-and-ID-Based Proxy Reencryption Scheme
Mtonga, Kambombo; Paul, Anand; Rho, Seungmin
2014-01-01
Time- and ID-based proxy reencryption scheme is proposed in this paper in which a type-based proxy reencryption enables the delegator to implement fine-grained policies with one key pair without any additional trust on the proxy. However, in some applications, the time within which the data was sampled or collected is very critical. In such applications, for example, healthcare and criminal investigations, the delegatee may be interested in only some of the messages with some types sampled wi...
Radikal konservativ idédebat og højreautoritær fascination i Danmark, ca. 1928-1940
DEFF Research Database (Denmark)
Holm, Adam
1999-01-01
Historie, Højreradikalisme, Konservatisme, Fascisme, Mellemkrigstid, Idéhistorie, Intellektuelle......Historie, Højreradikalisme, Konservatisme, Fascisme, Mellemkrigstid, Idéhistorie, Intellektuelle...
Application of game theory for the interpretation of inventory differences (ID)
International Nuclear Information System (INIS)
Moglewer, S.
1978-01-01
In a study performed by the Test and Evaluation Branch, Division of Safeguards, at the U.S. Nuclear Regulatory Commission with contract assistance from Lawrence Berkeley Laboratory, the validity of the ID concept for estabilishing assurance concerning possible unauthorized diversion of SNM was examined. The evaluation methodology was based upon the theory of games and produced results that were quite different from those derived by classical statistical hypothesis testing. A model was developed based upon a decision maker's utilities and solved for generic facilities. Based upon the value of ID, obtained from each inventory, and specific for each facility, there is a best policy for estimating unauthorized deliberate diversion and establishing action limits (alarm thresholds). This paper presents the results of this study as applied to a generic facility
Directory of Open Access Journals (Sweden)
Gutmann Anja
2010-01-01
Full Text Available Abstract Background ID proteins are dominant negative inhibitors of basic helix-loop-helix transcription factors that have multiple functions during development and cellular differentiation. Ectopic (over-expression of ID1 extends the lifespan of primary human epithelial cells. High expression levels of ID1 have been detected in multiple human malignancies, and in some have been correlated with unfavorable clinical prognosis. ID1 protein is localized at the centrosomes and forced (over-expression of ID1 results in errors during centrosome duplication. Results Here we analyzed the steady state expression levels of the four ID-proteins in 18 tumor cell lines and assessed the number of centrosome abnormalities. While expression of ID1, ID2, and ID3 was detected, we failed to detect protein expression of ID4. Expression of ID1 correlated with increased supernumerary centrosomes in most cell lines analyzed. Conclusions This is the first report that shows that not only ectopic expression in tissue culture but endogenous levels of ID1 modulate centrosome numbers. Thus, our findings support the hypothesis that ID1 interferes with centrosome homeostasis, most likely contributing to genomic instability and associated tumor aggressiveness.
Martin, Lynn; Hirdes, John P.; Fries, Brant E.; Smith, Trevor F.
2007-01-01
This paper describes the development of the interRAI-Intellectual Disability (interRAI ID), a comprehensive instrument that assesses all key domains of interest to service providers relative to a person with an intellectual disability (ID). The authors report on the reliability and validity of embedded scales for cognition, self-care, aggression,…
International Nuclear Information System (INIS)
Zhao, Po; Lu, Yali; Liu, Lin; Zhong, Mei
2008-01-01
The relationships between the expression of ID2, EBV-LMP1 and P16(INK4A) in Chinese classical Hodgkin lymphoma are unknown and need exploring. Samples of classical Hodgkin lymphoma from 60 Chinese patients were analyzed for the expression of ID2, EBV-LMP1 and p16(INK4A) proteins by immunohistochemistry. ID2 protein was expressed in 83.3% of this group of classical Hodgkin lymphoma, staining strongly in both cytoplasm and nucleus of the Hodgkin and Reed-Sternberg (HRS) cells. EBV-LMP1 and P16(INK4A) were overexpressed in 85.0% and 71.7% of Hodgkin lymphoma, respectively. EBV-LMP1 was noted in the cytoplasm, membrane and nucleus of HRS cells; P16(INK4A) was in the nucleus and cytoplasm. Microscopically, ID2, EBV-LMP1 and P16(INK4A) staining distinguished the HRS cells from the complex background of lymphocytes. ID2 was positively correlated with EBV-LMP1(P < 0.01), but P16(INK4A) was inversely related to EBV-LMP1 (P < 0.05). It is suggested that ID2, EBV-LMP1 and P16(INK4A) could play an important role in the evolution of classical Hodgkin lymphoma, and be considered as potential adjunct markers to identify HRS cells in diagnosis
Cyr61/CCN1 displays high-affinity binding to the somatomedin B(1-44 domain of vitronectin.
Directory of Open Access Journals (Sweden)
Ivo M B Francischetti
2010-02-01
Full Text Available Cyr61 is a member of the CCN (Cyr61, connective tissue growth, NOV family of extracellular-associated (matricellular proteins that present four distinct functional modules, namely insulin-like growth factor binding protein (IGFBP, von Willebrand factor type C (vWF, thrombospondin type 1 (TSP, and C-terminal growth factor cysteine knot (CT domain. While heparin sulphate proteoglycans reportedly mediate the interaction of Cyr61 with the matrix and cell surface, the role of other extracellular associated proteins has not been revealed.In this report, surface plasmon resonance (SPR experiments and solid-phase binding assays demonstrate that recombinant Cyr61 interacts with immobilized monomeric or multimeric vitronectin (VTNC with K(D in the nanomolar range. Notably, the binding site for Cyr61 was identified as the somatomedin B domain (SMTB(1-44 of VTNC, which mediates its interaction with PAI-1, uPAR, and integrin alphav beta3. Accordingly, PAI-1 outcompetes Cyr61 for binding to immobilized SMTB(1-44, and Cyr61 attenuates uPAR-mediated U937 adhesion to VTNC. In contrast, isothermal titration calorimetry shows that Cyr61 does not display high-affinity binding for SMTB(1-44 in solution. Nevertheless, competitive ELISA revealed that multimeric VTNC, heat-modified monomeric VTNC, or SMTB(1-44 at high concentrations attenuate Cyr61 binding to immobilized VTNC, while monomeric VTNC was ineffective. Therefore, immobilization of VTNC exposes cryptic epitopes that recognize Cyr61 with high affinity, as reported for a number of antibodies, beta-endorphin, and other molecules.The finding that Cyr61 interacts with the SMTB(1-44 domain suggests that VTNC represent a point of anchorage for CCN family members to the matrix. Results are discussed in the context of the role of CCN and VTNC in matrix biology and angiogenesis.
Directory of Open Access Journals (Sweden)
Maria Fernanda De Mello Costa
2012-10-01
Full Text Available Angiotensin II is a key regulator of blood pressure and cardiovascular function in mammals. The conversion of angiotensin into its active form is carried out by Angiotensin I-Converting Enzyme (ACE. The measurement of ACE concentration in plasma or serum, its enzymatic activity, and the correlation between an insertion/deletion (I/D genetic polymorphism of the ACE gene have been investigated as possible indicators of superior athletic performance in humans. In this context, other indicators of superior adaptation to exercise resulting in better athletic performance (such as ventricular hypertrophy, VO2 max, and competition results were mostly used to study the association between ACE I/D polymorphism and improved performance. Despite the fact that the existing literature presents little consensus, there is sufficient scientific evidence to warrant further investigation on the usage of ACE activity and the I/D ACE gene polymorphism as biomarkers of superior athletic performance in humans of specific ethnicities or in athletes involved in certain sports. In this sense, a biomarker would be a substance or genetic component that could be measured to provide a degree of certainty, or an indication, of the presence of a certain trait or characteristic that would be beneficial to the athlete’s performance. Difficulties in interpreting and comparing the results of scientific research on the topic arise from dissimilar protocols and variation in study design. This review aims to investigate the current literature on the use of ACE I/D polymorphism as a biomarker of performance in humans through the comparison of scientific publications.
International Nuclear Information System (INIS)
Nechev, Kh.; Nankova, D.; Miteva, S.; Tsvetkov, Ts.; Shopova, V.
1982-01-01
Male rats Wistar breed were treated with insecticide Agria-1050 which contains methylnitrophos or thionphosphate (TP). The animals received treatment 5 days weekly during 4 months per os in a dose of 1/40 LD 50 (15 mg/kg b.w.). On the 20th day Ce 144 was introduced as CeCl 2 . The control group was composed of rats untreated with insecticide. On the 1st, 3rd, 8th and 15th day after application of Ce 144 the activities or cytochrom P-450 (P-450), amino-pyrine-N-demethylase (APD) and aniline liver microsome fraction. As a result of the chronic treatment with Agria 1050 a decrease chronic treatment with Agria 1050 a decrease is found in the content of P-450, ADP and AH. The study of the restoration of the liver monooxigenase system after a low activity of compensatory mechanisms. Ce 144 applied intratracheally caused changes, corresponding to a post-stress situation with their biphasic character, as well as with their amplitude: increased activity of P-450 and ADP on the first day, followed by a prolonged 144 and TP the radionuclide caused the character of the changes, whereas the insecticide only increased 4-5 times the amplitudes of these changes. The most pronounced was the increase of AH after the combined action of Ce 144 and TP. (authors)
Nimmala, Praneeth Reddy; Theivendran, Shevanuja; Barcaro, Giovanni; Sementa, Luca; Kumara, Chanaka; Jupally, Vijay Reddy; Apra, Edoardo; Stener, Mauro; Fortunelli, Alessandro; Dass, Amala
2015-06-04
Ultrastable gold nanomolecule Au144(SCH2CH2Ph)60 upon etching with excess tert-butylbenzenethiol undergoes a core-size conversion and compositional change to form an entirely new core of Au133(SPh-tBu)52. This conversion was studied using high-resolution electrospray mass spectrometry which shows that the core size conversion is initiated after 22 ligand exchanges, suggesting a relatively high stability of the Au144(SCH2CH2Ph)38(SPh-tBu)22 intermediate. The Au144 → Au133 core size conversion is surprisingly different from the Au144 → Au99 core conversion reported in the case of thiophenol, -SPh. Theoretical analysis and ab initio molecular dynamics simulations show that rigid p-tBu groups play a crucial role by reducing the cluster structural freedom, and protecting the cluster from adsorption of exogenous and reactive species, thus rationalizing the kinetic factors that stabilize the Au133 core size. This 144-atom to 133-atom nanomolecule's compositional change is reflected in optical spectroscopy and electrochemistry.
Angiotensin-converting enzyme gene I/D polymorphism in Pakistani ...
African Journals Online (AJOL)
hope&shola
two were the cases of antiphospholipid syndrome. Parsa et al. (2002) conducted an association of 3 polymor- phisms in angiotensin-converting enzyme including I/D polymorphism and 2 polymorphisms were associated with systemic lupus erythematosus and Lupus Nephritis among non-Caucasians that includes Hispanic, ...
Attachment quality of children with ID and its link to maternal sensitivity and structuring.
Feniger-Schaal, Rinat; Joels, Tirtsa
2018-05-01
Attachment theory produced a fertile field of research and clinical application. Although the topic of attachment of children with intellectual disability (ID) has received increasing research attention over the past 15 years, the empirical evidence is still limited. We applied theoretical and empirical knowledge of parenting typically developing children to examine the mother-child relationship in the ID population. The aim was to examine maternal sensitivity and structuring and its association with children's attachment classification and their disability. Forty preschool children (mean age 47.25, range 26-75 months) with non-specific ID and their mothers participated in the study. The mean developmental age was 25.92 months (SD = 10.89), The DQ mean score was 55.45 (SD = 17.28). We assessed children's quality of attachment using the SSP and maternal interactive behavior using the Emotional Availability Scales. Forty percent of children showed secure attachment, and 32.5% showed disorganized attachment. Attachment classifications correlated significantly with maternal sensitivity and maternal structuring but not with the child's cognitive disability. The results point to the importance of maternal interactive behavior for children with ID. Clinical implication may consider interventions aiming to enhance maternal sensitivity and structuring to improve children's quality of attachment. Copyright © 2018 Elsevier Ltd. All rights reserved.
Pätid võtsid varastatud ID-kaardiga kiirlaene / Põim Kama
Kama, Põim, 1985-
2008-01-01
ID-kaardi vargusega seotud pettusjuhtumist ning jaanuaris jõustunud rahapesu ja terrorismi rahastamise tõkestamise seaduse sättest, mis kohustab laenufirmasid esimese tehingu sooritamisel kliendiga silmast silma kohtuma. Lisatud: kiirlaenufirmad vilistavad seadusele
DEFF Research Database (Denmark)
Fyhrquist, Frej; Eriksson, Anders; Saijonmaa, Outi
2013-01-01
INTRODUCTION: Short telomeres are often associated with cardiovascular risk factors and age-related diseases, while the angiotensin converting enzyme (ACE) gene insertion/deletion polymorphism (DD, ID, II) has shown such associations less consistently. We hypothesized that telomere length...... and association of telomere length with cardiovascular risk is affected by ACE (I/D) genotype. METHODS: We measured leucocyte telomere length (LTL) by Southern blot and analysed ACE I/D genotypes in 1249 subjects with hypertension and left ventricular hypertrophy (LVH). We examined interactions of ACE I...
British military operation at Sheikh Sa‘id in the First World War
Directory of Open Access Journals (Sweden)
Abdol Rauh Yaccob
2017-09-01
Full Text Available It is a difficult task to measure the importance of South West Arabia to the Ottomans and the British prior to and during World War I. Early history of imperial expansion in the area which followed by constant conflicts and involved a considerable amount of diplomacy and intrigues with the natives may suggest that South West Arabia was considered as equally as important to other areas within the empire. However from the beginning of the 20th century South West Arabia was considered something of a backwater. It may also be observed that during the First World War the position of South West Arabia to these powers in relation to other war theatres remained practically the same except in the episodes of British action at Sheikh Said and the Ottomans advance at Lahej. The Indian authorities who believed that the Ottomans were contemplating a move to Sheikh Sa‘id with the aim of acting against British Perim with the telegraphic communication, convoys and shipping, only two miles away, took the opportunity of the movement of the troops through the Red Sea to attack the fort of Sheikh Sa‘id. The action was quickly taken before obtaining official approval from the Admiralty and the India Office in London. The action was taken due to the persistent reports of the Ottoman reinforcement with guns had been sent to Sheikh Sa‘id, further to take advantage of the presence of transports with troops for Egypt. Subsequently future military operations at Sheikh Sa‘id and the Red Sea appeared to dominate the discussions among the authorities at the India Office, the Admiralty, the Indian authorities and the Resident at Aden throughout the war without materializing any further military action.
Inanir, Ahmet; Basol, Nursah; Karakus, Nevin; Yigit, Serbulent
2013-11-10
Diabetic peripheral neuropathy (DPN) is a microvascular complication of diabetes mellitus (DM) due to decreasing quality of life. In the present study, it is aimed to evaluate angiotensin-converting enzyme (ACE) Gene I/D polymorphism in Turkish population. Two hundred and thirty-five DPN patients and two hundred and eighty-one controls were enrolled in this study. Genomic DNA was isolated and genotyped using polymerase chain reaction (PCR) analyses for the ACE gene I/D polymorphism. Baseline characteristics of the DPN patients according to ACE genotypes were similar, except for history of hypertension. The frequency of II genotype was significantly higher in patients with positive history of hypertension than the patients with negative history of hypertension (p=0.013). DD genotype of I/D polymorphism was found to be a susceptibility factor for DPN in homozygous form (p=0.032). According to allele frequencies, D allele of I/D polymorphism was found to be a susceptibility factor for DPN (p=0.031). ACE gene I/D polymorphism may research in DM patients to determine genetic predisposition for DPN. It can be useful for taking early measures and avoiding DPN in a Turkish population. © 2013 Elsevier B.V. All rights reserved.
2011-08-03
...-Challis National Forest, ID; Upper North Fork HFRA Ecosystem Restoration Project Environmental Impact... improve the health of the ecosystem and reach the desired future condition. DATES: Comments concerning the... Ecosystem Restoration Project EIS, P.O. Box 180, 11 Casey Rd., North Fork, ID 83466. Comments may also be...
idSpace Tooling and Training for collaborative distributed product innovation
Rutjens, Marjo; Bitter-Rijpkema, Marlies; Grube, Pascal; Heider, Thomas
2009-01-01
Rutjens, M., Bitter-Rijpkema, M., Grube, P. P., & Heider, T. (2009). idSpace Tooling and Training for collaborative distributed product innovation. Workshop during the e-Learning Baltic conference. June, 17-19, 2009, Rostock, Germany.
Directory of Open Access Journals (Sweden)
Patricia V Aguilar
2009-09-01
Full Text Available Venezuelan equine encephalitis virus (VEEV has been responsible for hundreds of thousands of human and equine cases of severe disease in the Americas. A passive surveillance study was conducted in Peru, Bolivia and Ecuador to determine the arboviral etiology of febrile illness. Patients with suspected viral-associated, acute, undifferentiated febrile illness of <7 days duration were enrolled in the study and blood samples were obtained from each patient and assayed by virus isolation. Demographic and clinical information from each patient was also obtained at the time of voluntary enrollment. In 2005-2007, cases of Venezuelan equine encephalitis (VEE were diagnosed for the first time in residents of Bolivia; the patients did not report traveling, suggesting endemic circulation of VEEV in Bolivia. In 2001 and 2003, VEE cases were also identified in Ecuador. Since 1993, VEEV has been continuously isolated from patients in Loreto, Peru, and more recently (2005, in Madre de Dios, Peru. We performed phylogenetic analyses with VEEV from Bolivia, Ecuador and Peru and compared their relationships to strains from other parts of South America. We found that VEEV subtype ID Panama/Peru genotype is the predominant one circulating in Peru. We also demonstrated that VEEV subtype ID strains circulating in Ecuador belong to the Colombia/Venezuela genotype and VEEV from Madre de Dios, Peru and Cochabamba, Bolivia belong to a new ID genotype. In summary, we identified a new major lineage of enzootic VEEV subtype ID, information that could aid in the understanding of the emergence and evolution of VEEV in South America.
An Improved Dynamic ID-Based Remote User Authentication with Key Agreement Scheme
Directory of Open Access Journals (Sweden)
Juan Qu
2013-01-01
Full Text Available In recent years, several dynamic ID-based remote user authentication schemes have been proposed. In 2012, Wen and Li proposed a dynamic ID-based remote user authentication with key agreement scheme. They claimed that their scheme can resist impersonation attack and insider attack and provide anonymity for the users. However, we will show that Wen and Li's scheme cannot withstand insider attack and forward secrecy, does not provide anonymity for the users, and inefficiency for error password login. In this paper, we propose a novel ECC-based remote user authentication scheme which is immune to various known types of attack and is more secure and practical for mobile clients.
Directory of Open Access Journals (Sweden)
Libermann Towia
2008-05-01
Full Text Available Abstract Background Endothelial differentiation occurs during normal vascular development in the developing embryo. This process is recapitulated in the adult when endothelial progenitor cells are generated in the bone marrow and can contribute to vascular repair or angiogenesis at sites of vascular injury or ischemia. The molecular mechanisms of endothelial differentiation remain incompletely understood. Novel approaches are needed to identify the factors that regulate endothelial differentiation. Methods Mouse embryonic stem (ES cells were used to further define the molecular mechanisms of endothelial differentiation. By flow cytometry a population of VEGF-R2 positive cells was identified as early as 2.5 days after differentiation of ES cells, and a subset of VEGF-R2+ cells, that were CD41 positive at 3.5 days. A separate population of VEGF-R2+ stem cells expressing the endothelial-specific marker CD144 (VE-cadherin was also identified at this same time point. Channels lined by VE-cadherin positive cells developed within the embryoid bodies (EBs formed by differentiating ES cells. VE-cadherin and CD41 expressing cells differentiate in close proximity to each other within the EBs, supporting the concept of a common origin for cells of hematopoietic and endothelial lineages. Results Microarray analysis of >45,000 transcripts was performed on RNA obtained from cells expressing VEGF-R2+, CD41+, and CD144+ and VEGF-R2-, CD41-, and CD144-. All microarray experiments were performed in duplicate using RNA obtained from independent experiments, for each subset of cells. Expression profiling confirmed the role of several genes involved in hematopoiesis, and identified several putative genes involved in endothelial differentiation. Conclusion The isolation of CD144+ cells during ES cell differentiation from embryoid bodies provides an excellent model system and method for identifying genes that are expressed during endothelial differentiation and that
High Precision 142Nd/144Nd and 143Nd/144Nd Isotope Ratio Measurements in Rock Samples
Ali, A.; Srinivasan, G.
2009-05-01
were removed with a mixtures of HClO4 and HCl. Finally the digested samples were dissolved in 4N HCl prior to the column chromatography. The separation of alkalis and REE was achieved with 2 ml BioRad column using AG®50W-X12 resin; following which the separation of Nd and Sm fractions was achieved using Ln-Spec resin in PFA column. Results: Triple filament geometry was used to measure Nd as a metal in multi-dynamic mode using Isoprobe-T TIMS. About 600x10-9 g of JNdi-1 standard [6] produced a 142Nd beam strength of ~5×10-11 A; 400 cycles constituted one measurement, where each cycle consisted of 4 sequences of 10 second counting time. A set of ˜10 measurements of JNdi-1 gave extremely accurate and precise ratios for 142/144, 143/144 and 145/144 with internal precision better than 4 ppm and an external precision of less than 7 ppm in all cases. The BCR-2 samples were loaded ˜200 ng (factor of 4 less than JNdi-1) and therefore their operating signal strength for 142Nd was ˜1×10-11 A. Based on our analyses we conclude that the internal precision for BCR-2 samples in the range of 8-9 ppm and their external precision is comparable to JNdi-1. References: [1] Caro et al, (2008) Nature 452, 336-339; [2] Míková & Denková, (2007) Geosciences 52, 221-226; [3] Caro et al, (2003) Nature 432, 428-432; [4] Raczek et al., (2003) Geostandards Newsletter 27, No.2, 173-179; [5] O'Neil et al, (2008) Science 321, 1828-1831; [6] Tanaka et al., (2000) Chem Geol, 168, 279-281.
Association of ACE Gene I/D polymorphism with migraine in Kashmiri population.
Wani, Irfan Yousuf; Sheikh, Saleem; Shah, Zafar Amin; Pandith, Arshid A; Wani, Mushtaq; Asimi, Ravouf; Wani, Maqbool; Sheikh, Shahnawaz; Mehraj, Iqra
2016-01-01
Migraine is a complex, recurrent headache disorder that is one of the most common complaints in neurology practice. The role of various genes in its pathogenesis is being studied. We did this study to see whether an association exists between ACE gene I/D polymorphism and migraine in our region. The study included 100 patients diagnosed with migraine and 121 healthy controls. The study subject were age and gender matched. The analysis was based on Polymerase Chain Reaction (PCR) and included following steps: DNA extraction from blood, PCR and Restriction Fragment Length Polymorphism (RFLP). Out of 100 cases, 69 were females and 31 were males. Fifty-seven were having migraine without aura and 43 had migraine with aura. 45 of the cases had II polymorphism, 40 had ID polymorphism and 15 had DD polymorphism in ACE gene. We were not able to find a statistically significant association between ACE gene I/D polymorphism with migraine. The reason for difference in results between our study and other studies could be because of different ethnicity in study populations. So a continuous research is needed in this regard in order to find the genes and different polymorphism that increase the susceptibility of Kashmiri population to migraine.
ID based cryptography for secure cloud data storage
Kaaniche , Nesrine; Boudguiga , Aymen; Laurent , Maryline
2013-01-01
International audience; This paper addresses the security issues of storing sensitive data in a cloud storage service and the need for users to trust the commercial cloud providers. It proposes a cryptographic scheme for cloud storage, based on an original usage of ID-Based Cryptography. Our solution has several advantages. First, it provides secrecy for encrypted data which are stored in public servers. Second, it offers controlled data access and sharing among users, so that unauthorized us...
Batf3 and Id2 have a synergistic effect on Irf8-directed classical CD8α+ dendritic cell development
Jaiswal, Hemant
2013-11-13
Dendritic cells (DCs) are heterogeneous cell populations represented by different subtypes, each varying in terms of gene expression patterns and specific functions. Recent studies identified transcription factors essential for the development of different DC subtypes, yet molecular mechanisms for the developmental program and functions remain poorly understood. In this study, we developed and characterized a mouse DC progenitor-like cell line, designated DC9, from Irf8-/- bone marrow cells as a model for DC development and function. Expression of Irf8 in DC9 cells led to plasmacytoid DCs and CD8α+ DC-like cells, with a concomitant increase in plasmacytoid DC- and CD8α+ DC-specific gene transcripts and induction of type I IFNs and IL12p40 following TLR ligand stimulation. Irf8 expression in DC9 cells led to an increase in Id2 and Batf3 transcript levels, transcription factors shown to be important for the development of CD8α+ DCs. We show that, without Irf8 , expression of Id2 and Batf3 was not sufficient for directing classical CD8α+ DC development. When coexpressed with Irf8, Batf3 and Id2 had a synergistic effect on classical CD8α+ DC development. We demonstrate that Irf8 is upstream of Batf3 and Id2 in the classical CD8α+ DC developmental program and define the hierarchical relationship of transcription factors important for classical CD8α+ DC development.
Gurav, Reshma S; Ganu, Sneha S; Panhale, Vrushali P
2014-10-01
Functional ankle instability (FAI) is the tendency of the foot to 'give way'. Identification of Functional Ankle Instability questionnaire (IdFAI) is a newly developed questionnaire to detect whether individuals meet the minimum criteria necessary for inclusion in an FAI population. However, the reliability of the questionnaire was studied only in a restricted age group. The purpose of this investigation was to examine the reliability of IdFAI across different age groups in adults. One hundred and twenty participants in the age group of 20-60 years consisting of 30 individuals in each age group were asked to complete the IdFAI on two occasions. Test-retest reliability was evaluated by intraclass correlation coefficient (ICC2,1). The study revealed that IdFAI has excellent test-retest reliability when studied across different age groups. The ICC2,1 in the age groups 20-30 years, 30-40 years, 40-50 years and 50-60 years was 0.978, 0.975, 0.961 and 0.922, respectively with Cronbach's alpha >0.9 in all the age groups. The IdFAI can accurately predict if an individual meets the minimum criterion for FAI across different age groups in adults. Thus, the questionnaire can be applied over different age groups in clinical and research set-ups.
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Are Mutual Help homes developed under the 1937 Act subject to the useful life provisions of section 205(a)(2)? 1000.144 Section 1000.144 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued) OFFICE OF...
Bodappa, Nataraju; Fluch, Ulrike; Fu, Yongchun; Mayor, Marcel; Moreno-García, Pavel; Siegenthaler, Hans; Wandlowski, Thomas
2014-11-01
Single gold particles may serve as room temperature single electron memory units because of their size dependent electronic level spacing. Here, we present a proof-of-concept study by electrochemically controlled scanning probe experiments performed on tailor-made Au particles of narrow dispersity. In particular, the charge transport characteristics through chemically synthesized hexane-1-thiol and 4-pyridylbenzene-1-thiol mixed monolayer protected Au144 clusters (MPCs) by differential pulse voltammetry (DPV) and electrochemical scanning tunneling spectroscopy (EC-STS) are reported. The pyridyl groups exposed by the Au-MPCs enable their immobilization on Pt(111) substrates. By varying the humidity during their deposition, samples coated by stacks of compact monolayers of Au-MPCs or decorated with individual, laterally separated Au-MPCs are obtained. DPV experiments with stacked monolayers of Au144-MPCs and EC-STS experiments with laterally separated individual Au144-MPCs are performed both in aqueous and ionic liquid electrolytes. Lower capacitance values were observed for individual clusters compared to ensemble clusters. This trend remains the same irrespective of the composition of the electrolyte surrounding the Au144-MPC. However, the resolution of the energy level spacing of the single clusters is strongly affected by the proximity of neighboring particles.Single gold particles may serve as room temperature single electron memory units because of their size dependent electronic level spacing. Here, we present a proof-of-concept study by electrochemically controlled scanning probe experiments performed on tailor-made Au particles of narrow dispersity. In particular, the charge transport characteristics through chemically synthesized hexane-1-thiol and 4-pyridylbenzene-1-thiol mixed monolayer protected Au144 clusters (MPCs) by differential pulse voltammetry (DPV) and electrochemical scanning tunneling spectroscopy (EC-STS) are reported. The pyridyl groups
Quand l’idée fixe se met « à table »
Directory of Open Access Journals (Sweden)
Cécile de Bary
2008-03-01
Full Text Available Un livre de cuisine, comme A table de Claudian, édité en 1963, peut relever de la prose d’idées dans la mesure où son projet est sous-tendu par une idéologie très précise, qui seule lui donne sa cohérence. Si l’ethnocentrisme consiste à ne pas reconnaître à l’autre une culture, par exemple, ce livre apparaît comme ethnocentrique, puisqu’il a pour projet de départager les peuples qui savent et ceux qui ne savent pas. Il est encore réactionnaire, voué au rétablissement des savoir-faire des terroirs, contre les corruptions parisiennes en particulier. Dès lors, la présentation d’un plat est toujours susceptible de s’étendre ou de se faire discours, sous la poussée d’un lyrisme acrimonieux. Pour autant, il ne s’agit pas d’un faux livre de cuisine, d’un traité ou d’une « physiologie ». La recette est l’aboutissement logique de l’idée fixe. Elle est le lieu d’une bataille que l’argumentation sert, qu’elle met en scène et qu’elle prépare.
International Nuclear Information System (INIS)
Kiradzhiev, G.; Khadzhidekova, E.
1985-01-01
The effect of the preparation Pyrimetin on rats, subjected to external irradiation combined with oral cerium 144 incorporation was studied. LD 50/30 of cerium-144 was used as biological criterion. It was shown that by this criterion Pyrimetin essentially abolished the potentiated by external radiation effect of cerium. Probably, the preparation leads to normalization of the gastro-intestinal motor function and the dose loading of the colon
Su, Li-Na; Lei, Feng-Ying; Huang, Wei-Fang; Zhao, Yan-Jun
2011-01-01
Background The results from the published studies on the association between angiotensin-converting enzyme (ACE) insertion/deletion (I/D) gene polymorphism and the treatment response to steroid in Asian children with idiopathic nephrotic syndrome (INS) is still conflicting. This meta-analysis was performed to evaluate the relation between ACE I/D gene polymorphism and treatment response to steroid in Asian children and to explore whether ACE D allele or DD genotype could become a predictive marker for steroid responsiveness. Methodology/Principal Findings Association studies were identified from the databases of PubMed, Embase, Cochrane Library and CBM-disc (China Biological Medicine Database) as of September 1, 2010, and eligible investigations were synthesized using meta-analysis method. Five investigations were identified for the analysis of association between ACE I/D gene polymorphism and steroid-resistant nephrotic syndrome (SRNS) risk in Asian children and seven studies were included to explore the relationship between ACE I/D gene polymorphism and steroid-sensitive nephrotic syndrome (SSNS) susceptibility. Five investigations were recruited to explore the difference of ACE I/D gene distribution between SRNS and SSNS. There was no a markedly association between D allele or DD genotype and SRNS susceptibility or SSNS risk, and the gene distribution differences of ACE between SRNS and SSNS were not statistically significant. II genotype might play a positive role against SRNS onset but not for SSNS (OR = 0.51, P = 0.02; OR = 0.95, P = 0.85; respectively), however, the result for the association of II genotype with SRNS risk was not stable. Conclusions/Significance Our results indicate that D allele or DD homozygous can't become a significant genetic molecular marker to predict the treatment response to steroid in Asian children with INS. PMID:21611163
Structure determination of K2ZnBr4 at 291 and 144 K
International Nuclear Information System (INIS)
Fabry, J.; Breczewski, T.; Zuniga, F.J.; Arnaiz, A.R.
1993-01-01
The room-temperature phase of K 2 ZnBr 4 is isomorphous with Sr 2 GeS 4 (P2 1 /m) while the low-temperature structure (P2 1 ) is slightly distorted [the phase transition occurs at 155 K]. Both structures contain highly deformed tetrahedral [ZnBr 4 ] 2- molecules with Br(3)-Zn-Br(3') angles of 103.06(5) and 102.49(9) at 291 and 144 K, respectively. This distortion is caused by the repulsion of Br atoms whose distance 3.712(1) and 3.661(2) A at 291 and 144 K, respectively, is below the Br-Br van der Waals distance (3.9 A). The phase transition is accompanied by minor shifts of cations and [ZnBr 4 ] 2- tetrahedra which are simultaneously rotated about a small angle. Below the phase transition point an inversion twin develops whose twin-fraction parameter was refined to 0.459(65). (orig.)
Energy Technology Data Exchange (ETDEWEB)
Gosnell, Thomas B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Chavez, Joseph R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Rowland, Mark S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Wong, James L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2014-02-26
RadID is a new gamma-ray spectrum analysis program for rapid screening of HPGe gamma-ray data to reveal the presence of radionuclide signatures. It is an autonomous, rule-based heuristic system that can identify well over 200 radioactive sources with particular interest in uranium and plutonium characteristics. It executes in about one second. RadID does not require knowledge of the detector efficiency, the source-to-detector distance, or the geometry of the inspected radiation source—including any shielding. In this first of a three-document series we sketch the RadID program’s origin, its minimal requirements, the user experience, and the program operation.
Schwartz, R H; Farrow, J A; Banks, B; Giesel, A E
1998-01-01
Altered motor vehicle drivers's licenses or other falsified or counterfeit photo identification cards are widely and illegally used by teenagers to obtain beer and other alcohol beverages. We obtained information on the methods currently used by teenagers to purchase beer and wine by asking nine hundred teenagers, between 16-19 years old to complete a brief, confidential questionnaire. High school students most often obtained alcoholic beverages by requesting someone of legal age to purchase it for them. College students used borrowed, altered, or counterfeit identification (ID) more often than high school students. Photo IDs purchased through mail order from a magazine advertisement were used infrequently and when use was attempted, they were sometimes (25%) unsuccessful. Fifteen percent of high school students, 14% of college freshmen, and 24% of teenage drug abusers were able to purchase beer by the case with borrowed, altered, or fake ID. Suggestions to reduce sales of alcohol-containing beverages to minors include universal "carding" of prospective purchasers, use of two view or hologram photos on a drivers' license, requiring three different ID cards at the point of purchase, and penalties to stores that fail to make a good effort to identify underage customers.
2012-09-11
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [B-68-2012] Foreign-Trade Zone 242--Boundary County, ID; Application for Subzone AREVA Enrichment Services, LLC; Bonneville County, ID An application... FTZ 242, requesting special-purpose subzone status for the facility of AREVA Enrichment Services, LLC...
Mohr, Amanda L A; Ofsa, Bill; Keil, Alyssa Marie; Simon, John R; McMullin, Matthew; Logan, Barry K
2014-09-01
Ongoing changes in the synthetic cannabinoid drug market create the need for relevant targeted immunoassays for rapid screening of biological samples. We describe the validation and performance characteristics of an enzyme-linked immunosorbent assay designed to detect use of one of the most prevalent synthetic cannabinoids in urine, UR-144, by targeting its pentanoic acid metabolite. Fluorinated UR-144 (XLR-11) has been demonstrated to metabolize to this common product. The assay has significant cross-reactivity with UR-144-5-OH, UR-144-4-OH and XLR-11-4-OH metabolites, but assay's cutoff is 5 ng/mL relative to the pentanoic acid metabolite of UR-144, which is used as the calibrator. The method was validated with 90 positive and negative control urine samples for UR-144, XLR-11 and its metabolites tested versus liquid chromatography-tandem mass spectrometry. The accuracy, sensitivity and specificity were determined to be 100% for the assay at the specified cutoff. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
ASSOCIATION OF ACTN3 R577X AND ACE I/D POLYMORPHISMS IN BRAZILIANS WRESTLERS
Directory of Open Access Journals (Sweden)
Marcelo Romanovitch Ribas
Full Text Available ABSTRACT Introduction: By associating genetics and sport, it is possible to identify subjects with greater capacity to adapt to training, and lower chances of injury. Objective: The investigation evaluated the genotypic and allelic distribution of ACTN3 R577X and ACE I/D polymorphisms in Brazilian high-performance athletes in wrestling and percussion combat sports. Methods: The study included 37 male athletes ranked from first to third place in world scenarios, divided into two groups: wrestling (23 wrestlers, being 11 of Judo, 4 of Greco-Roman style, 8 of Brazilian Jiu Jitsu, with mean age of 27.3 ± 6.9 years and percussion combat sports (14 athletes with a mean age of 25.7±4.4 years, being 6 of Karate, 3 of Muay Thai, 4 of Taekwondo, 1 Boxing. Genotyping of ACTN3 and ACE I/D polymorphisms was performed by polymerase chain reaction (PCR from the genomic DNA. Genotypic and allelic distributions were compared with control populations and athletes by Chi-square test and Fisher’s exact test; all analyzes considered p ≤ 0.05. Results: The genotypic distributions and allelic frequencies of ACTN3 RR=46%, RX=38% and XX=16%; R=65% and X=35%, and ACE I/D DD=47.7%, ID=34.3% and II=20%; D=62.9% and I=37.1% did not differ from the control population; however, when compared with wrestling athletes a significant difference was observed. Conclusion: These results suggest an association of ACTN3 R577X and ACE I/D genes with Brazilian high-performance wrestling athletes.
On Eddy current examination (ECE) of Incoloy 800 SG tube using OD encircling and ID bobbin coil
International Nuclear Information System (INIS)
Kapoor, K.; Sunder Krishna, K.; Bakshu, S.A.
2015-01-01
The purpose of this paper is to present and compare the results of ECE carried out on steam generator tubes from OD side and ID side. During the manufacturing of the tubes Eddy current testing is being carried out using OD encircling probe as per ASTM E 571. Here the purpose of the test is to capture the manufacturing defects. The parameters of the test are optimized to achieve best sensitivity to this requirement. These tubes are then installed in the steam generator and once again ECE is carried out during installation (pre-service inspection-PSI) and during in-service inspection (ISI) by using ID bobbin coil. These tests are carried out as per ASME section V article 8 appendix 1. Here the purpose of the test is to detect wall thinning, dent, pits etc due to operation and to locate these defects (OD side or ID side). Here the operating parameters are optimized for phase separation of defects from OD and ID. These parameters are quite different from those used during the manufacturing ECE. Interpretation of the signals detected in PSI/ISI in must be done with care to correlate with defect indications detected during manufacturing. In the present study, tubes with certain manufacturing defects, detected with OD encircling test were subjected to ID bobbin coil examination. Also certain tubes with signal picked up during test from ID were examined by using the OD encircling probe. This comparison of the results provides a clear picture about the sensitivity and deficiency of the either type of test. (author)
Causes of Mortality in Older People with Intellectual Disability: Results from the HA-ID Study
Oppewal, Alyt; Schoufour, Josje D.; van der Maarl, Hanne J. K.; Evenhuis, Heleen M.; Hilgenkamp, Thessa I. M.; Festen, Dederieke A.
2018-01-01
We aim to provide insight into the cause-specific mortality of older adults with intellectual disability (ID), with and without Down syndrome (DS), and compare this to the general population. Immediate and primary cause of death were collected through medical files of 1,050 older adults with ID, 5 years after the start of the Healthy Ageing and…
The Mathematica package TopoID and its application to the Higgs boson production cross section
Energy Technology Data Exchange (ETDEWEB)
Hoff, Jens
2016-07-15
We present the Mathematica package TopoID which aims at the automation of several steps in multiloop calculations. The algorithm which lies at the very core of the package is described and illustrated with an example. The main features of TopoID are stated and some of them are briefly demonstrated for NLO or NNLO Higgs boson production.
High-precision ID-TIMS zircon U-Pb geochronology using new 1013 Ohm resistors
Von Quadt, A.; Buret, Y.; Large, S.; Peytcheva, I.; Trinquier, A.; Wotzlaw, J. F.
2015-12-01
Faraday cups equipped with high gain amplifiers provide a means to measure small ion beams in static mode without the limited linear range of ion counting systems. We tested the application of newly available 1013 Ohm resistors to ID-TIMS zircon U-Pb geochronology using a range of natural and synthetic reference materials. The TritonPlus-RPQ at the Institute of Geochemistry and Petrology, ETH Zurich, is equipped with five new 1013 Ohm resistors and one MasCom secondary electron multiplier, allowing to measure the 202-204-205-206-207-208Pb masses in static mode. U is measured subsequently as U-oxide (265-267-270UO2) during a second step, also in static Faraday mode. The gain calibration of the 1013 Ohm resistors was performed using the procedure of Trinquier (2014), with 144Nd-146Nd being measured using 1011 Ohm resistor and 142-143-145-148-150Nd being measured using 1013 Ohm resitors (Trinquier, 2014; Koornneef et al., 2014). Standard deviations of the noise in all five new 1013 Ohm resistors are lower than 5.0 x 10-6 over a 6 month period, with no shift occurring over this time interval. This new detector set-up was tested by analyzing natural zircon standard materials and synthetic U/Pb solutions (www.earthime.org), ranging in age from ~2 Ma to ~600 Ma. All natural zircon standards were chemically abraded (Mattinson, 2005) and all samples were spiked with the ET2535 tracer solution. U-Pb dates obtained using the static measurement routine are compared to measurements employing dynamic peak jumping routines on the MasCom multiplier. This study illustrates the benefits and current limitations of using high gain amplifiers to measure small ion beams for zircon U-Pb geochronology compared to conventional dynamic ion counting techniques. Mattinson, J.M. (2005) Chemical Geology 220:47-66; Trinquier, A. (2014) Application Note 30281; Koornneef, J. et al (2014) Analytica Chimica Acta 819:49-55.
Liao, Hua-Xin; Tomaras, Georgia D.; Bonsignori, Mattia; Tsao, Chun-Yen; Hwang, Kwan-Ki; Chen, Haiyan; Lloyd, Krissey E.; Bowman, Cindy; Sutherland, Laura; Jeffries, Thomas L.; Kozink, Daniel M.; Stewart, Shelley; Anasti, Kara; Jaeger, Frederick H.; Parks, Robert; Yates, Nicole L.; Overman, R. Glenn; Sinangil, Faruk; Berman, Phillip W.; Pitisuttithum, Punnee; Kaewkungwal, Jaranit; Nitayaphan, Sorachai; Karasavva, Nicos; Rerks-Ngarm, Supachai; Kim, Jerome H.; Michael, Nelson L.; Zolla-Pazner, Susan; Santra, Sampa; Letvin, Norman L.; Harrison, Stephen C.
2013-01-01
An immune correlates analysis of the RV144 HIV-1 vaccine trial revealed that antibody responses to the gp120 V1/V2 region correlated inversely with infection risk. The RV144 protein immunogens (A244-rp120 and MN-rgp120) were modified by an N-terminal 11-amino-acid deletion (Δ11) and addition of a herpes simplex virus (HSV) gD protein-derived tag (gD). We investigated the effects of these modifications on gp120 expression, antigenicity, and immunogenicity by comparing unmodified A244 gp120 with both Δ11 deletion and gD tag and with Δ11 only. Analysis of A244 gp120, with or without Δ11 or gD, demonstrated that the Δ11 deletion, without the addition of gD, was sufficient for enhanced antigenicity to gp120 C1 region, conformational V2, and V1/V2 gp120 conformational epitopes. RV144 vaccinee serum IgGs bound more avidly to A244 gp120 Δ11 than to the unmodified gp120, and their binding was blocked by C1, V2, and V1/V2 antibodies. Rhesus macaques immunized with the three different forms of A244 gp120 proteins gave similar levels of gp120 antibody titers, although higher antibody titers developed earlier in A244 Δ11 gp120-immunized animals. Conformational V1/V2 monoclonal antibodies (MAbs) gave significantly higher levels of blocking of plasma IgG from A244 Δ11 gp120-immunized animals than IgG from animals immunized with unmodified A244 gp120, thus indicating a qualitative difference in the V1/V2 antibodies induced by A244 Δ11 gp120. These results demonstrate that deletion of N-terminal residues in the RV144 A244 gp120 immunogen improves both envelope antigenicity and immunogenicity. PMID:23175357
Energy Technology Data Exchange (ETDEWEB)
Castro, R., E-mail: rodrigo.castro@visite.es [Asociacion EURATOM/CIEMAT para Fusion, Madrid (Spain); Barbato, P. [Consorzio RFX, Euratom ENEA Association, Corso Stati Uniti 4, 35127 Padova (Italy); Vega, J. [Asociacion EURATOM/CIEMAT para Fusion, Madrid (Spain); Taliercio, C. [Consorzio RFX, Euratom ENEA Association, Corso Stati Uniti 4, 35127 Padova (Italy)
2011-10-15
Remote participation facilities among fusion laboratories require access control solutions with two main objectives: to preserve the usability of the systems and to guaranty the required level of security for accessing to shared services. On one hand, this security solution has to be: single-sign-on, transparent for users, compatible with user mobility, and compatible with used client applications. On the other hand, it has to be compatible with shared services and resources among organisations, providing in each case the required access security level. EFDA-Federation is a security infrastructure that integrates a set of fusion laboratories and enables to share resources and services fulfilling the requirements previously described. In EFDA community, JET and RFX have security access policies to some of their services that require strong authentication mechanisms. In both cases, strong authentication is based on RSA SecurID tokens. This is a hardware device that is supplied to and generates a new password every minute. The job presents two main results. The first one is the integration of RSA SecurID into EFDA-Federation. Thanks to it, federated organisations are able to offer SecurID to their users as an alternative strong authentication mechanism, with the corresponding increase of security level. The second result is the development of a new access control mechanism based on port knocking techniques and its integration into EFDA-Federation. Additionally, a real application in RFX is presented and includes the integration of its SecurID infrastructure as federated authentication mechanism, and the application of the new access control mechanism to its MDSplus server.
International Nuclear Information System (INIS)
Castro, R.; Barbato, P.; Vega, J.; Taliercio, C.
2011-01-01
Remote participation facilities among fusion laboratories require access control solutions with two main objectives: to preserve the usability of the systems and to guaranty the required level of security for accessing to shared services. On one hand, this security solution has to be: single-sign-on, transparent for users, compatible with user mobility, and compatible with used client applications. On the other hand, it has to be compatible with shared services and resources among organisations, providing in each case the required access security level. EFDA-Federation is a security infrastructure that integrates a set of fusion laboratories and enables to share resources and services fulfilling the requirements previously described. In EFDA community, JET and RFX have security access policies to some of their services that require strong authentication mechanisms. In both cases, strong authentication is based on RSA SecurID tokens. This is a hardware device that is supplied to and generates a new password every minute. The job presents two main results. The first one is the integration of RSA SecurID into EFDA-Federation. Thanks to it, federated organisations are able to offer SecurID to their users as an alternative strong authentication mechanism, with the corresponding increase of security level. The second result is the development of a new access control mechanism based on port knocking techniques and its integration into EFDA-Federation. Additionally, a real application in RFX is presented and includes the integration of its SecurID infrastructure as federated authentication mechanism, and the application of the new access control mechanism to its MDSplus server.
2013-01-01
Background The use of microorganisms in the synthesis of nanoparticles emerges as an eco-friendly and exciting approach, for production of nanoparticles due to its low energy requirement, environmental compatibility, reduced costs of manufacture, scalability, and nanoparticle stabilization compared with the chemical synthesis. Results The production of gold nanoparticles by the thermophilic bacterium Geobacillus sp. strain ID17 is reported in this study. Cells exposed to Au3+ turned from colourless into an intense purple colour. This change of colour indicates the accumulation of intracellular gold nanoparticles. Elemental analysis of particles composition was verified using TEM and EDX analysis. The intracellular localization and particles size were verified by TEM showing two different types of particles of predominant quasi-hexagonal shape with size ranging from 5–50 nm. The mayority of them were between 10‒20 nm in size. FT-IR was utilized to characterize the chemical surface of gold nanoparticles. This assay supports the idea of a protein type of compound on the surface of biosynthesized gold nanoparticles. Reductase activity involved in the synthesis of gold nanoparticles has been previously reported to be present in others microorganisms. This reduction using NADH as substrate was tested in ID17. Crude extracts of the microorganism could catalyze the NADH-dependent Au3+ reduction. Conclusions Our results strongly suggest that the biosynthesis of gold nanoparticles by ID17 is mediated by enzymes and NADH as a cofactor for this biological transformation. PMID:23919572
Design of Distortion-Invariant Optical ID Tags for Remote Identification and Verification of Objects
Pérez-Cabré, Elisabet; Millán, María Sagrario; Javidi, Bahram
Optical identification (ID) tags [1] have a promising future in a number of applications such as the surveillance of vehicles in transportation, control of restricted areas for homeland security, item tracking on conveyor belts or other industrial environment, etc. More specifically, passive optical ID tag [1] was introduced as an optical code containing a signature (that is, a characteristic image or other relevant information of the object), which permits its real-time remote detection and identification. Since their introduction in the literature [1], some contributions have been proposed to increase their usefulness and robustness. To increase security and avoid counterfeiting, the signature was introduced in the optical code as an encrypted function [2-5] following the double-phase encryption technique [6]. Moreover, the design of the optical ID tag was done in such a way that tolerance to variations in scale and rotation was achieved [2-5]. To do that, the encrypted information was multiplexed and distributed in the optical code following an appropriate topology. Further studies were carried out to analyze the influence of different sources of noise. In some proposals [5, 7], the designed ID tag consists of two optical codes where the complex-valued encrypted signature was separately introduced in two real-valued functions according to its magnitude and phase distributions. This solution was introduced to overcome some difficulties in the readout of complex values in outdoors environments. Recently, the fully phase encryption technique [8] has been proposed to increase noise robustness of the authentication system.
Sr-90, Cs-137 and Ce-144 in commercial tea from several areas in China
International Nuclear Information System (INIS)
Sha Lianmao; Qiu Yundian; Wang Zhihui; Wang Fenghua
1993-01-01
18 kinds of tea, most of which are famous products, were collected in 1985 from 10 provinces of China. More than 1 kg of manufactured tea was collected from each sampling location and ashed in a stainless steel pan by a rapid ashing apparatus made in China Institute for Radiation Protection. A 10 g aliquot of the ashed sample was subjected to radiochemical analysis for 90 Sr. 117 Cs and 144 Ce. Strontium, Cesium and Cerium carriers were added to the samples. The chemical yield of Sr, Cs and Ce were determined by weighting. After the radiochemical separation the mounted precipitates were counted for activity using a thin window methane gas-flow proportional counter normally for 100 min. Statistical error due to counting in generally was 90 Sr, 2.2 +- 0.9 Bq/kg for 137 Cs and 0.8 +- 0.2 Bq/kg for 144 Ce. Among these data, the content of 144 Ce in each tea sample is the lowest for its shorter lift. Higher values of 90 Sr concentration occurred in each tea sample than that of 137 Cs. This seems to be due to the fact that 137 Cs is tightly bound by soil than 90 Sr and the extent to which 90 Sr is absorbed from the soil by plants is greater than 137 Cs. (2 figs., 1 tab.)
Gayibova, Ülkü; Dalyan Cılo, Burcu; Ağca, Harun; Ener, Beyza
2014-07-01
Opportunistic fungal pathogens are one of the important causes of nosocomial infections, and several different types of yeasts, especially Candida species are increasingly recovered from immunocompromised patients. Since many of the yeasts are resistant to the commonly used antifungal agents, the introduction of appropriate therapy depends on rapid and accurate identification. The aims of this study were to compare the commercial identification systems namely API® ID 32C (bioMerieux, France) and Phoenix™ Yeast ID Panel (Becton Dickinson Diagnostics, USA) for the identification of Candida species and to evaluate the effect of morphological findings in the identification process. A total of 211 yeast strains isolated from different clinical samples (111 urine, 34 blood/vascular catheter, 27 upper/lower respiratory tract, 16 abscess/pus, 13 throat/vagina swabs and 10 sterile body fluids) of 137 patients hospitalized in Uludag University Health and Research Center between October 2013 to January 2014, were included in the study. Samples were cultured on blood agar, chromogenic agar (CHROMagar Candida, BD, USA) and Saboraud's dextrose agar (SDA), and isolated yeast colonies were evaluated with germ tube test and morphological examination by microscopy on cornmeal/Tween-80 agar. The isolates were identified as well by two commercial systems according to the manufacturers' recommendations. Discrepant results between the systems were tried to be resolved by using morphological characteristics of the yeasts. Of the isolates 159 were identified identical by both of the systems, and the concordance between those systems were estimated as 75.4%. According to the concordant identification, the most frequently isolated species was C.albicans (44.1%) followed by C.tropicalis (9.9%), C.glabrata (9.5%), C.parapsilosis (8.5%) and C.kefyr (8.1%). The concordance rate was 81.7% in identification of frequently isolated species (C.albicans, C.tropicalis, C.parapsilosis, C.glabrata, C
International Nuclear Information System (INIS)
Kramer, G.H.; Davies, J.M.
1981-04-01
A method has been developed for separating low-level activities of the beta-emitting isotopes strontium-90, yttrium-90, promethium-147 and cerium-144 from urine and aqueous solutions. They are subsequently estimated by planchet or liquid scintillation counting. The radionuclides are separated from each other and from interfering elements by solvent extraction with HDEHP (di-2-ethylhexyl phosphoric acid) in n-heptane. It is possible to separate the elements with a minimum of cross-contamination by selecting appropriate pH's and solvent concentrations. Percentage recoveries for the radionuclides are: 90 Sr, 100 +- 12; 90 Y, 65 +- 4; 147 Pm, 90 +- 8; 144 Ce, 87 +- 11. The limits of detection are: 90 Sr, 0.6 pCi; 90 Y, 0.7 pCi; 147 Pm, 1.0 pCi; 144 Ce, 0.8 pCi. (author)
Angiotensin-converting enzyme gene I/D polymorphism in Pakistani ...
African Journals Online (AJOL)
The frequency of DD allele in SLE patients with lupus nephritis is 100%, Sjogren's syndrome 100%, Raynaud's phenomenon 88.88%, and with rheumatoid arthritis it is 78.94%. The frequency of ID allele in SLE patients with Raynaud's phenomenon is 5.55%, and with rheumatoid arthritis it is 10.52%. The frequency of II ...
Migraine headaches among university students using id migraine test as a screening tool
Directory of Open Access Journals (Sweden)
Caylan Ayse
2011-08-01
Full Text Available Abstract Background Migraine is a significant health problem, especially for the young people, due to its frequency and accompanying morbidity, causing disability and loss of performance. In this study, our aim was to determine the prevalence of migraine headaches among university students in Edirne, a Turkish city. Methods In this cross-sectional and descriptive study, study population was composed of students registered to Trakya University in the academic year of 2008-2009. Out of these, 3694 of them accepted to participate. Participants who had two or more headaches in the last 3 months formed the headache group. Afterwards, two preliminary questions were applied to the headache group and participants with at least one affirmative response were asked to perform the validated ID-Migraine™ test. Results The mean age of 3694 students participated in the study was 19.23 ± 1.84 (17-39 years, with adolescents:adult ratio being 2.5:1. 1613 students (43.7% did have at least two headaches in the last three months. Migraine-type headache was detected in 266 subjects (7.2% based on the ID-Migraine™ test. Of the migraine group, 72 were male (27.1% and 194 were female (72.9%. There was no significant difference in migraine prevalence between adolescent and adult age groups. Conclusions With a prevalence similar to adults, primary care physicians should be aware of the probability of migraine headaches in university students in order to maintain a successful school performance.
Le point de vue de la philosophie: L'entreprise idéologique
Pesqueux , Yvon
2004-01-01
Parler de l'entreprise conduit à questionner ce qui fonde le discours – scientifique ou médiatique – qui permette d'en parler. Et c'est bien en cela qu'il est nécessaire d'approfondir l'univers de l'idéologie et de la croyance qui est celui dans lequel modèle, image, métaphore et figure de l'entreprise plongent leurs racines dans la mesure où l'usage de ces notions, quand on les applique à l'entreprise, conduit à créer un monde qui soit cohérent avec ce qu'ils portent en eux. L'idéologie comm...
Biological effects of repeated exposure of beagle dogs to relatively insoluble aerosols of 144Ce. IV
International Nuclear Information System (INIS)
Boecker, B.B.; Hahn, F.F.; Hanika-Rebar, C.; McClellan, R.O.; Mauderly, J.L.; Pickrell, J.A.
1977-01-01
This experiment is being conducted to study the behavior and long-term biological effects in Beagle dogs of 144 Ce inhaled in fused aluminosilicate particles in repeated inhalation exposures for comparison with similar data from dogs that were exposed only once to a similar aerosol. Four groups of nine dogs each were exposed once every eight weeks for two years (13 exposures) to achieve specified exposure goals. The 144 Ce-exposed dogs received increasing or relatively constant beta radiation dose rates in contrast to the steadily decreasing dose rate seen after a single inhalation exposure. Exposures in the first and second groups were planned to yield a cumulative absorbed dose to lung of approximately equal to 35,000 rads and those in the third group approximately equal to 17,000 rads within two years after the first exposure. Singly exposed dogs that had died with pulmonary tumors when this experiment was initiated had cumulative doses to death of 29,000 to 61,000 rads. All 13 exposures have been completed. One dog in the 4.5-μCi 144 Ce/kg body weight group died at 771 days after first exposure with emaciation, adrenal cortical degeneration and bone marrow aplasia. One control dog died accidentally during anesthesia. During the past year, two additional dogs have died. One dog in the repeated 2.5-μCi 144 Ce/kg body weight group died at 1256 days after the first exposure with radiation pneumonitis and pulmonary fibrosis and a control dog died at 1052 days with autoimmune hemolytic anemia. The remaining 32 dogs appear to be in good physical condition except for a persistent lymphopenia at approximately equal to 4 years after the first exposure. They are being maintained for life span observations
DEFF Research Database (Denmark)
Tetens, Inge
claims in relation to very low calorie diets (VLCDs) and reduction in body weight, reduction in the sense of hunger, reduction in body fat mass while maintaining lean body mass, reduction of post-prandial glycaemic responses, and maintenance of normal blood lipid profile. The scientific substantiation...... that whereas the diet that is the subject of the claim, very low calorie diet, is sufficiently characterised in relation to the following claimed effects: reduction in body weight (ID 1410), reduction in the sense of hunger (ID 1411), and reduction in body fat mass while maintaining lean body mass (ID 1412...... that formula foods for use in very low calorie diets should contain. The Panel concludes that a cause and effect relationship cannot be established between the consumption of a very low calorie diet and reduction of post-prandial glycaemic responses (ID 1414) and maintenance of normal blood lipid profile (ID...
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSD492 (Link to dictyBase) - - - Contig-U11368-1 SSD492E (Link... to Original site) - - - - - - SSD492E 768 Show SSD492 Library SS (Link to library) Clone ID SSD492 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSD4-D/SSD492Q.Seq.d/ Representative seq. ID SSD492...E (Link to Original site) Representative DNA sequence >SSD492 (SSD492Q) /CSM/SS/SSD4-D/SSD492Q.Seq.d/ CTGAA...nificant alignments: (bits) Value SSD492 (SSD492Q) /CSM/SS/SSD4-D/SSD492Q.Seq.d/ 1481 0.0 AHH144 (AHH144Q) /
Directory of Open Access Journals (Sweden)
Thais Fernanda de Almeida Galatro
Full Text Available Inhibitor of DNA Binding 4 (ID4 is a member of the helix-loop-helix ID family of transcription factors, mostly present in the central nervous system during embryonic development, that has been associated with TP53 mutation and activation of SOX2. Along with other transcription factors, ID4 has been implicated in the tumorigenic process of astrocytomas, contributing to cell dedifferentiation, proliferation and chemoresistance. In this study, we aimed to characterize the ID4 expression pattern in human diffusely infiltrative astrocytomas of World Health Organization (WHO grades II to IV of malignancy (AGII-AGIV; to correlate its expression level to that of SOX2, SOX4, OCT-4 and NANOG, along with TP53 mutational status; and to correlate the results with the clinical end-point of overall survival among glioblastoma patients. Quantitative real time PCR (qRT-PCR was performed in 130 samples of astrocytomas for relative expression, showing up-regulation of all transcription factors in tumor cases. Positive correlation was found when comparing ID4 relative expression of infiltrative astrocytomas with SOX2 (r = 0.50; p<0.005, SOX4 (r = 0.43; p<0.005 and OCT-4 (r = 0.39; p<0.05. The results from TP53 coding exon analysis allowed comparisons between wild-type and mutated status only in AGII cases, demonstrating significantly higher levels of ID4, SOX2 and SOX4 in mutated cases (p<0.05. This pattern was maintained in secondary GBM and further confirmed by immunohistochemistry, suggesting a role for ID4, SOX2 and SOX4 in early astrocytoma tumorigenesis. Combined hyperexpression of ID4, SOX4 and OCT-4 conferred a much lower (6 months median survival than did hypoexpression (18 months. Because both ID4 alone and a complex of SOX4 and OCT-4 activate SOX2 transcription, it is possible that multiple activation of SOX2 impair the prognosis of GBM patients. These observational results of associated expression of ID4 with SOX4 and OCT-4 may be used as a
DEFF Research Database (Denmark)
Pinto, V V; Salanti, A; Joergensen, L M
2012-01-01
720, Alhydrogel(®) and CAF01. Antibodies induced against DBL4¿-ID4 in combination with these adjuvants inhibited parasite binding to CSA from 82% to 99%. Although, different epitope recognition patterns were obtained for the different formulations, all adjuvant combinations induced strong Th1 and Th2......¿-ID4 to induce binding-inhibitory antibodies when formulated with adjuvants approved for human use. We have characterized the immune response of DBL4¿-ID4 in combination with Freund's complete and incomplete adjuvant and with three adjuvants currently being used in clinical trials: Montanide(®) ISA...... type responses, resulting in IgG with similar binding strength, with to the DBL4¿-ID4 antigen. These results demonstrate that the DBL4¿-ID4 antigen is highly immunogenic and that binding inhibitory antibodies are induced when formulated with any of the tested adjuvants....
Moreira, Jacqueline de Oliveira
2008-11-01
Theoretical, psychoanalytical constructs referring to the unconscious, the superego, and id, enjoy an autonomy within the I. As such, this study contemplates the discussion of these foreign entities that inhabit the interior of the I, producing an effect of foreignness. In the first section, I will develop a reflection on the state of foreignness of the unconscious. I will begin with an analogy used by Freud, which addresses the thesis of universality of consciousness with the psychoanalytical thesis of the subconscience within the I. Affirmation of consciousness in the other may be used analogously for affirm the idea of another inhabiting our own being. I shall continue, seeking to understand how the process of unconscious repression produces the effect of foreignness. The idea of a moral censor present in the entity of the superego constitutes the theme of the second section. The superego follows the principle of otherness in its constitution and in its effects on the I. Finally, a reflection on the dimension of otherness in the Id seems urgent to me, as with this concept, Freud radicalized in the idea of the foreign as the origin of the subject.
Student ID Cards: What You Should Know About Them
Hoffman, Jonathan; McGuire, Agnes C.
1973-01-01
Discusses the usefulness of photo ID cards for school security purposes, library control, student activities, and bus transportation control. Examines ways in which card costs can be reduced and the pros and cons of producing the cards at the school or of letting the work out. Problems involving card abuse and student rights are also considered.…
Comprehensive sieve analysis of breakthrough HIV-1 sequences in the RV144 vaccine efficacy trial.
Directory of Open Access Journals (Sweden)
Paul T Edlefsen
2015-02-01
Full Text Available The RV144 clinical trial showed the partial efficacy of a vaccine regimen with an estimated vaccine efficacy (VE of 31% for protecting low-risk Thai volunteers against acquisition of HIV-1. The impact of vaccine-induced immune responses can be investigated through sieve analysis of HIV-1 breakthrough infections (infected vaccine and placebo recipients. A V1/V2-targeted comparison of the genomes of HIV-1 breakthrough viruses identified two V2 amino acid sites that differed between the vaccine and placebo groups. Here we extended the V1/V2 analysis to the entire HIV-1 genome using an array of methods based on individual sites, k-mers and genes/proteins. We identified 56 amino acid sites or "signatures" and 119 k-mers that differed between the vaccine and placebo groups. Of those, 19 sites and 38 k-mers were located in the regions comprising the RV144 vaccine (Env-gp120, Gag, and Pro. The nine signature sites in Env-gp120 were significantly enriched for known antibody-associated sites (p = 0.0021. In particular, site 317 in the third variable loop (V3 overlapped with a hotspot of antibody recognition, and sites 369 and 424 were linked to CD4 binding site neutralization. The identified signature sites significantly covaried with other sites across the genome (mean = 32.1 more than did non-signature sites (mean = 0.9 (p < 0.0001, suggesting functional and/or structural relevance of the signature sites. Since signature sites were not preferentially restricted to the vaccine immunogens and because most of the associations were insignificant following correction for multiple testing, we predict that few of the genetic differences are strongly linked to the RV144 vaccine-induced immune pressure. In addition to presenting results of the first complete-genome analysis of the breakthrough infections in the RV144 trial, this work describes a set of statistical methods and tools applicable to analysis of breakthrough infection genomes in general vaccine
The Id, Ego and Super-Ego in "Pride and Prejudice"
Liang, Yamin
2011-01-01
This paper mainly analyses the the id, ego, and super-ego which exists in the main character Elizabeth from several aspects, such as her pursuit for love, her prejudice towards Mr. Darcy, and the changes in her attitudes towards Wickham. This analysis helps readers appreciate this masterpiece from a different aspect which is related to the…
International Nuclear Information System (INIS)
Guilmette, R.A.; Boecker, B.B.; Muggenburg, B.A.; Hahn, F.F.; McClellan, R.O.
1987-01-01
Immature (90 days of age), young adult (18 months of age), and aged (8-10.5 years of age) male and female beagle dogs received a single brief pernasal inhalation exposure to an aerosol of 144 Ce in an insoluble fused aluminosilicate matrix or 239 PuO 2 . These isotopes were selected to represent low- and high-LET emitters, respectively. No age-related differences in the retention of Pu in the lungs of dogs have been observed, nor have there been any detectable differences in the uptake and retention of Pu in the tracheobronchial lymph nodes. Age-related effects have been seen in the uptake of Pu in the skeleton, with the amount of Pu being greatest in the skeleton of immature dogs. For the dogs exposed to the 144 Ce aerosol, there was a statistically significant difference in the retention of 144 Ce in the lungs of immature dogs compared to young adults. Increased uptake of 144 Ce in the immature dog skeleton was also noted. 14 refs.; 4 figs
Predicting Students’ Performance using Modified ID3 Algorithm
Ramanathan L; Saksham Dhanda; Suresh Kumar D
2013-01-01
The ability to predict performance of students is very crucial in our present education system. We can use data mining concepts for this purpose. ID3 algorithm is one of the famous algorithms present today to generate decision trees. But this algorithm has a shortcoming that it is inclined to attributes with many values. So , this research aims to overcome this shortcoming of the algorithm by using gain ratio(instead of information gain) as well as by giving weights to each attribute at every...
RFID and Auto-ID in planning and logistics
Jones, Erick C
2011-01-01
As RFID technology is becoming increasingly popular, the need has arisen to address the challenges and approaches to successful implementation. RFID and Auto-ID in Planning and Logistics: A Practical Guide for Military UID Applications presents the concepts for students, military personnel and contractors, and corporate managers to learn about RFID and other automatic information capture technologies, and their integration into planning and logistics functions. The text includes comparisons of RFID with technologies such as bar codes, satellite tags, and global positioning systems and provides
Self-Reporting Tool On Pain in People with Intellectual Disabilities (STOP-ID!): A Usability Study
de Knegt, N.C.; Lobbezoo, F.; Schuengel, C.; Evenhuis, H.M.; Scherder, E.J.A.
2016-01-01
The use of the Self-reporting Tool On Pain in people with Intellectual Disabilities (STOP-ID!), an online application developed by the authors to aid in the self-reporting of pain, was evaluated in 40 adults with Down syndrome. Comprehension of the use of the tool (the ability to recognize
76 FR 43196 - Implementation of the Truth in Caller ID Act
2011-07-20
... National Network to End Domestic Violence (NNEDV) that the term ``harm'' is a broad concept that... evolution of technology, and the consequences of spoofing ANI and pseudo-ANI, we find that the delivery of... ID spoofing to protect victims of domestic violence. According to NNEDV, a verification requirement...
Underground Storage Tank Integrated Demonstration (UST-ID)
International Nuclear Information System (INIS)
1994-02-01
The DOE complex currently has 332 underground storage tanks (USTs) that have been used to process and store radioactive and chemical mixed waste generated from weapon materials production. Very little of the over 100 million gallons of high-level and low-level radioactive liquid waste has been treated and disposed of in final form. Two waste storage tank design types are prevalent across the DOE complex: single-shell wall and double-shell wall designs. They are made of stainless steel, concrete, and concrete with carbon steel liners, and their capacities vary from 5000 gallons (19 m 3 ) to 10 6 gallons (3785 m 3 ). The tanks have an overburden layer of soil ranging from a few feet to tens of feet. Responding to the need for remediation of tank waste, driven by Federal Facility Compliance Agreements (FFCAs) at all participating sites, the Underground Storage Tank Integrated Demonstration (UST-ID) Program was created by the US DOE Office of Technology Development in February 1991. Its mission is to focus the development, testing, and evaluation of remediation technologies within a system architecture to characterize, retrieve, treat to concentrate, and dispose of radioactive waste stored in USTs at DOE facilities. The ultimate goal is to provide safe and cost-effective solutions that are acceptable to the public and the regulators. The UST-ID has focused on five DOE locations: the Hanford Site, which is the host site, in Richland, Washington; the Fernald Site in Fernald, Ohio; the Idaho National Engineering Laboratory near Idaho Falls, Idaho; the Oak Ridge Reservation in Oak Ridge, Tennessee, and the Savannah River Site in Savannah River, South Carolina
Guo, Le; Zhou, Linlin; Gao, Qian; Zhang, Aijun; Wei, Jun; Hong, Dantong; Chu, Yuankui; Duan, Xiangguo; Zhang, Ying; Xu, Guangxian
2017-01-01
MicroRNAs (miRNAs) are small noncoding nucleotides that play major roles in the response of host immune cells. Autophagy plays a key role in activating the antimicrobial host defense against Mycobacterium tuberculosis (M. tuberculosis). Whether miRNAs specifically influence the activation of macrophage autophagy during M. tuberculosis infection is largely unknown. In the present study, we demonstrate that Mycobacterium bovis Bacillus Calmette-Guérin (BCG) infection of macrophages leads to increased expression of miR-144-3p, which targets autophagy-related gene 4a (ATG4a), to inhibit autophagy activation and antimicrobial responses to BCG. Overexpression of miR-144-3p significantly decreased both mRNA and protein levels of ATG4a, inhibited the formation of autophagosomes in RAW264.7 cells and increased intracellular survival of BCG. However, transfection with miR-144-3p inhibitor led to an increase in ATG4a levels, accelerated the autophagic response in macrophages, and decreased BCG survival in macrophages. The experimental results of this study reveal a novel role of miR-144-3p in inhibiting autophagy activation by targeting ATG4a and enhancing BCG infection, and provide potential targets for developing improved treatment.
ORCID Integration: Services to Create and Use ORCID IDs at KAUST
Grenz, Daryl M.
2015-06-09
As ORCID IDs become accepted as a global standard, the potential benefits to researchers and institutions of making use of them are multiplying. At King Abdullah University of Science and Technology (KAUST) we adopted the first institutional open access policy in the Arab region in June 2014 and are integrating with ORCID as part of services to researchers that improve the preservation and dissemination of their research. We started by using ORCID IDs to identify authors in our institutional repository. Our next step was to join ORCID as an institutional member and then set up a plan to support our faculty, researchers and students in the creation and use of ORCID identifiers. This presentation will look at the choices made and lessons learned during this process, focusing on the tools we developed to interact with the ORCID member API and the ways in which introducing ORCID has complemented other repository initiatives, such as the implementation of our institutional open access policy.
77 FR 55813 - Transition of DOE-ID Public Reading Room
2012-09-11
... to the INL Research Library at 1776 Science Center Drive, Idaho Falls, ID 83401, beginning September 1, 2012. Access to documents will also be electronically accessible through the World Wide Web. For direction in accessing documents electronically through the World Wide Web, please refer to the Idaho...
Ahuja, Suchit; Dogra, Deepika; Stainier, Didier Y R; Reischauer, Sven
2016-04-01
The atrioventricular canal (AVC) connects the atrial and ventricular chambers of the heart and its formation is critical for the development of the cardiac valves, chamber septation and formation of the cardiac conduction system. Consequently, problems in AVC formation can lead to congenital defects ranging from cardiac arrhythmia to incomplete cardiac septation. While our knowledge about early heart tube formation is relatively comprehensive, much remains to be investigated about the genes that regulate AVC formation. Here we identify a new role for the basic helix-loop-helix factor Id4 in zebrafish AVC valve development and function. id4 is first expressed in the AVC endocardium and later becomes more highly expressed in the atrial chamber. TALEN induced inactivation of id4 causes retrograde blood flow at the AV canal under heat induced stress conditions, indicating defects in AV valve function. At the molecular level, we found that id4 inactivation causes misexpression of several genes important for AVC and AV valve formation including bmp4 and spp1. We further show that id4 appears to control the number of endocardial cells that contribute to the AV valves by regulating Wnt signaling in the developing AVC endocardium. Copyright © 2016 Elsevier Inc. All rights reserved.
Heat transfer through He II in a 9.6 m long 35 mm ID tube
International Nuclear Information System (INIS)
Caspi, S.; Schafer, R.V.
1984-07-01
The limiting heat flux at the onset of He I was measured in a 9.6 m long tube of 35 mm ID at a bath temperature between 1.8 K and T/sub lambda/ and a pressure of 1 atm. The measured limiting heat flux during axial heating is 50% more than end heating at the same bath temperature. Both cases agrees with the Gorter-Mellink mutual friction theory
Directory of Open Access Journals (Sweden)
Sinem Nalbantoglu
2013-01-01
Full Text Available Henoch-Schönlein purpura (HSP is a small-vessel vasculitis of autoimmune hypersensitivity, and renin-angiotensin system (RAS regulates vascular homeostasis and inflammation with activation of cytokine release. Thus, we aimed to investigate the association between HSP and ACE I/D and AGT M235T polymorphisms. Genotyping was determined by allele specific PCR and PCR-RFLP. We obtained a significant difference in genotype distribution (p = 0.003 and allele frequencies (p 0.05 and allele frequencies (p > 0.05 of the AGT M235T polymorphism. Risk assessment showed significant risk for HSP in the subjects both with the ID + DD genotype (p = 0.019, OR: 2.288, 95% CI: 1.136–4.609 and D allele (OR: D vs. I: 2.0528, 95% CI: 1.3632–3.0912, p = 0.001 while no significant risk was obtained for HSP in the subjects both with the MT + TT genotype (p = 0.312, OR: 1.3905, 95% CI: 0.7326–2.6391 and T allele (OR: T vs. M: 1.065, 95% CI: 0.729–1.557, p = 0.743. Furthermore, when patients were stratified by the presence of certain systemic complications of HSP, no significant association was detected with ACE I/D, and AGT M235T polymorphisms. Our findings suggest that ACE I/D polymorphism is significantly associated with HSP susceptibility.
Oeseburg, B.; Jansen, D. E. M. C.; Reijneveld, S. A.; Dijkstra, G. J.; Groothoff, J. W.
2010-01-01
Evidence on teachers' knowledge about somatic and mental chronic diseases among ID-adolescent compared to the knowledge parents and healthcare professionals have, is limited. The aim of this study is: (1) to assess the knowledge of teachers on the presence of chronic diseases in ID-adolescents; (2)
Comparison of the optimized conditions for genotyping of ACE ID ...
African Journals Online (AJOL)
ACE ID polymorphism is inevitable for genetic epidemiology of several cardiovascular and non cardiovascular diseases due to its direct influence on ACE activity level. In the present work, conditions were optimized for its analysis using conventional and direct blood PCR (DB PCR). Blood samples from nine normotensive ...
Directory of Open Access Journals (Sweden)
Ankita Das
Full Text Available Cranial neural crest cells (CNCCs have the remarkable capacity to generate both the non-ectomesenchyme derivatives of the peripheral nervous system and the ectomesenchyme precursors of the vertebrate head skeleton, yet how these divergent lineages are specified is not well understood. Whereas studies in mouse have indicated that the Twist1 transcription factor is important for ectomesenchyme development, its role and regulation during CNCC lineage decisions have remained unclear. Here we show that two Twist1 genes play an essential role in promoting ectomesenchyme at the expense of non-ectomesenchyme gene expression in zebrafish. Twist1 does so by promoting Fgf signaling, as well as potentially directly activating fli1a expression through a conserved ectomesenchyme-specific enhancer. We also show that Id2a restricts Twist1 activity to the ectomesenchyme lineage, with Bmp activity preferentially inducing id2a expression in non-ectomesenchyme precursors. We therefore propose that the ventral migration of CNCCs away from a source of Bmps in the dorsal ectoderm promotes ectomesenchyme development by relieving Id2a-dependent repression of Twist1 function. Together our model shows how the integration of Bmp inhibition at its origin and Fgf activation along its migratory route would confer temporal and spatial specificity to the generation of ectomesenchyme from the neural crest.
Automatic ID heat load generation in ANSYS code
International Nuclear Information System (INIS)
Wang, Zhibi.
1992-01-01
Detailed power density profiles are critical in the execution of a thermal analysis using a finite element (FE) code such as ANSYS. Unfortunately, as yet there is no easy way to directly input the precise power profiles into ANSYS. A straight-forward way to do this is to hand-calculate the power of each node or element and then type the data into the code. Every time a change is made to the FE model, the data must be recalculated and reentered. One way to solve this problem is to generate a set of discrete data, using another code such as PHOTON2, and curve-fit the data. Using curve-fitted formulae has several disadvantages. It is time consuming because of the need to run a second code for generation of the data, curve-fitting, and doing the data check, etc. Additionally, because there is no generality for different beamlines or different parameters, the above work must be repeated for each case. And, errors in the power profiles due to curve-fitting result in errors in the analysis. To solve the problem once and for all and with the capability to apply to any insertion device (ID), a program for ED power profile was written in ANSYS Parametric Design Language (APDL). This program is implemented as an ANSYS command with input parameters of peak magnetic field, deflection parameter, length of ID, and distance from the source. Once the command is issued, all the heat load will be automatically generated by the code
Directory of Open Access Journals (Sweden)
Mian-Yang Li
2015-01-01
Full Text Available Background: The diagnosis of myelodysplastic syndrome (MDS, especially hypoplastic MDS, and MDS with low blast counts or normal karyotype may be problematic. This study characterized ID4 gene methylation in patients with MDS and aplastic anemia (AA. Methods: The methylation status of ID4 was analyzed by bisulfite sequencing polymerase chain reaction (PCR and quantitative real-time methylation-specific PCR (MethyLight PCR in 100 patients with MDS and 31 patients with AA. Results: The MDS group had a higher ID4 gene methylation positivity rate (22.22% and higher methylation levels (0.21 [0-3.79] than the AA group (P < 0.05. Furthermore, there were significant differences between the hypoplastic MDS and AA groups, the MDS with low blast count and the AA groups, and the MDS with normal karyotype and the AA groups. The combination of genetic and epigenetic markers was used in much more patients with MDS (62.5% [35/56] than the use of genetic markers only (51.79% [29/56]. Conclusions: These results showed that the detection of ID4 methylation positivity rates and levels could be a useful biomarker for MDS diagnosis.
Shunmugam, Vicneswari; Say, Yee-How
2016-02-01
α-adrenergic receptor 2A (ADRA2A) and angiotensin-converting enzyme (ACE) genes have been variably associated with obesity and its related phenotypes in different populations worldwide. This cross-sectional study aims to investigate the association of adrenergic receptor α2A (ADRA2A) rs553668 and angiotensin-converting enzyme (ACE) I/D single nucleotide polymorphisms (SNPs) with obesity traits (body mass index-BMI; waist-hip ratio-WHR; total body fat percentage - TBF) in a Malaysian population. Demographic and clinical variables were initially collected from 230 subjects via convenience sampling among residents and workers in Setapak, Malaysia, but in the end only 214 multi-ethnic Malaysians (99 males; 45 Malays, 116 ethnic Chinese, and 53 ethnic Indians) were available for statistical analysis. Genotyping was performed by polymerase chain reaction using DNA extracted from mouthwash samples. The overall minor allele frequencies (MAFs) for ADRA2A rs553668 and ACE I/D were 0.55 and 0.56, respectively. Allele distribution of ACE I/D was significantly associated with ethnicity and WHR class. Logistic regression analysis showed that subjects with the ACE II genotype and I allele were, respectively, 2.15 and 1.55 times more likely to be centrally obese, but when adjusted for age and ethnicity, this association was abolished. Covariate analysis controlling for age, gender, and ethnicity also showed similar results, where subjects carrying the II genotype or I allele did not have significantly higher WHR. Combinatory genotype and allele analysis for ADRA2A rs553668 and ACE I/D showed that subjects with both ADRA2A rs553668 GG and ACE I/D II genotypes had significant lowest WHR compared to other genotype combinations. The ACE II genotype might be a protective factor against central adiposity risk among the Malaysian population when in combination with the ADRA2A rs553668 GG genotype.
Angular momentum distributions for 16O+144Nd
International Nuclear Information System (INIS)
Duchene, G.; Romain, P.; Beck, F.A.; Benet, P.; Disdier, D.; Haas, B.; Lott, B.; Rauch, V.; Scheibling, F.; Vivien, J.P.; Basu, S.K.; Bozek, E.; Zuber, K.; Di Gregorio, D.; Fernandez-Niello, J.
1993-01-01
Fusion cross sections have been measured for the system 16 O+ 144 Nd at bombarding energies in the range 67 MeV≤E lab ≤90 MeV by detecting directly evaporation residues in Si detectors and in the range 60 MeV≤E lab ≤75 MeV by off-line detection of the K x rays emitted by the radioactive evaporation residues and daughters. In order to obtain the spin distributions in the compound system gamma-ray multiplicity distributions for the most important neutron evaporation channels were also measured using a 4π BaF 2 array, in conjunction with Ge detectors. Results are compared with calculations based on models that consider fluctuations in barrier height due to ground-state zero-point vibrations as well as couplings to various inelastic and transfer channels
Directory of Open Access Journals (Sweden)
Nishith Saurav Topno
2016-03-01
Full Text Available Inhibitor of DNA binding protein 3 (ID3 has long been characterized as an oncogene that implicates its functional role through its Helix–Loop–Helix (HLH domain upon protein–protein interaction. An insight into the dimerization brought by this domain helps in identifying the key residues that favor the mechanism behind it. Molecular dynamics (MD simulations were performed for the HLH proteins ID3 and Transcription factor E2-alpha (E2A/E12 and their ensemble complex (ID3-E2A/E12 to gather information about the HLH domain region and its role in the interaction process. Further evaluation of the results by Principal Component Analysis (PCA and Free Energy Landscape (FEL helped in revealing residues of E2A/E12: Lys570, Ala595, Val598, and Ile599 and ID3: Glu53, Gln63, and Gln66 buried in their HLH motifs imparting key roles in dimerization process. Furthermore the T-pad analysis results helped in identifying the key fluctuations and conformational transitions using the intrinsic properties of the residues present in the domain region of the proteins thus specifying their crucial role towards molecular recognition. The study provides an insight into the interacting mechanism of the ID3-E2A/E12 complex and maps the structural transitions arising in the essential conformational space indicating the key structural changes within the helical regions of the motif. It thereby describes how the internal dynamics of the proteins might regulate their intrinsic structural features and its subsequent functionality.
Fixation of radioactive cerium-144 on white blood cells. Possibilities for use in physiopathology
International Nuclear Information System (INIS)
Aeberhardt, A.
1958-01-01
From the study of the means of transport of cerium in the blood of various laboratory animals, after intra-venous injection of 144 Ce- 144 Pr without carrier, we have been able to show up the part played by the white cells in the transport of this fission product during its passage in the blood. This observation has led to the study, in vitro, of the methods of cerium fixation on the white cells, with a view to determining the possibilities of using this property for white cell labelling, the methods used up to the present not being entirely satisfactory. Using the method for the separation of the known constituents of the blood proposed by us in 1956, we have studied the cerium fixation under various conditions: - on suspensions of white cells from the rabbit, - on a suspension of human white cells, - on the white cells in whole from the rabbit. (author) [fr
An ID-based Blind Signature Scheme from Bilinear Pairings
B.Umaprasada Rao; K.A.Ajmath
2010-01-01
Blind signatures, introduced by Chaum, allow a user to obtain a signature on a message without revealing any thing about the message to the signer. Blind signatures play on important role in plenty of applications such as e-voting, e-cash system where anonymity is of great concern. Identity based(ID-based) public key cryptography can be a good alternative for certified based public key setting, especially when efficient key management and moderate security are required. In this paper, we prop...
Lee, Jae-Chul; Kim, In Hye; Cho, Jeong Hwi; Lee, Tae-Kyeong; Park, Joon Ha; Ahn, Ji Hyeon; Shin, Bich Na; Yan, Bing Chun; Kim, Jong-Dai; Jeon, Yong Hwan; Lee, Young Joo; Won, Moo-Ho; Kang, Il Jun
2018-03-01
4-Hydroxy-3-methoxybenzaldehyde (vanillin), contained in a number of species of plant, has been reported to display beneficial effects against brain injuries. In the present study, the impact of vanillin on scopolamine‑induced alterations in cognition and the expression of DNA binding protein inhibitor ID‑1 (ID1), one of the inhibitors of DNA binding/differentiation proteins that regulate gene transcription, in the mouse hippocampus. Mice were treated with 1 mg/kg scopolamine with or without 40 mg/kg vanillin once daily for 4 weeks. Scopolamine‑induced cognitive impairment was observed from 1 week and was deemed to be severe 4 weeks following the administration of scopolamine. However, treatment with vanillin in scopolamine‑treated mice markedly attenuated cognitive impairment 4 weeks following treatment with scopolamine. ID1‑immunoreactive cells were revealed in the hippocampus of vehicle‑treated mice, and were hardly detected 4 weeks following treatment with scopolamine. However, treatment with vanillin in scopolamine‑treated mice markedly restored ID1‑immunoreactive cells and expression 4 weeks subsequent to treatment. The results of the present study suggested that vanillin may be beneficial for cognitive impairment, by preventing the reduction of ID1 expression which may be associated with cognitive impairment.
Iacomino, Giuseppe; Di Stasio, Luigia; Fierro, Olga; Picariello, Gianluca; Venezia, Antonella; Gazza, Laura; Ferranti, Pasquale; Mamone, Gianfranco
2016-12-01
A growing interest in developing new strategies for preventing coeliac disease has motivated efforts to identify cereals with null or reduced toxicity. In the current study, we investigate the biological effects of ID331 Triticum monococcum gliadin-derived peptides in human Caco-2 intestinal epithelial cells. Triticum aestivum gliadin derived peptides were employed as a positive control. The effects on epithelial permeability, zonulin release, viability, and cytoskeleton reorganization were investigated. Our findings confirmed that ID331 gliadin did not enhance permeability and did not induce zonulin release, cytotoxicity or cytoskeleton reorganization of Caco-2 cell monolayers. We also demonstrated that ID331 ω-gliadin and its derived peptide ω(105-123) exerted a protective action, mitigating the injury of Triticum aestivum gliadin on cell viability and cytoskeleton reorganization. These results may represent a new opportunity for the future development of innovative strategies to reduce gluten toxicity in the diet of patients with gluten intolerance. Copyright © 2016 Elsevier Ltd. All rights reserved.
DEFF Research Database (Denmark)
Lauritsen, Jens Peter Holst; Wong, Gladys W; Lee, Sang-Yun
2009-01-01
)-inhibitor of DNA binding 3 (Id3) pathway plays a defining role in this process. In particular, Id3 expression served to regulate adoption of the gammadelta fate. Moreover, Id3 was both necessary and sufficient to enable gammadelta-lineage cells to differentiate independently of Notch signaling and become competent...
Robust Fourier Watermarking for ID Images on Smart Card Plastic Supports
Directory of Open Access Journals (Sweden)
RIAD, R.
2016-11-01
Full Text Available Security checking can be improved by watermarking identity (ID images printed on smart cards plastic supports. The major challenge is resistance to attacks: printing the images on the plastic cards, durability and other attacks then scanning the image from the plastic card. In this work, a robust watermarking technique is presented in this context. It is composed of three main mechanisms. The first is a watermarking algorithm based on the Fourier transform to cope with global geometric distortions. The second comprises a filter that reduces image blurring. The third attenuates color degradations. Experiments on 400 ID images show that the Wiener filter strongly improves the detection rate and outperforms competitive algorithms (blind deconvolution and unsharp filter. Color corrections also enhance the watermarking score. The whole scheme has a high efficiency and a low computational cost. It makes it compatible with the desired industrial constraints, i.e. the watermark is to be invisible, the error rate must be lower than 1%, and the detection of the mark should be fast and simple for the user.
Directory of Open Access Journals (Sweden)
Kitsios Georgios
2009-06-01
Full Text Available Abstract Background The role of angiotensin-converting enzyme (ACE gene insertion/deletion (I/D polymorphism in modifying the response to treatment modalities in coronary artery disease is controversial. Methods PubMed was searched and a database of 58 studies with detailed information regarding ACE I/D polymorphism and response to treatment in coronary artery disease was created. Eligible studies were synthesized using meta-analysis methods, including cumulative meta-analysis. Heterogeneity and study quality issues were explored. Results Forty studies involved invasive treatments (coronary angioplasty or coronary artery by-pass grafting and 18 used conservative treatment options (including anti-hypertensive drugs, lipid lowering therapy and cardiac rehabilitation procedures. Clinical outcomes were investigated by 11 studies, while 47 studies focused on surrogate endpoints. The most studied outcome was the restenosis following coronary angioplasty (34 studies. Heterogeneity among studies (p ACE I/D polymorphism on the response to treatment for the rest outcomes (coronary events, endothelial dysfunction, left ventricular remodeling, progression/regression of atherosclerosis, individual studies showed significance; however, results were discrepant and inconsistent. Conclusion In view of available evidence, genetic testing of ACE I/D polymorphism prior to clinical decision making is not currently justified. The relation between ACE genetic variation and response to treatment in CAD remains an unresolved issue. The results of long-term and properly designed prospective studies hold the promise for pharmacogenetically tailored therapy in CAD.
Kim, Young Jin; Kim, Si Hyun; Park, Hyun-Jung; Park, Hae-Geun; Park, Dongchul; Song, Sae Am; Lee, Hee Joo; Yong, Dongeun; Choi, Jun Yong; Kook, Joong-Ki; Kim, Hye Ran; Shin, Jeong Hwan
2016-08-01
All 50 Clostridium difficile strains were definitely identified by Vitek2 system, Rapid ID 32A system, and MALDI-TOF. For 18 non-difficile Clostridium strains, the identification results were correct in 0, 2, and 17 strains by Vitek2, Rapid ID 32A, and MALDI-TOF, respectively. MALDI-TOF could be used as the primary tool for identification of Clostridium species. Copyright © 2016 Elsevier Ltd. All rights reserved.
The long noncoding RNA TUG1 regulates blood-tumor barrier permeability by targeting miR-144.
Cai, Heng; Xue, Yixue; Wang, Ping; Wang, Zhenhua; Li, Zhen; Hu, Yi; Li, Zhiqing; Shang, Xiuli; Liu, Yunhui
2015-08-14
Blood-tumor barrier (BTB) limits the delivery of chemotherapeutic agent to brain tumor tissues. Long non-coding RNAs (lncRNAs) have been shown to play critical regulatory roles in various biologic processes of tumors. However, the role of lncRNAs in BTB permeability is unclear. LncRNA TUG1 (taurine upregulated gene 1) was highly expressed in glioma vascular endothelial cells from glioma tissues. It also upregulated in glioma co-cultured endothelial cells (GEC) from BTB model in vitro. Knockdown of TUG1 increased BTB permeability, and meanwhile down-regulated the expression of the tight junction proteins ZO-1, occludin, and claudin-5. Both bioinformatics and luciferase reporter assays demonstrated that TUG1 influenced BTB permeability via binding to miR-144. Furthermore, Knockdown of TUG1 also down-regulated Heat shock transcription factor 2 (HSF2), a transcription factor of the heat shock transcription factor family, which was defined as a direct and functional downstream target of miR-144. HSF2 up-regulated the promoter activities and interacted with the promoters of ZO-1, occludin, and claudin-5 in GECs. In conclusion, our results indicate that knockdown of TUG1 increased BTB permeability via binding to miR-144 and then reducing EC tight junction protein expression by targeting HSF2. Thus, TUG1 may represent a useful future therapeutic target for enhancing BTB permeability.
MacKinnon, Neil; Somashekar, Bagganahalli S; Tripathi, Pratima; Ge, Wencheng; Rajendiran, Thekkelnaycke M; Chinnaiyan, Arul M; Ramamoorthy, Ayyalusamy
2013-01-01
Nuclear magnetic resonance based measurements of small molecule mixtures continues to be confronted with the challenge of spectral assignment. While multi-dimensional experiments are capable of addressing this challenge, the imposed time constraint becomes prohibitive, particularly with the large sample sets commonly encountered in metabolomic studies. Thus, one-dimensional spectral assignment is routinely performed, guided by two-dimensional experiments on a selected sample subset; however, a publicly available graphical interface for aiding in this process is currently unavailable. We have collected spectral information for 360 unique compounds from publicly available databases including chemical shift lists and authentic full resolution spectra, supplemented with spectral information for 25 compounds collected in-house at a proton NMR frequency of 900 MHz. This library serves as the basis for MetaboID, a Matlab-based user interface designed to aid in the one-dimensional spectral assignment process. The tools of MetaboID were built to guide resonance assignment in order of increasing confidence, starting from cursory compound searches based on chemical shift positions to analysis of authentic spike experiments. Together, these tools streamline the often repetitive task of spectral assignment. The overarching goal of the integrated toolbox of MetaboID is to centralize the one dimensional spectral assignment process, from providing access to large chemical shift libraries to providing a straightforward, intuitive means of spectral comparison. Such a toolbox is expected to be attractive to both experienced and new metabolomic researchers as well as general complex mixture analysts. Copyright © 2012 Elsevier Inc. All rights reserved.
2016-05-11
With the issuance of this final rule, the Drug Enforcement Administration places (1-pentyl-1H-indol-3-yl)(2,2,3,3-tetramethylcyclopropyl)methanone (UR-144), [1-(5-fluoro-pentyl)-1H-indol-3-yl](2,2,3,3-tetramethylcyclopropyl)methanone (5-fluoro-UR-144, XLR11), and N-(1-adamantyl)-1-pentyl-1H-indazole-3-carboxamide (APINACA, AKB48), including their salts, isomers, and salts of isomers whenever the existence of such salts, isomers, and salts of isomers is possible, into schedule I of the Controlled Substances Act. This scheduling action is pursuant to the Controlled Substances Act which requires that such actions be made on the record after opportunity for a hearing through formal rulemaking. This action imposes the regulatory controls and administrative, civil, and criminal sanctions applicable to schedule I controlled substances on persons who handle (manufacture, distribute, reverse distribute, import, export, engage in research, conduct instructional activities or chemical analysis, or possess), or propose to handle UR-144, XLR11, or AKB48.
International Nuclear Information System (INIS)
Ashok Kumar, G.V.S.; Kumar, R.; Venkata Subramani, C.R.
2015-01-01
Radioactive equilibrium is a condition in which the activity ratio of parent to its daughter is maintained constant with time which occurs only when the parent half-life is greater than daughter half-life. It is transient equilibrium in the case of the ratio of their half-lives of parent to daughter being less than an order whereas it becomes secular equilibrium when it is more than an order. In the case of secular equilibrium, the ratio of the activities becomes unity whereas the same depends on the decay constants of the parent and daughter nuclide for the transient equilibrium. 144 Ce- 144 Pr pair is a good example for the demonstration of secular equilibrium
Hall, James C; Jobson, Laura; Langdon, Peter E
2014-09-01
The aims of the study were to (1) revise the Impact of Event Scale-Revised for use with people with intellectual disabilities (IDs), creating the Impact of Event Scale-Intellectual Disabilities (IES-IDs), (2) assess the reliability of the IES-IDs, and (3) compare the IES-IDs to an existing measure trauma-related symptomatology, namely the Lancaster and Northgate Trauma Scale (LANTS), along with measures of anxiety and depression. Forty adults with IDs who had experienced at least one traumatic event were recruited and completed the IES-IDs and the LANTS on two occasions, separated by 2 weeks. Participants also completed the Glasgow Depression Scale and the Glasgow Anxiety Scale, along with the Trauma Information Form which was used to collect information about trauma history. Fifteen per cent of the sample had encountered five or more traumatic events. The IES-IDs and the LANTS had good to excellent internal consistency and test-retest reliability. Both measures correlated with self-report measures of depression and anxiety, although the strength of this correlation was greater with the LANTS. There was a significant positive correlation between trauma frequency and the IES-IDs, while trauma frequency did not correlate with the LANTS. Both the IES-IDs and the LANTS appear to have good reliability. There is a lack of well-developed questionnaires that can be used to assess symptoms of post-traumatic stress disorder (PTSD) in people with intellectual disabilities. The Impact of Event Scale-Revised was augmented creating the Impact of Event Scale-Intellectual Disabilities (IES-IDs). The IES-IDs was shown to have good psychometric properties. The IES-IDs was compared to the Lancaster and Northgate Trauma Scale (LANTS), but the LANTS did not correlate with trauma frequency. However, this study had a small sample size, and a much larger study is needed to examine the factor structure of both the IES-IDs and the LANTS. Future studies should attempt to recruit people with
Change of deformation at the backbending in the yrast superdeformed band of {sup 144}Gd
Energy Technology Data Exchange (ETDEWEB)
Ur, C.A.; Bolzonella, G.P.; Bazzacco, D. [dell`Universita, Padova (Italy)]|[INFN, Padova (Italy)] [and others
1996-12-31
A mean lifetime measurement using the Doppler shift attenuation method has been performed at GASP in order to extract the quadrupole moment of the yrast SD band of {sup 144}Gd. The extracted intrinsic quadrupole moments, being Q{sub 0}=13.7 eb above the backbending and Q{sub 0}=11.8 eb below the backbending, are consistent with a change of deformation from {beta}{sub 2}=0.51 (at {beta}{sub 4} {approx} 0.050) to {beta}{sub 2}=0.45 (at {beta}{sub 4} {approx}0.035). The experimental results are in nice agreement with the theoretical predictions, which revealed that the second well in {sup 144}Gd arises essentially from the very favored shell structure at N=80 and Z=64. The occupation at higher frequency of the aligned N=6 proton orbitals drives the nucleus to a slightly more deformed shape.
Young, Vicky J; Ahmad, Syed F; Brown, Jeremy K; Duncan, W Colin; Horne, Andrew W
2016-09-01
Is inhibitor of DNA-binding protein 2 (ID2) a mediator of the transforming growth factor (TGF)-β1-induced Warburg-like effect seen in the peritoneum of women with endometriosis? The TGF-β1-induced changes in the metabolic phenotype of peritoneal mesothelial cells from women with endometriosis are mediated through the ID2 pathway. TGF-β1 induces the metabolic conversion of glucose to lactate via aerobic glycolysis (the 'Warburg effect') in the peritoneum of women with endometriosis, through increased expression of the transcription factor hypoxia inducible factor α (HIF-1α). ID proteins are transcriptional targets of TGF-β1. Expression of ID2 was investigated in luteal phase peritoneal biopsies from women with regular menstrual cycles, with and without endometriosis (n = 8-10 each group) by quantitative RT-PCR (qRT-PCR) and immunohistochemistry. ID2 mRNA expression in primary human peritoneal mesothelial cells (HPMC) and immortalized mesothelial cells (MeT-5A) was assessed by qRT-PCR (n = 6). The effects of TGF-β1 and ID2 siRNA on HIF-1α mRNA expression and lactate secretion was assessed using qRT-PCR and a colorimetric lactate assay. ID2 is localized to peritoneal mesothelial and stromal cells of women with and without endometriosis. ID2 mRNA expression is lower in peritoneum adjacent to the endometriosis lesions compared to distal sites (P endometriosis. None. This work was funded by a Wellbeing of Women research grant (R42533) awarded to A.W.H., J.K.B. and W.C.D.; and an MRC Centre Grant G1002033. V.J.Y. received grant support from Federation of Women Graduates (134225) and a PhD studentship from the College of Medicine and Veterinary Medicine at the University of Edinburgh. There are no competing interests to declare. © The Author 2016. Published by Oxford University Press on behalf of the European Society of Human Reproduction and Embryology. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Design and performance of the 2-ID-B scanning x-ray microscope
International Nuclear Information System (INIS)
McNulty, I.
1998-01-01
We have constructed a high resolution scanning x-ray microscope at the 2-ID-B beamline at the Advanced Photon Source for 1-4 keV x-ray imaging and microspectroscopy experiments. The microscope uses a Fresnel zone plate to focus coherent x-ray undulator radiation to a 150 nm focal spot on a sample. The spectral flux in the focus is 10 8 ph/s/0.1% BW. X-ray photons transmitted by the sample are detected by an avalanche photodiode as the sample is scanned to form an absorption image. The sample stage has both coarse and fine translation axes for raster scanning and a rotation axis for microtomography experiments. The incident x-ray beam energy can also be scanned via the 2-ID-B monochromator while the sample is kept in focus to record spatially resolved absorption spectra. We have measured the performance of the instrument with various test objects. The microscope hardware, software, and performance are discussed in this paper
James, Daylon; Nam, Hyung-song; Seandel, Marco; Nolan, Daniel; Janovitz, Tyler; Tomishima, Mark; Studer, Lorenz; Lee, Gabsang; Lyden, David; Benezra, Robert; Zaninovic, Nikica; Rosenwaks, Zev; Rabbany, Sina Y; Rafii, Shahin
2010-01-01
Previous efforts to differentiate human embryonic stem cells (hESCs) into endothelial cells have not achieved sustained expansion and stability of vascular cells. To define vasculogenic developmental pathways and enhance differentiation, we used an endothelial cell–specific VE-cadherin promoter driving green fluorescent protein (GFP) (hVPr-GFP) to screen for factors that promote vascular commitment. In phase 1 of our method, inhibition of transforming growth factor (TGF)β at day 7 of differentiation increases hVPr-GFP+ cells by tenfold. In phase 2, TGFβ inhibition maintains the proliferation and vascular identity of purified endothelial cells, resulting in a net 36-fold expansion of endothelial cells in homogenous monolayers, which exhibited a transcriptional profile of Id1highVEGFR2highVE-cadherin+ ephrinB2+. Using an Id1-YFP hESC reporter line, we showed that TGFβ inhibition sustains Id1 expression in hESC-derived endothelial cells and that Id1 is required for increased proliferation and preservation of endothelial cell commitment. Our approach provides a serum-free method for differentiation and long-term maintenance of hESC-derived endothelial cells at a scale relevant to clinical application. PMID:20081865
Três idéias sedutoras e quatro sugestões preciosas: algumas reflexões de Jerome Kagan
Directory of Open Access Journals (Sweden)
José Fernando Bitencourt Lomônaco
Full Text Available São consideradas três idéias, denominadas por Jerome Kagan idéias sedutoras pela sua capacidade de se apresentarem como intuitivamente verdadeiras. A primeira é a de que processos psicológicos tais como inteligência, consciência, etc, podem ser amplamente generalizados para uma ampla gama de situações. A segunda refere-se ao determinismo infantil, à crença de que as primeiras experiências infantis constituem uma influência determinante no desenvolvimento. A terceira é relativa ao princípio do prazer, à noção de que o comportamento humano é regido fundamentalmente pela busca do prazer. Fundamentado em dados de diferentes áreas do conhecimento, Kagan demonstra a falácia de cada uma dessas idéias e apresenta quatro sugestões construtivas para aqueles que trabalham nas ciências sociais e comportamentais.
A new TLD badge with machine readable ID for fully automated readout
International Nuclear Information System (INIS)
Kannan, S. Ratna P.; Kulkarni, M.S.
2003-01-01
The TLD badge currently being used for personnel monitoring of more than 40,000 radiation workers has a few drawbacks such as lack of on-badge machine readable ID code, delicate two-point clamping of dosimeters on an aluminium card with the chances of dosimeters falling off during handling or readout, projections on one side making automation of readout difficult etc. A new badge has been designed with a 8-digit identification code in the form of an array of holes and smooth exteriors to enable full automation of readout. The new badge also permits changing of dosimeters when necessary. The new design does not affect the readout time or the dosimetric characteristics. The salient features and the dosimetric characteristics are discussed. (author)
International Nuclear Information System (INIS)
Muggenburg, B.A.; Brooks, A.L.; Hahn, F.F.; Boecker, B.B.; McClellan, R.O.
1984-01-01
The risk of liver cancer from alpha-emitting radionuclides has been estimated for people from studies of patients injected with Thorotrast, which contains an alpha-emitting radionuclide. There is no corresponding estimation of the risk of liver cancers in people from internally-deposited beta-emitting radionuclides because of the lack of human data. Life-span studies in Beagle dogs exposed by inhalation to /sup 144/CeCl/sub 3/, a beta-emitting radionuclide, or by injection to /sup 239/Pu citrate, an alpha-emitting radionuclide, and in Chinese hamsters exposed by intravenous injections to /sup 144/Ce-/sup 144/Pr citrate or /sup 239/Pu citrate have provided information on liver cancers in these species. These radionuclides accumulated in the liver resulting in significant radiation exposure of the liver. Liver cancer occurred long after exposure. When the lifetime risks of liver cancer were calculated, /sup 239/Pu was found to be more effective than /sup 144/Ce in inducing liver cancers by factor of 10 to 12. The risk of liver cancer from internally-deposited beta emitters for people are estimated by assuming this relationship for people
Comparison of the optimized conditions for genotyping of ACE ID ...
African Journals Online (AJOL)
STORAGESEVER
2009-10-19
Oct 19, 2009 ... variants (Koyama et al., 2008). This method removed the chances of mistyping and gave 100% accuracy in the confirmation of ID heterozygotes but expenses of chromatography did not prove it to be cost effective. Normally, genomic DNA is used as template DNA for. PCR based studies. It is very difficult to ...
National Oceanic and Atmospheric Administration, Department of Commerce — This archival information package contains a listing of codes and chemical names that were used in NODC Standard Format Marine Toxic Substances and Pollutants (F144)...
Directory of Open Access Journals (Sweden)
Imkongtenla Pongen
2016-12-01
Full Text Available This study aims to evaluate the association of gender-dependent expression of angiotensin converting enzyme gene polymorphism (I/D with adiposity markers and blood pressure among AoNagas.57AoNagas[Males (n =26; Females (n = 31; Mean Age: 30.56±7.5 and 31.9 ±8.3 1]residing in Delhi were included in this cross sectionalstudy. Anthropometric measurements and blood pressure were taken using standardized techniques. Adiposity indices viz., BMI, WHR and WHtR were computed. Body fat percentage was assessed by bioelectricimpedance technique using Tanita Body composition analyzer (T-6360. Venous blood samples were withdrawn for DNA extraction and genotyping of ACE gene (I/D polymorphism was established by polymerase chain reaction (PCR. In female participants with DD homozygote, risk of both general and central obesity as depicted by BMI, body fat percentage, WC, WHR and WHtR were higher than ID heterozygote. Risk of hypertension was found to be greater among males with DD homozygote rather than females with DD homozygote. In males, obesity was not found to be associated with hypertension in either DD or ID genotypic variants of ACE. Whereas, in females obesity was significantly and positively correlated with hypertension in both DD and ID genotype. DD homozygous form of ACE is linked with both obesity and blood pressure in females and only with blood pressure in males. This genotype-by-gender interaction gives us a facet in understanding the complex genetic basis of adiposity and blood pressure phenotypes.
DEFF Research Database (Denmark)
Andreasen, Jesper T; Nasser, Arafat; Caballero-Puntiverio, Maitane
2016-01-01
NOS interaction has therefore been proposed as an alternative analgesic mechanism. We recently reported that UCCB01-125, a dimeric PSD-95 inhibitor with limited blood-brain-barrier permeability, reduced mechanical hypersensitivity in the complete Freund's adjuvant (CFA) inflammatory pain model, without disrupting...... of neuropathic pain. Potential cognitive effects of UCCB01-144 were examined using the social transmission of food preference (STFP) test and the V-maze test, and motor coordination was assessed with the rotarod test. UCCB01-144 (10mg/kg) reversed CFA-induced mechanical hypersensitivity after 1h, and completely...
Identification and expression analysis of miR-144-5p and miR-130b-5p in dairy cattle
Directory of Open Access Journals (Sweden)
Z. Li
2017-07-01
Full Text Available MicroRNAs (miRNAs can coordinate the main pathways involved in innate and adaptive immune responses by regulating gene expression. To explore the resistance to mastitis in cows, miR-144-5p and miR-130b-5p were identified in bovine mammary gland tissue and 14 potential target genes belonging to the chemokine signaling pathway, the arginine and proline metabolism pathway and the mRNA surveillance pathway were predicted. Subsequently, we estimated the relative expression of miR-144-5p and miR-130b-5p in cow mammary tissues by using stem-loop quantitative real-time polymerase chain reaction. The results showed that the relative expression of miR-144-5p and miR-130b-5p in the mastitis-infected mammary tissues (n = 5 was significantly downregulated 0.14-fold (p < 0. 01 and upregulated 3.34-fold (p < 0. 01, respectively, compared to healthy tissues (n = 5. Our findings reveal that miR-144-5p and miR-130b-5p may have important roles in resistance to mastitis in dairy cattle.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Depreciation: Allowance for depreciation on fully... SKILLED NURSING FACILITIES Capital-Related Costs § 413.144 Depreciation: Allowance for depreciation on fully depreciated or partially depreciated assets. (a) Principle. Depreciation on assets being used by a...
Lee, Youn Soo; Gong, Gyungyub; Sohn, Jin Hee; Ryu, Ki Sung; Lee, Jung Hun; Khang, Shin Kwang; Cho, Kyung-Ja; Kim, Yong-Man; Kang, Chang Suk
2013-06-01
The objective of this study was to evaluate a newly-developed EASYPREP liquid-based cytology method in cervicovaginal specimens and compare it with SurePath. Cervicovaginal specimens were prospectively collected from 1,000 patients with EASYPREP and SurePath. The specimens were first collected by brushing for SurePath and second for EASYPREP. The specimens of both methods were diagnosed according to the Bethesda System. Additionally, we performed to REBA HPV-ID genotyping and sequencing analysis for human papillomavirus (HPV) on 249 specimens. EASYPREP and SurePath showed even distribution of cells and were equal in cellularity and staining quality. The diagnostic agreement between the two methods was 96.5%. Based on the standard of SurePath, the sensitivity, specificity, positive predictive value, and negative predictive value of EASYPREP were 90.7%, 99.2%, 94.8%, and 98.5%, respectively. The positivity of REBA HPV-ID was 49.4% and 95.1% in normal and abnormal cytological samples, respectively. The result of REBA HPV-ID had high concordance with sequencing analysis. EASYPREP provided comparable results to SurePath in the diagnosis and staining quality of cytology examinations and in HPV testing with REBA HPV-ID. EASYPREP could be another LBC method choice for the cervicovaginal specimens. Additionally, REBA HPV-ID may be a useful method for HPV genotyping.
KONSEP MᾹQᾹṢID AL-SYᾹRĪAH MENURUT ṬᾹHᾹ JᾹBIR AL-‘ALWᾹNĪ
Directory of Open Access Journals (Sweden)
Chasnak Najidah
2017-03-01
Full Text Available One discourse which is receiving considerable attention from scholars of Islam is about the objectives of Islamic law (maqasid al-shari'ah. Taha Jabir al-'Alwānī as one reviewer of Maqasid al-shari'ah contemporary formulate the concept of maqasid al-shari'ah different from previous scholars. This article describes the concept of maqasid al-shari'ah by Taha Jabir al-'Alwānī. According to him, there are three levels of hierarchical of Maqasid al-Sharia. The highest value of maqasid al-shari'ah says is what he describes as al-Maqasid al-'ulyā al-Hakimah (intentions of the highest shari'ah and a legal basis, which consists of three main elements, namely al-Tawhid ( Onesess of God, al-Tazkiyah (purification and al-'umrān (prosperity. The position of the second al-shari'ah Maqasid are universal values such as justice, freedom, and equality. While the third position is the formulation of the previous scholars regarding maqasid al-shari'ah consisting of ḍarūriyyat, ḥājiyyāt, and taḥsīniyyāt. In terms of methodological, Taha Jabir al-'Alwānī basing the new system for Maqasid al-syarī'ahnya on the methods of al-jam'u Baina al-qirā'atain, a reading of the two entities: the revelation of God and the universe. With this basis, he argues that the maqasid al-shari'ah formulations are qaṭ'ī, so it can be a reference to the scholars in solving the problems of contemporary law. [Salah satu diskursus yang mendapat perhatian cukup besar dari para akademisi Islam adalah seputar tujuan-tujuan hukum islam (maqāṣid al-syarī'ah. Ṭāhā Jābir al-‘Alwānī sebagai salah satu ulama pengkaji maqāṣid asy-syarī’ahkontemporer merumuskan konsep maqāṣid asy-syarī’ahyang berbeda dari ulama sebelumnya. Artikel ini mendeskripsikan konsep maqāṣid asy-syarī’ahmenurut Ṭāhā Jābir al-‘Alwānī. Menurutnya, ada tiga tingkatan hierarkis maqāṣid al-syarī'ah. Nilai tertinggi maqāṣid asy-syarī’ahmenurutnya adalah apa
Choi, Ickwon; Chung, Amy W; Suscovich, Todd J; Rerks-Ngarm, Supachai; Pitisuttithum, Punnee; Nitayaphan, Sorachai; Kaewkungwal, Jaranit; O'Connell, Robert J; Francis, Donald; Robb, Merlin L; Michael, Nelson L; Kim, Jerome H; Alter, Galit; Ackerman, Margaret E; Bailey-Kellogg, Chris
2015-04-01
The adaptive immune response to vaccination or infection can lead to the production of specific antibodies to neutralize the pathogen or recruit innate immune effector cells for help. The non-neutralizing role of antibodies in stimulating effector cell responses may have been a key mechanism of the protection observed in the RV144 HIV vaccine trial. In an extensive investigation of a rich set of data collected from RV144 vaccine recipients, we here employ machine learning methods to identify and model associations between antibody features (IgG subclass and antigen specificity) and effector function activities (antibody dependent cellular phagocytosis, cellular cytotoxicity, and cytokine release). We demonstrate via cross-validation that classification and regression approaches can effectively use the antibody features to robustly predict qualitative and quantitative functional outcomes. This integration of antibody feature and function data within a machine learning framework provides a new, objective approach to discovering and assessing multivariate immune correlates.
Directory of Open Access Journals (Sweden)
Ickwon Choi
2015-04-01
Full Text Available The adaptive immune response to vaccination or infection can lead to the production of specific antibodies to neutralize the pathogen or recruit innate immune effector cells for help. The non-neutralizing role of antibodies in stimulating effector cell responses may have been a key mechanism of the protection observed in the RV144 HIV vaccine trial. In an extensive investigation of a rich set of data collected from RV144 vaccine recipients, we here employ machine learning methods to identify and model associations between antibody features (IgG subclass and antigen specificity and effector function activities (antibody dependent cellular phagocytosis, cellular cytotoxicity, and cytokine release. We demonstrate via cross-validation that classification and regression approaches can effectively use the antibody features to robustly predict qualitative and quantitative functional outcomes. This integration of antibody feature and function data within a machine learning framework provides a new, objective approach to discovering and assessing multivariate immune correlates.
PROYECTOS DE I+D, CARACTERIZACIÓN DEL TIPO DE INVESTIGACIÓN Y EL ROL DE GERENTE DE PROYECTOS
Directory of Open Access Journals (Sweden)
Aníbal N. Cassanelli
2014-12-01
Full Text Available En este artículo se pone de manifiesto la importancia del sector de la I+D y su organización fuertemente proyectizada que la convierte en un área clave para la aplicación de metodologías de gestión de proyectos. Se analizan los modelos de procesos de la I+D para proponer un esquema basado en dominios interrelacionados que permite dar pie a la identificación y caracterización de la investigación básica, aplicada, desarrollo e innovación. A partir de ahí, se comparan las competencias entre el gestor de proyectos general y los investigadores principales (gestores de proyectos de I+D de facto. Se concluye que existe una gran diferencia entre conocimientos y competencias requeridos para la gestión. Se muestran las dos tendencias que existen en el sector de I+D y la propuesta de separación del roles y la creación de una nueva figura distintiva del investigador principal que se ocupe de la gestión de proyectos.
International Nuclear Information System (INIS)
Villano, C.M.; White, L.A.
2006-01-01
The ID (inhibitor of differentiation or DNA binding) helix-loop-helix proteins are important mediators of cellular differentiation and proliferation in a variety of cell types through regulation of gene expression. Overexpression of the ID proteins in normal human keratinocytes results in extension of culture lifespan, indicating that these proteins are important for epidermal differentiation. Our hypothesis is that the ID proteins are targets of the retinoic acid signaling pathway in keratinocytes. Retinoids, vitamin A analogues, are powerful regulators of cell growth and differentiation and are widely used in the prevention and treatment of a variety of cancers in humans. Furthermore, retinoic acid is necessary for the maintenance of epithelial differentiation and demonstrates an inhibitory action on skin carcinogenesis. We examined the effect of all-trans retinoic acid on expression of ID-1, -2, -3, and -4 in normal human keratinocytes and found that exposure of these cells to all-trans retinoic acid causes an increase in both ID-1 and ID-3 gene expression. Furthermore, our data show that this increase is mediated by increased transcription involving several cis-acting elements in the distal portion of the promoter, including a CREB-binding site, an Egr1 element, and an YY1 site. These data demonstrate that the ID proteins are direct targets of the retinoic acid signaling pathway. Given the importance of the ID proteins to epidermal differentiation, these results suggest that IDs may be mediating some of the effects of all-trans retinoic acid in normal human keratinocytes
Directory of Open Access Journals (Sweden)
Kersten Christian
2005-05-01
Full Text Available Abstract Background Bone morphogenetic proteins (BMPs belong to the TGF-β superfamily and are secreted proteins with pleiotropic roles in many different cell types. A potential role of BMP-6 in the immune system has been implied by various studies of malignant and rheumatoid diseases. In the present study, we explored the role of BMP-6 in normal human peripheral blood B cells. Results The B cells were found to express BMP type I and type II receptors and BMP-6 rapidly induced phosphorylation of Smad1/5/8. Furthermore, Smad-phosphorylation was followed by upregulation of Id1 mRNA and Id1 protein, whereas Id2 and Id3 expression was not affected. Furthermore, we found that BMP-6 had an antiproliferative effect both in naïve (CD19+CD27- and memory B cells (CD19+CD27+ stimulated with anti-IgM alone or the combined action of anti-IgM and CD40L. Additionally, BMP-6 induced cell death in activated memory B cells. Importantly, the antiproliferative effect of BMP-6 in B-cells was completely neutralized by the natural antagonist, noggin. Furthermore, B cells were demonstrated to upregulate BMP-6 mRNA upon stimulation with anti-IgM. Conclusion In mature human B cells, BMP-6 inhibited cell growth, and rapidly induced phosphorylation of Smad1/5/8 followed by an upregulation of Id1.
Energy Technology Data Exchange (ETDEWEB)
Cuddihy, R G; Boecker, B B; McClellan, R O; Kanapilly, G M [Lovelace Foundation for Medical Education and Research, Albuquerque, N.Mex. (USA)
1976-01-01
Beagle dogs inhaled aerosols containing /sup 144/CeCl/sub 3/. Deposition of /sup 144/Ce in tissues was determined in serially sacrificed dogs to characterize radiation dose patterns at early times after exposure. Uptakes of /sup 144/Ce in endocrine glands and reproductive organs were also measured; radiation doses were calculated and those doses were compared with the doses to the major organs of deposition - lung, liver and skeleton. Integrated radiation doses in pituitary and adrenal glands, pancreas, ovaries, testes, prostate and uterus were less than 2 % of those in lung and liver, while the thyroid dose was about 30 % of the dose in liver. These findings were consistent with previously reported biological responses in beagle dogs exposed to high levels of /sup 144/CeCl/sub 3/ wherein no radiation effects related to endocrine glands or the reproductive system have been observed. Use of these results in predicting the dosimetry of /sup 144/Ce in exposed humans re-emphasized the importance of radiation damage to lung, liver, skeleton and gastrointestinal tract compared to other organ systems.
Labelling IDS clusters by means of the silhouette index
Petrovic, Slovodan; Álvarez, Gonzalo; Orfila, Agustín; Carbó, Javier
2006-01-01
Proceeding of: IX Reunión Española sobre Criptología y Seguridad de la Información. Barcelona, 2006 One of the most difficult problems in the design of an anomaly based intrusion detection system (IDS) that uses clustering is that of labelling the ob- tained clusters, i.e. determining which of them correspond to ”good” behaviour on the network/host and which to ”bad” behaviour. In this paper, a new clusters’ labelling strategy, which makes use of the Silhouette clustering quality index is ...
ID-kaart on mugav ja praktiline dokument / Heiki Raudla
Raudla, Heiki, 1949-
2001-01-01
Ilmunud ka: Severnoje Poberezhje 12. okt., lk. 2; Lääne Elu 13. okt., lk. 2; Hiiumaa 13. okt., lk. 2; Koit 16. okt., lk. 6; Nädaline 16. okt., lk. 4; Sakala 18. okt., lk. 2; Valgamaalane 18. okt., lk. 2; Pjarnuskii Ekspress 12. okt., lk. 2; Meie Maa 19. okt., lk. 2; Hiiu Leht 23. okt., lk. 2; Järva Teataja 30. okt., lk. 2. Siseministri nõunik Heiki Raudla ID-kaardist
International Nuclear Information System (INIS)
Bäuerle, Bettina; Sandalova, Tatyana; Schneider, Gunter; Rieger, Paul-Gerhard
2006-01-01
This is the first report of the crystallization of an IDS-epimerase from A. tumefaciens BY6 and its l-selenomethionine derivative. The initial degradation of all stereoisomers of the complexing agent iminodisuccinate (IDS) is enabled by an epimerase in the bacterial strain Agrobacterium tumefaciens BY6. This protein was produced in Escherichia coli, purified and crystallized by the hanging-drop vapour-diffusion method. Crystals of IDS-epimerase were obtained under several conditions. The best diffracting crystals were grown in 22% PEG 3350, 0.2 M (NH 4 ) 2 SO 4 and 0.1 M bis-Tris propane pH 7.2 at 293 K. These crystals belong to the monoclinic space group P2 1 , with unit-cell parameters a = 55.4, b = 104.2, c = 78.6 Å, β = 103.3°, and diffracted to 1.7 Å resolution. They contain two protein molecules per asymmetric unit. In order to solve the structure using the MAD phasing method, crystals of the l-selenomethionine-substituted epimerase were grown in the presence of 20% PEG 3350, 0.2 M Na 2 SO 4 and 0.1 M bis-Tris propane pH 8.5
Comprehensive sieve analysis of breakthrough HIV-1 sequences in the RV144 vaccine efficacy trial.
Edlefsen, Paul T; Rolland, Morgane; Hertz, Tomer; Tovanabutra, Sodsai; Gartland, Andrew J; deCamp, Allan C; Magaret, Craig A; Ahmed, Hasan; Gottardo, Raphael; Juraska, Michal; McCoy, Connor; Larsen, Brendan B; Sanders-Buell, Eric; Carrico, Chris; Menis, Sergey; Kijak, Gustavo H; Bose, Meera; Arroyo, Miguel A; O'Connell, Robert J; Nitayaphan, Sorachai; Pitisuttithum, Punnee; Kaewkungwal, Jaranit; Rerks-Ngarm, Supachai; Robb, Merlin L; Kirys, Tatsiana; Georgiev, Ivelin S; Kwong, Peter D; Scheffler, Konrad; Pond, Sergei L Kosakovsky; Carlson, Jonathan M; Michael, Nelson L; Schief, William R; Mullins, James I; Kim, Jerome H; Gilbert, Peter B
2015-02-01
The RV144 clinical trial showed the partial efficacy of a vaccine regimen with an estimated vaccine efficacy (VE) of 31% for protecting low-risk Thai volunteers against acquisition of HIV-1. The impact of vaccine-induced immune responses can be investigated through sieve analysis of HIV-1 breakthrough infections (infected vaccine and placebo recipients). A V1/V2-targeted comparison of the genomes of HIV-1 breakthrough viruses identified two V2 amino acid sites that differed between the vaccine and placebo groups. Here we extended the V1/V2 analysis to the entire HIV-1 genome using an array of methods based on individual sites, k-mers and genes/proteins. We identified 56 amino acid sites or "signatures" and 119 k-mers that differed between the vaccine and placebo groups. Of those, 19 sites and 38 k-mers were located in the regions comprising the RV144 vaccine (Env-gp120, Gag, and Pro). The nine signature sites in Env-gp120 were significantly enriched for known antibody-associated sites (p = 0.0021). In particular, site 317 in the third variable loop (V3) overlapped with a hotspot of antibody recognition, and sites 369 and 424 were linked to CD4 binding site neutralization. The identified signature sites significantly covaried with other sites across the genome (mean = 32.1) more than did non-signature sites (mean = 0.9) (p analysis of the breakthrough infections in the RV144 trial, this work describes a set of statistical methods and tools applicable to analysis of breakthrough infection genomes in general vaccine efficacy trials for diverse pathogens.
Renaud, Stéphanie; Corcé, Vincent; Cannie, Isabelle; Ropert, Martine; Lepage, Sylvie; Loréal, Olivier; Deniaud, David; Gaboriau, François
2015-08-01
Tumor cell growth requires large iron quantities and the deprivation of this metal induced by synthetic metal chelators is therefore an attractive method for limiting the cancer cell proliferation. The antiproliferative effect of the Quilamine HQ1-44, a new iron chelator vectorized toward tumor cells by a polyamine chain, is related to its high selectivity for the Polyamine Transport System (PTS), allowing its preferential uptake by tumoral cells. The difference in PTS activation between healthy cells and tumor cells enables tumor cells to be targeted, whereas the strong dependence of these cells on iron ensures a secondary targeting. Here, we demonstrated in vitro that HQ1-44 inhibits DNA synthesis and cell proliferation of HCT116 cells by modulating the intracellular metabolism of both iron and polyamines. Moreover, in vivo, in xenografted athymic nude mice, we found that HQ1-44 was as effective as cis-platin in reducing HCT116 tumor growth, without its side effects. Furthermore, as suggested by in vitro data, the depletion in exogenous or endogenous polyamines, known to activate the PTS, dramatically enhanced the antitumor efficiency of HQ1-44. These data support the need for further studies to assess the value of HQ1-44 as an adjuvant treatment in cancer. Copyright © 2015 Elsevier Inc. All rights reserved.
Saúde coletiva: história de uma idéia e de um conceito
Directory of Open Access Journals (Sweden)
Everardo Duarte Nunes
1994-12-01
Full Text Available O presente trabalho procura resgatar de forma sintética a trajetória histórica e conceitual da "Saúde Coletiva", evidenciando as suas raízes nos projetos preventivistas e da medicina social. Estes projetos, que se estenderam a partir dos anos 50 e que culminam com a idéia da chamada "Saúde Coletiva", apresentam aspectos que os diferenciam na apreensão do social e do coletivo. Ao tratar especificamente da idéia de uma Saúde Coletiva, o texto aponta para a sua tríplice dimensão: como corrente de pensamento, como movimento social e como prática teórica.
International Nuclear Information System (INIS)
Zhou, Yan; Ming, Jia; Xu, Yan; Zhang, Yi; Jiang, Jun
2015-01-01
Highlights: • Expression of ERβ1 was positively correlated with E-cadherin in breast cancer cell. • ERβ1 upregulates E-cadherin expression in breast cancer cell lines. • ERβ1 upregulates E-cadherin expression in a Id1-dependent manner. - Abstract: ERβ1 is a member of the nuclear receptor superfamily of ligand-regulated transcription factors. It plays an important role in regulating the progression of breast cancer. However, the mechanisms of ERβ1 in tumorigenesis, metastasis and prognosis are still not fully clear. In this study, we showed that the expression of ERβ1 was positively correlated with E-cadherin expression in breast cancer cell lines. In addition, we found that ERβ1 upregulates E-cadherin expression in breast cancer cell lines. Furthermore, we also found that ERβ1 inhibits the migration and invasion of breast cancer cells and upregulated E-cadherin expression in a Id1-dependent manner. Taken together, our study provides further understanding of the molecular mechanism of ERβ1 in tumor metastasis and suggests the feasibility of developing novel therapeutic approaches to target Id1 to inhibit breast cancer metastasis
Temple, V; Drummond, C; Valiquette, S; Jozsvai, E
2010-06-01
Video conferencing (VC) technology has great potential to increase accessibility to healthcare services for those living in rural or underserved communities. Previous studies have had some success in validating a small number of psychological tests for VC administration; however, VC has not been investigated for use with persons with intellectual disabilities (ID). A comparison of test results for two well known and widely used assessment instruments was undertaken to establish if scores for VC administration would differ significantly from in-person assessments. Nineteen individuals with ID aged 23-63 were assessed once in-person and once over VC using the Wechsler Abbreviated Scale of Intelligence (WASI) and the Beery-Buktenica Test of Visual-Motor Integration (VMI). Highly similar results were found for test scores. Full-scale IQ on the WASI and standard scores for the VMI were found to be very stable across the two administration conditions, with a mean difference of less than one IQ point/standard score. Video conferencing administration does not appear to alter test results significantly for overall score on a brief intelligence test or a test of visual-motor integration.
Isotope shifts and hyperfine splittings in 144-154Sm I
International Nuclear Information System (INIS)
England, J.G.; Grant, I.S.; Newton, G.W.A.; Walker, P.M.
1990-01-01
The isotope shifts and hyperfine splittings have been measured in 144-154 Sm I using the crossed-beam laser fluorescence method. Transitions at 598.98 nm and 570.68 nm were investigated for all isotopes except 146 Sm and 153 Sm, in which measurements were only obtained at 570.68 nm. Laser-induced fluorescence has not previously been reported for 145 Sm. The magnetic dipole and electric quadrupole moments of the odd isotopes and the changes in mean square radii of the even ones are shown to be consistent with the information obtained from nuclear spectroscopy. (author)
Validez y fiabilidad del Researcher ID y de «Web of Science Production of Spanish Psychology»
Directory of Open Access Journals (Sweden)
José Alonso Olivas-Ávila
2014-01-01
Full Text Available La creación de sistemas integradores de productos de investigación, como el Researcher ID de Thomson Reuters, ha sido una necesidad emergente debido a lo complejo que es para los investigadores demostrar de manera periódica el impacto y difusión de su investigación. Sin embargo, estos sistemas se alimentan de información proveniente de las diversas bases de datos y cada vez son más inclusivos para captar productos de investigación. Varios estudios bibliométricos han demostrado que las bases de datos contienen imprecisiones de varios tipos, que afectan directamente a los sistemas integradores. Como consecuencia, se plantea este estudio descriptivo con el fin de analizar la precisión de los registros del Researcher ID de los miembros del consejo de www.psy-wos.es y de una muestra de usuarios de esta página para cotejar los registros con los contenidos en la base de datos Web of Science, diferenciándolos de contenidos ajenos a esta base de datos. Los resultados reflejan que existen imprecisiones y errores considerables en los Researcher ID de la muestra analizada, tales como duplicidad de registros y la inclusión de registros ajenos a la Web of Science. Se concluye que los Resercher ID así como el www.psy-wos.es no son válidos ni fiables.
Design and field configuration for a 14.4 GHz ECR ion source in Kolkata
International Nuclear Information System (INIS)
Rashid, M.H.; Bose, D.K.; Mallik, C.; Bhandari, R.K.
2001-01-01
The K500 cyclotron under construction will be capable of accelerating ions like O 6+ , Ne 4+ , Ar 16+ , Kr 27+ etc. We aim to get ∼200 euA maximum intensity of the extracted beam of O 6+ from the ion source and decided to have >2B ECR magnetic field on the cylindrical surface and the injection ends of the plasma chamber (P Ch) and slightly less than this at the extraction end. The success of the high field operation of ECRs at other places (U-AECR at LBL) suggests generation of proper magnetic field configuration for the 14.4 GHz microwave heating. The absolute composite magnetic field have been evaluated due to the coils (C1,C2) at the two ends and a -ve coil (NC) at the mid-length and a Halbach type sextupole (PM-Hex)
Baumgartner, C; Freydiere, A M; Gille, Y
1996-01-01
Two chromogenic media, Albicans ID and CHROMagar Candida agar plates, were compared with a reference medium, Sabouraud-chloramphenicol agar, and standard methods for the identification of yeast species. This study involved 951 clinical specimens. The detection rates for the two chromogenic media for polymicrobial specimens were 20% higher than that for the Sabouraud-chloramphenicol agar plates. The rates of identification of Candida albicans for Albicans ID and CHROMagar Candida agar plates w...
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFH121 (Link to dictyBase) - - - - VFH121P (Link to Original s...ite) VFH121F 632 VFH121Z 144 VFH121P 776 - - Show VFH121 Library VF (Link to library) Clone ID VFH121 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts...nificant alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum calreticulin mRNA, complete cd...es cDNA clone hj81f04, mRNA sequence. 36 7e-04 3 CB937139 |CB937139.1 IpCGJx13_12_E07_23 IpCGJx13 Ictalurus
Typing of two Middle Eastern populations with the Precision ID Ancestry Panel
DEFF Research Database (Denmark)
Truelsen, Ditte Mikkelsen; Farzad, Maryam Sharafi; Mogensen, Helle Smidt
2017-01-01
, Turkish and Iranian individuals were SNP typed with Massively Parallel Sequencing with the Precision ID Ancestry Panel (Thermo Fisher Scientific) to assess whether it was possible to differentiate geographically proximate populations in the Middle East using this kit. Analyses showed that it were...
Sègla, Aimé Dafon
The essay examines Idààcha cosmological vision as a kind of incorporation of Yoruba cosmology. It shows a process where the two strands, that is to say, knowledge and belief can not be readily distinguished. The divinatory traditional calendar is indeed based on a scale of fixed number values whose definitions are drawn from the concepts early traditional people have of the universe. Thus, the signification of the terms that designate entities such as angle, circle, center of the circle, midnight, time zone, the number of days in a week, etc., in the Yoruba dialect Idààcha, mirrors cosmological standards. These words constitute a landscape of memory shedding light on early Yoruba culture and history. Hence, Idààcha being a significant western periphery of the Yoruba region, we examine why its divinatory calendar would preserve an older spatio-temporal logic, beyond Ifè and Oyo revisionism in Yoruba history. Finally, the article points out that the translation of spatial and geometrical relations into temporal terms and vice-versa may suggest a new indexical approach to the study of cosmology in relation to the human body. As the body is in the mind, we say in relation to the human mind.
Energy Technology Data Exchange (ETDEWEB)
Bäuerle, Bettina [Institute of Microbiology, University of Stuttgart, 70569 Stuttgart (Germany); Sandalova, Tatyana; Schneider, Gunter [Department of Medical Biochemistry and Biophysics, Karolinska Institutet, 17177 Stockholm (Sweden); Rieger, Paul-Gerhard, E-mail: pg.rieger@imb.uni-stuttgart.de [Institute of Microbiology, University of Stuttgart, 70569 Stuttgart (Germany)
2006-08-01
This is the first report of the crystallization of an IDS-epimerase from A. tumefaciens BY6 and its l-selenomethionine derivative. The initial degradation of all stereoisomers of the complexing agent iminodisuccinate (IDS) is enabled by an epimerase in the bacterial strain Agrobacterium tumefaciens BY6. This protein was produced in Escherichia coli, purified and crystallized by the hanging-drop vapour-diffusion method. Crystals of IDS-epimerase were obtained under several conditions. The best diffracting crystals were grown in 22% PEG 3350, 0.2 M (NH{sub 4}){sub 2}SO{sub 4} and 0.1 M bis-Tris propane pH 7.2 at 293 K. These crystals belong to the monoclinic space group P2{sub 1}, with unit-cell parameters a = 55.4, b = 104.2, c = 78.6 Å, β = 103.3°, and diffracted to 1.7 Å resolution. They contain two protein molecules per asymmetric unit. In order to solve the structure using the MAD phasing method, crystals of the l-selenomethionine-substituted epimerase were grown in the presence of 20% PEG 3350, 0.2 M Na{sub 2}SO{sub 4} and 0.1 M bis-Tris propane pH 8.5.
Directory of Open Access Journals (Sweden)
Ling CHEN
2014-01-01
Full Text Available Objective To systematically investigate the correlation between the polymorphism of angiotensin converting enzyme (ACE gene I/D and hypertrophic cardiomyopathy. Methods The databases, such as PubMed, Embase, OVID, Web of Science, Cochrane library, CNKI, WanFang Data and VIP, were searched to collect the studies on the correlation between ACE I/D polymorphism and hypertrophic cardiomyopathy susceptibility. Studies that met the inclusion criteria were Meta-analyzed using Stata 11.0 software. Results Fifteen articles were collected including 1114 cases and 1648 controls. The Meta-analysis indicated that there was significant correlation between the 4 models of ACE I/D polymorphism and hypertrophic cardiomyopathy susceptibility [D vs I: OR=1.49, 95%CI (1.20, 1.84; DD vs (ID+II: OR=1.56, 95%CI (1.17, 2.08; (DD+ID vs II: OR=1.76, 95%CI (1.30, 2.38; DD vs II: OR=2.20, 95%CI (1.44, 3.37]. In subgroup analysis, the significant difference existed in Asian population, but no significance was found in European population (P<0.05. Conclusions There is a positive correlation between hypertrophic cardiomyopathy and ACE I/D polymorphism in population, and D allele and DD genotype are likely to be the risk factors of hypertrophic cardiomyopathy. But such correlation does not exist in European population. DOI: 10.11855/j.issn.0577-7402.2013.12.07
Lifescience Database Archive (English)
Full Text Available List Contact us BodyParts3D Table of 3D organ model IDs and organ names (PART-OF Tree) Data detail Data name Table of 3D org...an model IDs and organ names (PART-OF Tree) DOI 10.18908/lsdba.nbdc00837-002 Description of ...data contents List of downloadable 3D organ models in a tab-delimited text file format, describing the correspondence between 3D org...an model IDs and organ names available in PART-OF Tree. D...atabase Site Policy | Contact Us Table of 3D organ model IDs and organ names (PART-OF Tree) - BodyParts3D | LSDB Archive ...
Wardenaar, Klaas J.; van Veen, Tineke; Giltay, Erik J.; den Hollander-Gijsman, Margien; Penninx, Brenda W. J. H.; Zitman, Frans G.
Background: The Inventory of Depressive Symptomatology Self Report (IDS-SR) is a widely used but heterogeneous measure of depression severity. Insight in its factor structure and dimensionality could help to develop more homogeneous IDS-SR subscales. However previous factoranalytical studies have
Quasi-elastic Scattering Measurements in the 6,7Li+144Sm Systems
International Nuclear Information System (INIS)
Capurro, O. A.; Arazi, A.; Fernandez Niello, J. O.; Figueira, J. M.; Marti, G. V.; Martinez Heimann, D.; Negri, A. E.; Pacheco, A. J.; Monteiro, D. S.; Otomar, D. R.; Gomes, P. R. S.; Guimaraes, V.
2009-01-01
In the present work, results of measurements of quasi-elastic scattering cross sections using a silicon-telescope detector at backward angles are reported. They allowed us to deduce fusion barrier distributions from the first derivative of the corresponding excitation function (-d(dσ qes /dσ Rut )/dE). We report data for the systems 6,7 Li on 144 Sm which are characterized by loosely bound projectiles onto a closed neutron shell target. The experimental excitation functions and the associated barrier distributions are compared for both systems.
2013-02-08
... SECURITIES AND EXCHANGE COMMISSION [File No. 500-1] Advance Nanotech, Inc., Advanced ID Corp., Aeon Holdings, Inc. (n/k/a BCM Energy Partners, Inc.), ANTS Software, Inc., Beauty Brands Group, Inc... current and accurate information concerning the securities of Advanced Nanotech, Inc. because it has not...
Liu, Guohui; Zhou, Tian-Biao; Jiang, Zongpei; Zheng, Dongwen
2015-03-01
The association of the angiotensin-converting enzyme (ACE) insertion/deletion (I/D) gene polymorphism with type-2 diabetic nephropathy (T2DN) susceptibility and the risk of type-2 diabetes mellitus (T2DM) developing into T2DN in Caucasian populations is still controversial. A meta-analysis was performed to evaluate the association of ACE I/D gene polymorphism with T2DN susceptibility and the risk of T2DM developing into T2DN in Caucasian populations. A predefined literature search and selection of eligible relevant studies were performed to collect data from electronic databases. Sixteen articles were identified for the analysis of the association of ACE I/D gene polymorphism with T2DN susceptibility and the risk of T2DM developing into T2DN in Caucasian populations. ACE I/D gene polymorphism was not associated with T2DN susceptibility and the risk of patients with T2DM developing T2DN in Caucasian populations. Sensitivity analysis according to sample size of case (ACE I/D gene polymorphism was not associated with T2DN susceptibility and the risk of patients with T2DM developing T2DN in Caucasian populations. However, more studies should be performed in the future. © The Author(s) 2014.
40 CFR 144.7 - Identification of underground sources of drinking water and exempted aquifers.
2010-07-01
..., all aquifers or parts of aquifers which meet the definition of an “underground source of drinking... underground source of drinking water if it meets the definition in § 144.3. (b)(1) The Director may identify... mineral or hydrocarbon producing. Information contained in the mining plan for the proposed project, such...
de Winter, C. F.; Bastiaanse, L. P.; Hilgenkamp, T. I. M.; Evenhuis, H. M.; Echteld, M. A.
2012-01-01
Hypertension, diabetes, hypercholesterolemia and the metabolic syndrome are important risk factors for cardiovascular disease (CVD). In older people with intellectual disability (ID), CVD is a substantial morbidity risk. The aims of the present study, which was part of the Healthy Ageing in Intellectual Disability (HA-ID) study, were (1) to…
Influência do polimorfismo I/D do gene da eca na HPE de jovens normotensos
Directory of Open Access Journals (Sweden)
Manuella de Oliveira Fernandes
2015-08-01
Full Text Available INTRODUÇÃO: A hipotensão pós-exercício (HPE é considerada uma estratégia não farmacológica adotada para redução da pressão arterial (PA. Ademais, sabe-se que a presença de alguns polimorfismos genéticos influencia a resposta pressórica, como o I/D do gene da enzima conversora da angiotensina (ECA. Objetivo: Analisar a influência do polimorfismo I/D da ECA sobre a HPE após três diferentes intensidades de exercício em jovens normotensos e fisicamente ativos.MÉTODOS: Vinte e seis jovens saudáveis (DD = 11; ID/II = 15 realizaram uma sessão máxima de 1.600 metros, na pista de atletismo e outras três sessões experimentais (Sessão Moderada: 6% abaixo do limiar anaeróbio, Sessão Intensa: 6% acima do limiar anaeróbio e Sessão de Controle, com aferições prévias da PA, por 20 minutos e posteriores ao exercício por 60 minutos.RESULTADOS: Observou-se que o exercício moderado ocasionou HPE independentemente do grupo genotípico, sendo mais evidente para a pressão arterial sistólica nos momentos 45 minutos e 60 minutos (p ≤ 0,05. Verificou-se também que a característica gênica exerceu influência sobre a área abaixo da curva pressórica (p ≤ 0,005 sobre a pressão arterial diastólica, formada 1 hora após o exercício.CONCLUSÃO: Conclui-se que o exercício moderado ocasiona HPE em jovens normotensos e fisicamente ativos, independentemente do polimorfismo I/D no gene da ECA, sendo que esse polimorfismo exerce influência sobre a hipotensão diastólica, e os indivíduos portadores do alelo I apresentam maior decaimento da PA diastólica (PAD.
Validation of the Inventory of Depressive Symptomatology (IDS) in Cocaine Dependent Inmates.
Suris, Alina; Kashner, T. Michael; Gillaspy, James A., Jr.; Biggs, Melanie; Rush, A. John
2001-01-01
While the reliability and validity of Inventory of Depressive Symptomatology (IDS) scores have been established with outpatient adults being treated in community psychiatric clinics, it has not been used in special or dually diagnosed populations. Establishes internal consistency, concurrent validity, and construct validity for both the clinical…
Directory of Open Access Journals (Sweden)
Muhammad Syaifullah
2017-11-01
Full Text Available Learning Arabic qowa'id student Syari'ah Banking Second semester Ma'arif Institute of Islamic NU Metro Lampung still not maximized. Students have difficulties to understand Arabic qowa'id material. Student learning motivation is also low. This is what makes researchers want to do research in that class. Problems to be expressed in this research are: (1 How is the application of Arabic qowa'id learning with cooperative model of jigsaw method in class A, second semester of Syari'ah Banking, (2 How to improve learning qowa'id after getting learning with cooperative learning model of jigsaw method, (3 What are the advantages and disadvantages of implementing cooperative Arabic qawaid in class A with jigsaw method. This research is a classroom action research conducted in two cycles. Each cycle is done in a cycle consisting of four stages: planning, execution, observation and reflection. The results of this study indicate an increase from cycle I of cycle II. The average class cycle I is 60.83 and the average of cycle II is 71. The students also show behavior change in the positive direction. Student activity is increasing. The improvement of test result is also followed by behavioral and motivational change based on research which has been done by the researcher that through cooperative learning with jigsaw method, Arabic qowa'id learning becomes more fun and easier for students in learning qowa'id. Suggestions that can be given is a lecturer of Arabic language should be more creative in using techniques and learning methods that involve the active role of student learning so that the learning process to get the maximum value. One alternative of learning Arabic qowa'id is by using cooperative learning jigsaw model.
Directory of Open Access Journals (Sweden)
Alberto Morales
1983-06-01
Full Text Available Se realizó un experimento con el objeto de investigar la capacidad del mosquito Psorophora confinnis para transmitir por picadura a ratones blanco-suizos de 21 días una cepa de virus de encefalitis equina venezolana, subgrupo ID. Cuando los mosquitos se alimentaron sobre hamster con altas viremias (7.5, 6.5 y 6.3 dex en 0.1 ml. de suero, los porcentajes de infección de los mosquitos y los de transmisión fueron altos. Sin embargo, cuando los mosquitos se alimentaron sobre Proechimys hendei con viremias bajas (1,4 y 2.6 dex en 0.1 ml. de suero el porcentaje de infección de los mosquitos fue muy bajo y no hubo transmisión. Cuando la viremia en el Proechimys fue de 4.4 dex en 0.1 ml. de suero, el porcentaje de infección de los mosquitos aumentó y hubo transmisión baja (9%. Los resultados sugieren que Psorophora confinnis es un mosquito que tiene un alto umbral de infección para EEV subgrupo ID.
International Nuclear Information System (INIS)
Rajan, N.; Nigam, A.K.
1984-01-01
The total electronic absorption coefficient for 14.4 keV gamma photons in aluminium, has been measured experimentally, for the first time, using the Moessbauer effect as a monochromator. This data is important for the determination of background in Moessbauer recoilless fraction measurements especially if the energy of X-rays of the source host lattice lie near the 14.4 keV photon energy (e.g. in Rh and Pd) in which case electronic absorption coefficients should be known precisely. The coefficient obtained by interpolation from available values at other energies differ from our experimental value by as much as 20%. It is shown that this can lead to errors, in recoilless fraction values, which are far from negligible. The above absorption coefficient for aluminium was measured to be 11+-1 cm 2 /g. (orig.)
Developments in time-resolved x-ray research at APS beamline 7ID
Energy Technology Data Exchange (ETDEWEB)
Walko, D. A., E-mail: d-walko@anl.gov; Adams, B. W.; Doumy, G.; Dufresne, E. M.; Li, Yuelin; March, A. M.; Sandy, A. R.; Wang, Jin; Wen, Haidan; Zhu, Yi [Advanced Photon Source, Argonne National Laboratory, Argonne, IL 60439 (United States)
2016-07-27
The 7ID beamline of the Advanced Photon Source (APS) is dedicated to time-resolved research using x-ray imaging, scattering, and spectroscopy techniques. Time resolution is achieved via gated detectors and/or mechanical choppers in conjunction with the time structure of the x-ray beam. Three experimental hutches allow for a wide variety of experimental setups. Major areas of research include atomic, molecular, and optical physics; chemistry; condensed matter physics in the bulk, thin film, and surface regimes; and fluid-spray dynamics. Recent developments in facilities at 7ID include a high-power, high-repetition-rate picosecond laser to complement the 1 kHz ultrafast laser. For the ultrafast laser, a newly commissioned optical parametric amplifier provides pump wavelength from 0.2 to 15 µm with energy per pulse up to 200 µJ. A nanodiffraction station has also been commissioned, using Fresnel zone-plate optics to achieve a focused x-ray spot of 300 nm. This nanoprobe is not only used to spatially resolve the evolution of small features in samples after optical excitation, but also has been combined with an intense THz source to study material response under ultrafast electric fields.
Dielectric parameters of blood plasma of rats treated with cerium-144 and external irradiation
International Nuclear Information System (INIS)
Hadzhidekova, E.; Kiradzhiev, G.; Paskalev, Z.; Miloslavov, V.
1988-01-01
Investigation was carried out of the dielectric parameters of blood plasma of male Wistar rats treated with cerium 144 in doses of 370 kBq/animal and external gamma irradiation in doses of 200 cGy and 400 cGy. The radioactive cerium was introduced intraperitoneally 1 h after the external irradiation with dose rate of 1,6 cGy/sec. The permittivity ε, the time of relaxation τ and the coefficient of Debaye κ of plasma protein molecules were determined at the 1st, 3rd, 10th, 15th, and 30th days after treatement for frequence ranges of 1,4, 2,2, 3,6 and 6 MHz. At the same terms the content of cerium 144 was measured in the organs of predilectional accumulation of cerium. It was established that the treatment only with cerium lead to most essential changes of dielectric parameters at frequence of 3,6 MHz. The external irradiation didn't influence essentially the kinetics of absorbed cerium. In combination of both radiation factors the action of cerium was predominant
Evaluation of the RapID-ANA system for identification of anaerobic bacteria of veterinary origin.
Adney, W S; Jones, R L
1985-12-01
This study evaluated the ability of the RapID-ANA system (Innovative Diagnostic Systems, Inc., Atlanta, Ga.) to accurately identify a spectrum of freshly isolated veterinary anaerobes. A total of 183 isolates were tested and included 7 Actinomyces spp., 53 Bacteroides spp., 32 Clostridium spp., 2 Eubacterium spp., 65 Fusobacterium spp., 1 Peptococcus spp., 22 Peptostreptococcus spp., and 1 Propionibacterium spp. All isolates were initially identified by conventional biochemical testing and gas-liquid chromatography of short-chain fatty acid metabolites. Additional tests were performed as required by the RapID-ANA system. Of these isolates, 81.4% were correctly identified to the genus level, including 59.6% to the species level, 14.2% were incorrectly identified at the genus level, and 4.4% were not identified. Initially, 20.2% of the strains were not identified because the microcodes were not in the code book. The majority of the incorrect identifications were caused by the misidentification of Fusobacterium spp. as Bacteroides spp. Errors also occurred when veterinary anaerobes not included in the data base were assigned an identification from the existing data base. The RapID-ANA system appears to be a promising new method for rapid identification of veterinary anaerobes; however, further evaluation with an extended data base is needed before the system can accurately identify all clinically significant anaerobes.
International Nuclear Information System (INIS)
Jorda, Mireia; Vinyals, Antonia; Marazuela, Anna; Cubillo, Eva; Olmeda, David; Valero, Eva; Cano, Amparo; Fabra, Angels
2007-01-01
Id-1, a member of the helix-loop-helix transcription factor family has been shown to be involved in cell proliferation, angiogenesis and invasion of many types of human cancers. We have previously shown that stable expression of E47 and Snail repressors of the E-cadherin promoter in MDCK epithelial cell line triggers epithelial mesenchymal transition (EMT) concomitantly with changes in gene expression. We show here that both factors activate the Id-1 gene promoter and induce Id-1 mRNA and protein. The upregulation of the Id-1 gene occurs through the transactivation of the promoter by the Erk/MAPK signaling pathway. Moreover, oncogenic Ras is also able to activate Id-1 promoter in MDCK cells in the absence of both E47 and Snail transcription factors. Several transcriptionally active regulatory elements have been identified in the proximal promoter, including AP-1, Sp1 and four putative E-boxes. By EMSA, we only detected an increased binding to Sp1 and AP-1 elements in E47- and Snail-expressing cells. Binding is affected by the treatment of cells with PD 98059 MEK inhibitor, suggesting that MAPK/Erk contributes to the recruitment or assembly of proteins to Id-1 promoter. Small interfering RNA directed against Sp1 reduced Id-1 expression and the upregulation of the promoter, indicating that Sp1 is required for Id-1 induction in E47- and Snail-expressing cells. Our results provide new insights into how some target genes are activated during and/or as a consequence of the EMT triggered by both E47 and Snail transcription factors
Using Efficient TRNGs for PSEUDO Profile in National eID Card
Blerim Rexha; Dren Imeraj; Isak Shabani
2018-01-01
Applications that requires true random number generator (TRNG), which uses raw analog data generated from any noise source in nature, must convert the source normal distribution to uniform distribution. Many up to date implementations convert the raw analog data into digital data by employing a comparator or a Schmitt trigger. This method wastes a large amount of random input data, lowering the throughput of the TRNG. In new national electronic identity card (eID) beyond the true identity of ...
Projectc conception for city logistics with utilization of IDS element applicated to the Nitra city
Directory of Open Access Journals (Sweden)
Michal Balog
2010-02-01
Full Text Available Nowadays traffic situation in the town-residential area is characterized by growing requirement for quality and quantityof transfer performance and services that result in congestion increasing in the some towns. Currently the similar problem has Nitracity, where it is necessary to solve this situation immediately. One of the possibilities of increasing traffic fluency is to extend roads, butin case of Nitra that possibility is irrelevant because of non-available space. Other possibility is an utilization of IDS elements(Intelligent Transport System. The contribution presents the conception of transportation in the town, founded on creation of trafficcircles with subsequent IDS elements application.
Zorina, Olesya I; Haueis, Patrick; Semmler, Alexander; Marti, Isabelle; Gonzenbach, Roman R; Guzek, Markus; Kullak-Ublick, Gerd A; Weller, Michael; Russmann, Stefan
2012-08-01
The comparative evaluation of clinical decision support software (CDSS) programs regarding their sensitivity and positive predictive value for the identification of clinically relevant drug interactions. In this research, we used a cross-sectional study that identified potential drug interactions using the CDSS MediQ and the ID PHARMA CHECK in 484 neurological inpatients. Interactions were reclassified according to the Zurich Interaction System, a multidimensional classification that incorporates the Operational Classification of Drug Interactions. In 484 patients with 2812 prescriptions, MediQ and ID PHARMA CHECK generated a total of 1759 and 1082 alerts, respectively. MediQ identified 658 unique potentially interacting combinations, 8 classified as "high danger," 164 as "average danger," and 486 as "low danger." ID PHARMA CHECK detected 336 combinations assigned to one or several of 12 risk and management categories. Altogether, both CDSS issued alerts relating to 808 unique potentially interacting combinations. According to the Zurich Interaction System, 6 of these were contraindicated, 25 were provisionally contraindicated, 190 carried a conditional risk, and 587 had a minimal risk of adverse events. The positive predictive value for alerts having at least a conditional risk was 0.24 for MediQ and 0.48 for ID PHARMA CHECK. CDSS showed major differences in the identification and grading of interactions, and many interactions were only identified by one of the two CDSS. For both programs, only a small proportion of all identified interactions appeared clinically relevant, and the selected display of alerts that imply management changes is a key issue in the further development and local setup of such programs. Copyright © 2012 John Wiley & Sons, Ltd.
The impact of clinical pharmacist and ID intervention in rationalization of antimicrobial use.
Al-Somai, Niaz; Al-Muhur, Mohammed; Quteimat, Osama; Hamzah, Nashaat
2014-12-01
There is little research on the impact of implementing and monitoring antimicrobial policy in Saudi hospitals. The purpose of this study is to measure the impact of the clinical pharmacist (CP) and infectious disease consultant (ID) interventions on the use of three antimicrobials (caspofungin, imipenem, meropenem) in hospitalized patients in the King Abdullah Medical City hospital. The study was carried out in the King Abdullah Medical City, in Mekkah, Saudi Arabia. The hospital is a tertiary center that provides CCU, CSICU, Cardiac, Hematology, ICU, Medical, Neuroscience, Oncology, and specialized surgery services. The use of three antimicrobials (caspofungin, imipenem, meropenem) was reviewed by the clinical pharmacist for four periods, pre and post implementation of policy. Relevant data were collected in four periods. In the first period, before policy implementation, data were collected retrospectively to be used as baseline status reference, and in the three remaining periods that followed data were collected prospectively, and compared to baseline data, to evaluate the role of clinical pharmacist and ID interventions in optimizing antimicrobial therapy. Caspofungin duration of therapy was not affected significantly by the intervention. Statistically significant reduction in antimicrobial therapy duration was observed in imipenem (37%) and meropenem (37%) from baseline, which indicate a better control on antimicrobial use and reduction in antimicrobial resistance. The impact of the clinical pharmacist and ID interventions, in reducing antimicrobial therapy duration using imipenem and meropenem, is clear from the result presented above. However, lack of restriction and follow up in the antimicrobial policy in case of negative culture makes antimicrobial use uncontrollable in these cases. Establishing good and accepted policy may help reduce consumption and total cost of therapy.
Minimization of Antinutrients in Idli by Using Response Surface Process Optimization
Sharma, Anand; Kumari, Sarita; Nout, Martinus J.R.; Sarkar, Prabir K.
2017-01-01
Deploying response surface methodology, the stages of idli preparation were optimized for minimizing the level of antinutrients. Under optimum conditions of soaking blackgram dal (1:5 of dal and water at 16C, and pH 4.0 for 18 h) and rice (1:5 of rice and water at 16C, and pH 5.6 for 18 h), the
Directory of Open Access Journals (Sweden)
Noorfiya Umniyati
2017-06-01
Full Text Available Penelitian ini bertujuan untuk mengukur pengaruh terpaan informasi riset di Pusat Penelitian Elektronika dan Telekomunikasi LIPI melalui website www.ppet.lipi.go.id terhadap sikap mahasiswa mengenai penelitian. Tujuan penelitian ini untuk mengetahui besarnya pengaruh jumlah waktu yang digunakan dalam mengakses informasi terhadap sikap mahasiswa mengenai penelitian, isi pesan terhadap sikap mahasiswa mengenai penelitian, dan hubungan individu dengan media terhadap sikap mahasiswa mengenai penelitian. Penelitian ini menggunakan metode kuantitatif dengan analisis jalur. Hasil penelitian ini menunjukan bahwa secara keseluruhan terpaan informasi riset melalui website www.ppet.lipi.go.id berpengaruh secara signifikan terhadap sikap mahasiswa Teknik Telekomunikasi Telkom University mengenai penelitian. Secara parsial, hasil penelitian menunjukkan bahwa variabel jumlah waktu yang digunakan dalam informasi dan variabel hubungan individu dengan media memberikan pengaruh yang siginifikan terhadap sikap mahasiswa mengenai penelitian. Sedangkan variabel isi pesan tidak memberikan pengaruh yang siginifikan karena memberikan pengaruh yang sedikit. Kesimpulan pada penelitian ini menunjukan bahwa secara keseluruhan informasi riset telah melakukan terpaan cukup besar terhadap sikap mahasiswa jurusan Teknik Telekomunikasi Telkom University mengenai penelitian yang mengakses website www.ppet.lipi.go.id.
Directory of Open Access Journals (Sweden)
Güldane
2016-12-01
Full Text Available The dervish lodge cuisine in the Ottoman lodge structuring has a central importance. The lodge cuisine helped Anatolia turn into a homeland. Travelers took shelter in the lodges in Anatolia. So, these buildings were a safe haven for those who travel. Lodge’s kitchens were always open. These kitchens offered a delightful “Sheikh Baba’s Soup” anytime and these kitchens gave peace and serenity to Anatolia. This article analyzes the Ottoman lodge food culture in the context of a manuscript which belongs to an imaret. This manuscript called Majmūʿa al-fawāʾid was written in between 1240-1250 (1825-1835 in Istanbul. This work belongs to the period of Sultan Mahmud II and the Hudāyī Lodge Foundation. Institution Employees and accounting records were disclosed in this manuscript in which the names of kitchenware are mentioned and recipes are found. This work gives detailed information about foods that are cooked in the Hudāyī Lodge Foundation’s imaret kitchen. SUMMARY Eating is thought always to be important and it is considered worthwhile to eat with guests and travelers in Turkish culture. In the process of Islamization, the dining table was accepted “Halil İbrahim’s Table” and this approach has strengthened further the hospitality. Eating with people, preparing the table for the guests, travelers and the needy were regarded as a factor increasing the fertility of the table. In addition, these movements were considered an act of social cooperation and deepen the collective consciousness. Especially the sufis played a dominant role in the process of Islamization in Anatolia and depending on this, they undertook various social and cultural functions that including catering. In this regard, the lodge was seen as a complex and this structure encompasses different units such as imaret or soup kitchen, mosque, tomb, library, dervish cells, public fountains, bakery and bathhouse. Travelers stay in the imaret and supply their needs
Confinement margins for ignition and driven operation in Iter Eda ID
International Nuclear Information System (INIS)
Johner, J.
1995-09-01
Preliminary calculations for ITER EDA ID have been performed using the 1/2D thermal equilibrium code HELIOS. It is found that: - The maximum ignition margin for ITER ID (29%) is 6% less than for ITER OD (35%) and 5% less than for ITER CDA (34%). - Decreasing the ration τ * He /τ E from the nominal value 10 to a value of 5 gives a 12% gain in the maximum ignition margin. Increasing the ration from 10 to 15 causes a 22% loss in the margin. Furthermore, ignited equilibria non longer exist for τ * He /τ E ≥ 17.6. - Operation in driven mode with 50 MW of external power increases the confinement capability by 13%. With 100 MW, the improvement is 24%. - Lowering the fusion power from 1500 to 1000 MW slightly improves the maximum ignition margin (+5%) and allows operation below the Greenwald density limit. - A 10% reduction of the toroidal magnetic field with a correlative diminution of the plasma current for constant safety factor operation, causes a dramatic reduction (-18%) of the maximum ignition margin. - A fraction of neon of 0.68% would completely suppress the ignition margin. Furthermore, ignited equilibria, with the nominal fusion power and τ * He /τ E , no longer exist when the neon fraction exceeds 0.75%. (Author). 2 refs., 10 figs
International Nuclear Information System (INIS)
Benjamin, S.A.; Jones, R.K.; Snipes, M.B.; Lustgarten, C.S.
1976-01-01
Dogs that have inhaled relatively insoluble forms of either alpha- or beta-emitting radionuclides manifest a peripheral lymphopenia, the development and course of which depends on both total dose and dose rate. The remaining peripheral lymphocytes in dogs exposed to longer lived beta-emitting radionuclides showed a depressed function as measured by the ability to respond to plant mitogens in vitro. This experiment was designed to evaluate the effect of dose rate on peripheral lymphocyte function by exposing dogs to aerosols of radionuclides with varied effective half-lives in the lung: 90 Y (2.6 days), 144 Ce (170 days), and 90 Sr (650 days). Three groups of four adult beagle dogs each were exposed by inhalation to 90 Y, 144 Ce, or 90 Sr in fused-clay particles. Two controls were matched with each group. Initial lung burdens and initial dose rates to the lung were 520 to 610 μCi/kg of body weight and 2200 to 2600 rads/day in the 90 Y group, 33 to 60 μCi/kg and 200 to 350 rads/day in the 144 Ce group, and 25 to 32 μCi/kg and 130 to 170 rads/day in the 90 Sr group. Hematologic parameters and lymphocyte function as measured by the ability of lymphocytes to respond to plant mitogen stimulation were evaluated on a weekly or biweekly basis for 8 weeks after exposure and on a monthly basis thereafter. The 90 Y-exposed dogs showed a marked lymphopenia within 1 week with a return to control levels by 20 weeks after exposure. The remaining peripheral lymphocytes, however, showed no functional changes in these dogs. Animals exposed to 144 Ce or 90 Sr developed a progressive and persisent lymphopenia and showed functional depression of the remaining lymphocytes as well. The relationships among dose pattern, lymphopenia, and lymphocyte-function depression are discussed
Lofthouse, Rachael; Golding, Laura; Totsika, Vasiliki; Hastings, Richard; Lindsay, William
2017-12-01
Risk assessments assist professionals in the identification and management of risk of aggression. The present study aimed to systematically review evidence on the efficacy of assessments for managing the risk of physical aggression in adults with intellectual disabilities (ID). A literature search was conducted using the databases PsycINFO, EMBASE, MEDLINE, Web of Science, and Google Scholar. Electronic and hand searches identified 14 studies that met the inclusion criteria. Standardised mean difference effect sizes Area Under Curve (AUC) were calculated for studies. Random effects subgroup analysis was used to compare different types of risk measures (Actuarial, Structured Professional Judgment and dynamic), and prospective vs. catch-up longitudinal study designs. Overall, evidence of predictive validity was found for risk measures with ID populations: (AUC)=0.724, 95% CI [0.681, 0.768]. There was no variation in the performance of different types of risk measures, or different study design. Risk assessment measures predict the likelihood of aggression in ID population and are comparable to those in mainstream populations. Further meta-analysis is necessary when risk measures are more established in this population. Copyright © 2017 Elsevier Ltd. All rights reserved.
Pérez-Cabré, Elisabet; Millán, María S.; Javidi, Bahram
2006-09-01
Verification of a piece of information and/or authentication of a given object or person are common operations carried out by automatic security systems that can be applied, for instance, to control the entrance to restricted areas, access to public buildings, identification of cardholders, etc. Vulnerability of such security systems may depend on the ease of counterfeiting the information used as a piece of identification for verification and authentication. To protect data against tampering, the signature that identifies an object is usually encrypted to avoid an easy recognition at human sight and an easy reproduction using conventional devices for imaging or scanning. To make counterfeiting even more difficult, we propose to combine data from visible and near infrared (NIR) spectral bands. By doing this, neither the visible content nor the NIR data by theirselves are sufficient to allow the signature recognition and thus, the identification of a given object. Only the appropriate combination of both signals permits a satisfactory authentication. In addition, the resulting signature is encrypted following a fully-phase encryption technique and the obtained complex-amplitude distribution is encoded on an ID tag. Spatial multiplexing of the encrypted signature allows us to build a distortion-invariant ID tag, so that remote authentication can be achieved even if the tag is captured under rotation or at different distances. We also explore the possibility of using partial information of the encrypted signature to simplify the ID tag design.
Inspection of cup-shaped steel parts from the I.D. side using eddy current
Griffiths, Erick W.; Pearson, Lee H.
2018-04-01
An eddy current method was developed to inspect cup-shaped steel parts from the I.D. side. During the manufacturing process of these parts, a thin Al tape foil is applied to the I.D. side of the part. One of the critical process parameters is that only one foil layer can be applied. An eddy current inspection system was developed to reject parts with more than one foil layer. The Al tape foil is cut to length to fit the inner diameter, however, after application of the foil there is a gap created between the beginning and end of the foil. It was found that this gap interfered with the eddy current inspection causing a false positive indication. To solve this problem a sensor design and data analysis process were developed to overcome the effects of these gaps. The developed system incorporates simultaneous measurements from multiple eddy current sensors and signal processing to achieve a reliable inspection.
Directory of Open Access Journals (Sweden)
Anukriti Singh
2018-04-01
Full Text Available Renin angiotensin system (RAS comprising Angiotensin converting enzyme (ACE, Angiotensin II (Ang II and its receptor Angiotensin II receptor type I (AGTR1, plays a critical role in several diseases including cancer. A single nucleotide polymorphism (SNP A1166C located in 3′ untranslated region (UTR of AGTR1 and an insertion/deletion (I/D polymorphism present in intron 16 of ACE gene have been associated with many diseases, but their association with Breast cancer (BCa is still debatable. Here, we for the first time investigated the association of these polymorphisms in a North Indian BCa cohort including 161 patients and 152 healthy women. The polymorphisms were evaluated by polymerase chain reaction (PCR and restriction fragment length polymorphism (RFLP respectively. The association between these polymorphisms and BCa risk was estimated by calculating Odds Ratio (OR and chi-square (χ2 test. The DD genotype/D allele of ACE (I/D polymorphism and “AC and CC” genotype/C allele of AGTR1 (A1166C polymorphism were associated with higher risk of BCa when evaluated independently. Furthermore, interaction analysis of “AC and CC” and DD genotype and combination of “C and D” alleles of both polymorphisms revealed significantly greater BCa risk than that observed independently. Conclusively, women harboring “AC or CC” genotype/C allele for AGTR1 (A1166C polymorphism and DD genotype/D allele for ACE (I/D polymorphisms have a predisposition to develop more aggressive disease with advanced staging and larger tumor size. Our study indicates importance of genetic screening based on these polymorphisms for women, who may have higher risk of BCa.
Penerimaan Masyarakat terhadap Website P3M.Sidoarjokab.go.id
Ningrum, Dyah Ary Setya; Rochmaniah, Ainur
2016-01-01
This study aimed to describe community reception of website P3M.sidoarjokab.go.id. This research used descriptive qualitative method with in-depth interview technique. The focus of this research discussed perception, thinking, preference, interpretation, ease of use, easy of finding information, design of page, web traffic and search in website of Complaint Service Center (P3M). Data analysis technique in this research used interactive analysis, with five informant. The research found that P3...
International Nuclear Information System (INIS)
1996-06-01
The foundation conducts an environmental monitoring and surveillance program over an area covering much of the upper Snake River Plain and provide environmental education and support services related to INEL natural resource issues. Also, the foundation, with its university affiliates, conducts ecological and radioecological research on the Idaho National Environmental Research Park. This research benefits major DOE-ID programs including waste management, environmental restoration, spent nuclear fuels, and land management issues. Major accomplishments during CY1995 can be divided into five categories: environmental surveillance program, environmental education, environmental services and support, ecological risk assessment, and research benefitting the DOE-ID mission
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-06-01
The foundation conducts an environmental monitoring and surveillance program over an area covering much of the upper Snake River Plain and provide environmental education and support services related to INEL natural resource issues. Also, the foundation, with its university affiliates, conducts ecological and radioecological research on the Idaho National Environmental Research Park. This research benefits major DOE-ID programs including waste management, environmental restoration, spent nuclear fuels, and land management issues. Major accomplishments during CY1995 can be divided into five categories: environmental surveillance program, environmental education, environmental services and support, ecological risk assessment, and research benefitting the DOE-ID mission.
International Nuclear Information System (INIS)
Umetani, Tomohiro; Morioka, Jun-ichi; Tamura, Yuichi; Inoue, Kenji; Arai, Tatsuo; Mae, Yasusi
2011-01-01
This paper describes a method for the automated estimation of three-dimensional pose (position and orientation) of objects by autonomous robots, using multiple identification (ID) devices. Our goal is to estimate the object pose for assembly or maintenance tasks in a real nuclear fusion reactor system, with autonomous robots cooperating in a virtual assembly system. The method estimates the three-dimensional pose for autonomous robots. This paper discusses a method of motion generation for ID acquisition using the sensory data acquired by the measurement system attached to the robots and from the environment. Experimental results show the feasibility of the proposed method. (author)
Exploring the Link between ACE Insertion/Deletion (I/D Polymorphism and Uterine Leiomyomas
Directory of Open Access Journals (Sweden)
Shirin Shahbazi
2017-03-01
Full Text Available Introduction: Uterine leiomyomas arise from the proliferation of smooth muscle cells. ACE gene encodes a convertase enzyme mainly secreted in vascular endothelial cells which is involved in the renin–angiotensin system and blood pressure controlling. This gene has an insertion/deletion (I/D polymorphism correlates to serum and tissue ACE levels. The aim of this study is to elucidate the relationship between ACE gene variation and the development of myom. Methods: The samples of 55 uterine leiomyoma patients and 78 healthy women were studied. After obtaining informed consent, blood samples were collected and DNA extraction was performed by Salting-out method. Genotyping was performed using PCR reaction. The amplified products were two bands of 190 and 490 bp, which represents D allele and I allele, respectively. Statistical analysis was done using Chi-square test. Results: The D allele frequency was 0.55 in the patient group and 0.51 in the control group. The I allele frequencies in the two groups were 0.45 and 0.49, respectively. The results showed that taking the II genotype into account as reference genotype; homozygous DD individuals were at increased risk of uterine myoma (Odds ratio: 1.37. However, heterozygous ID showed a similar risk with the II genotype as the reference group. Conclusion: High blood pressure is significantly associated with uterine fibroids. It has been shown that atherosclerotic damage of uterine blood vessels and the inflammatory process caused by it may play an important role in the development of uterine myoma. This study indicates a positive relationship between the ACE (I/D polymorphism and the risk of uterine myoma. This finding is evidence of the important role of the renin–angiotensin system in the pathogenesis of myoma
Dong, Hye-Jin; Jang, Gyu-Beom; Lee, Hwa-Yong; Park, Se-Ra; Kim, Ji-Young; Nam, Jeong-Seok; Hong, In-Sun
2016-03-11
Hypoxia, a feature common to most solid tumors, is known to regulate many aspects of tumorigenesis. Recently, it was suggested that hypoxia increased the size of the cancer stem-cell (CSC) subpopulations and promoted the acquisition of a CSC-like phenotype. However, candidate hypoxia-regulated mediators specifically relevant to the stemness-related functions of colorectal CSCs have not been examined in detail. In the present study, we showed that hypoxia specifically promoted the self-renewal potential of CSCs. Through various in vitro studies, we found that hypoxia-induced Wnt/β-catenin signaling increased the occurrence of CSC-like phenotypes and the level of Id2 expression in colorectal-cancer cells. Importantly, the levels of hypoxia-induced CSC-sphere formation and Id2 expression were successfully attenuated by treatment with a Wnt/β-catenin-signaling inhibitor. We further demonstrated, for the first time, that the degree of hypoxia-induced CSC-sphere formation (CD44(+) subpopulation) in vitro and of tumor metastasis/dissemination in vivo were markedly suppressed by knocking down Id2 expression. Taken together, these data suggested that Wnt/β-catenin signaling mediated the hypoxia-induced self-renewal potential of colorectal-cancer CSCs through reactivating Id2 expression.
Directory of Open Access Journals (Sweden)
José Alberto Rodrigues Pedroso
2010-06-01
Full Text Available A síndrome de disfunção de múltiplos órgãos e sistemas (DMOS e a disfunção renal aguda compartilham muitos dos fatores fisiológicos envolvidos em seu desenvolvimento. Estudos recentes correlacionam suscetibilidades individuais, determinadas geneticamente, à disfunção de órgãos em pacientes criticamente enfermos, situação em que o gene da enzima conversora da angiotensina (ECA poderia ser um candidato para elucidar predisposição ou risco genético. Nosso objetivo foi examinar os efeitos da presença de dois polimorfismos, I/D e -262A > T, na disfunção renal em pacientes agudamente graves do Sul do Brasil. O escore SOFA (sequential organ failure assessment à admissão e a tendência da função renal (medida pelo escore renal diário do SOFA foram determinados em pacientes de unidade de terapia intensiva (UTI. Um total de 153 pacientes adultos (79 homens foi incluído no estudo. Houve monitoração diária da função renal durante toda a permanência na UTI e também pós-UTI. Observou-se a progressão para insuficiência renal (SOFA 3 e 4 nos primeiros sete dias de internação em UTI, bem como necessidade de diálise. As frequências genotípicas gerais em nossa amostra foram II = 0,17; ID = 0,46; DD = 0,37; e AA = 0,30; AT = 0,55; TT = 0,15; e as frequências alélicas foram I = 0,40, D = 0,60; e A = 0,56; T = 0,44. Este é o primeiro estudo para verificar a influência de polimorfismos I/D e -262A > T da ECA em disfunção renal aguda em pacientes críticos. Nenhuma associação significativa foi encontrada entre os genótipos ou as frequências alélicas e a evolução da função renal. Os polimorfismos I/D e -262A > T da ECA não têm impacto significativo sobre a evolução da função renal durante a primeira semana de internação na UTI nem exercem qualquer influência sobre a mortalidade em pacientes graves.Multiple organ failure syndrome and acute renal dysfunction share many of physiologic factors involved in
Directory of Open Access Journals (Sweden)
Susana Aparecida da Silva
2012-08-01
Full Text Available Esta pesquisa reflete a respeito da possibilidade de se analisar a idéia de tempo na Espanha Barroca do século XVII através de cinco retratos feitos pelo pintor espanhol Diego Velázquez (1599-1660. Estes retratos são feitos após o período em que o pintor é admitido na corte de Felipe IV da Espanha (1605-1665 como pintor oficial. As fontes visuais selecionadas para esta pesquisa no sentido de possibilitar a análise da idéia de tempo são retratos do rei feitos por Diego Velázquez e representam o rei jovem e posteriormente envelhecido. Acredita-se que a idéia de tempo para Velázquez tenha estreita relação com a sociedade barroca espanhola do século XVII na qual ele está inserido. Neste sentido, as representações do poder e do envelhecimento do monarca possíveis de serem vistas nas pinturas de Velázquez contribuem para se pensar a concepção de tempo do artista e da sociedade espanhola daquele período
Breakup Reactions and Exclusive Measurements in the 6,7Li+144Sm Systems
International Nuclear Information System (INIS)
Heimann, D. Martinez; Pacheco, A. J.; Arazi, A.; Figueira, J. M.; Negri, A. E.; Capurro, O. A.; Carnelli, P.; Fimiani, L.; Grinberg, P.; Marti, G. V.; Testoni, J. E.; Monteiro, D. S.; Niello, J. O. Fernandez; Marta, H. D.
2009-01-01
The breakup of the projectile-like nuclei in reactions induced by 30 MeV 6 Li and 7 Li beams on a 144 Sm target have been measured through the coincident detection of the in-plane emitted light particles. The primary ion that undergoes breakup has been identified and the physically meaningful variables that characterize the reaction have been obtained on a purely experimental basis. Distributions have been obtained for both the binary emission angle and for the breakup emission angle in the reference frame of the breakup products.
2012-03-05
... DEPARTMENT OF AGRICULTURE Forest Service Salmon-Challis National Forest, Butte, Custer and Lemhi Counties, ID, Supplemental Environmental Impact Statement to the 2009 Salmon- Challis National Forest... of intent to prepare a supplemental environmental impact statement. SUMMARY: The Salmon-Challis...
Nestor Capdevila, Le concept d’idéologie, Paris, PUF, 2004, 326 pages, 25 euros.
Directory of Open Access Journals (Sweden)
Marie GAILLE-NIKODIMOV
2005-09-01
Full Text Available Que la philosophie puisse se pratiquer dans toute sa rigueur conceptuelle en s’appliquant à des notions politiques, voilà qui n’a pas été et n’est pas toujours évident pour tous. Le concept d’idéologie de Nestor Capdevila est une lecture tout indiquée pour les sceptiques. Le pari n’est pourtant pas gagné a priori : ce terme, forgé en 1798 par Destutt de Tracy pour désigner la science des idées prises au sens général de perceptions, est on ne peut plus fuyant. S’il n’a pas, à l’origine, la con...
Gloury, Renee; Zotos, Dimitra; Zuidscherwoude, Malou; Masson, Frederick; Liao, Yang; Hasbold, Jhaguaral; Corcoran, Lynn M.; Hodgkin, Phil D.; Belz, Gabrielle T.; Shi, Wei; Nutt, Stephen L.; Tarlinton, David M.
2016-01-01
The generation of high-affinity antibodies requires germinal center (GC) development and differentiation of long-lived plasma cells in a multilayered process that is tightly controlled by the activity of multiple transcription factors. Here, we reveal a new layer of complexity by demonstrating that dynamic changes in Id3 and E-protein activity govern both GC and plasma cell differentiation. We show that down-regulation of Id3 in B cells is essential for releasing E2A and E2-2, which in a redundant manner are required for antigen-induced B cell differentiation. We demonstrate that this pathway controls the expression of multiple key factors, including Blimp1, Xbp1, and CXCR4, and is therefore critical for establishing the transcriptional network that controls GC B cell and plasma cell differentiation. PMID:27217539
International Decommissioning Symposium 2000 (IDS 2000). Final Report
International Nuclear Information System (INIS)
Ebadian, M.A.
2001-01-01
The purpose of IDS 2000 was to deliver a world-class conference on applicable global environmental issues. The objective of this conference was to publicize environmental progress of individual countries, to provide a forum for technology developer and problem-holder interaction, to facilitate environmental and technology discussions between the commercial and financial communities, and to accommodate information and education exchange between governments, industries, universities, and scientists. The scope of this project included the planning and execution of an international conference on the decommissioning of nuclear facilities, and the providing of a business forum for vendors and participants sufficient to attract service providers, technology developers, and the business and financial communities. These groups, when working together with attendees from regulatory organizations and government decision-maker groups, provide an opportunity to more effectively and efficiently expedite the decommissioning projects
International Nuclear Information System (INIS)
Walters, P.E.; Chester, T.L.; Winefordner, J.D.
1977-01-01
Diagnostic measurements of 144 MHz radiofrequency inductively coupled plasmas at pressures between 0.5 and 14 Torr have been made. Other variables studied included the gas type (Ar or Ne) and material in plasma (Ti or Tl). Parameters measured included excitation temperatures via the atomic Boltzmann plot and the two-line method, ionization electric probes. Excitation temperatures increased as the pressure of Ar or Ne plasmas decreased and reached a maximum of approx.9000 degreeK in the latter case and approx.6700 degreeK in the former case; Tl in the Ar plasma resulted in in a smaller rate of decrease of excitation temperature with increase of pressure of Ar. The ionization temperatures were lower than the excitation temperatures and were similar for both the Ar and Ne plasmas. Electron temperatures were about 10 times higher than the excitation temperatures indicating non-LTE behavior. Again, the electron temperatures indicating in Ne were considerably higher than in Ar. With the presence of metals, the electron temperatures with a metal in the Ar plasma were higher than in the absence. Positive ion concentrations were also measured for the various plasmas and were found to be similar (approx.10 18 m -3 ) in both the Ar and Ne plasmas. The presence of metals caused significant increase in the positive ion concentrations. From the results obtained, the optimum Ar pressure for Tl electrodeless discharge lamps operated at 144 MHz would be between 2 and 4 Torr
Karikaturist Aivar Juhanson näitab KuKu klubis oma töid
2009-01-01
Loit Jõekalda kureeritud joonistustriennaali raames eksponeerivad oma töid Ave Avalo, Kärt Hammer, Eero Ijavoinen, Kristjan Kittus, Mari-Liis Laanemaa, Triinu Lille, Valli Lember-Bogatkina jpt. kunstnikud. Ajalehe "Eesti Ekspress" karikaturisti Aivar Juhansoni tööde näitus Tallinnas KuKu klubis
Compact Nd:YAG laser operating at 1.06, 1.32, and 1.44 μm for dental caries effective disinfection
Dostálová, Tat'jana; Jelínková, Helena; Kadlecová, Martina; Němec, Michal; Å ulc, Jan; Fibrich, Martin; Nejezchleb, Karel; Kapitch, Nickalai; Å koda, Václav
2017-02-01
The analysis of the disinfection effect of Nd:YAG laser radiation was investigated for patients with high concentration of Streptococcus mutans in saliva (positive result in Saliva-check mutans test). For the interaction the Nd:YAG laser system generated separate switchable wavelengths with the maximum output energies 1.1, 0.6, and 0.3 J for wavelength 1.06 μm, 1.32, μm and 1.44 μm, respectively, was used. Our study proved that after the laser irradiation the Saliva-check test showed negative presence of Streptococcus mutans. The disinfection effect was confirmed for all used radiation wavelength. For 1.44 μm this effect was reached with a smallest energy density.
Directory of Open Access Journals (Sweden)
Mario Melo
2015-07-01
Full Text Available This study was designed to investigate the effects of two instructional approaches (4C-ID versus conventional on learners’ knowledge-acquisition and learning transfer of the electrical circuits content in Physics. Participants were 129 9th graders from a secondary school in Lisbon, M = 14.3 years, SD = 0.54. The participants were divided in two groups: an experimental group constituted three intact classes (n = 78; and a control group constituted two intact classes (n = 51. The experimental group was taught using a digital learning environment designed with the 4C-ID model principles while the control group learned the same contents through a conventional method. We assessed the students’ performance (knowledge-acquisition and transfer, the perceived cognitive load, and the instructional efficiency. Results indicated that the experimental group performed significantly better than the control group on a knowledge-acquisition test and in a learning transfer test. They also perceived a less cognitive load in the transfer test and the learning environment developed with the 4C-ID model proved to be more instructional efficient than the conventional method.
Directory of Open Access Journals (Sweden)
Isabelle Caby
2016-04-01
Full Text Available Study Design: A controlled and retrospective study of 144 chronic low back pain patients to evaluate the effectiveness of an intensive functional restoration program in France. Objective: Evaluating the efficiency of an intensive, dynamic and multidisciplinary functional restoration program in patients with chronic low back pain (LBP, during 6 and 12 months follow up. Summary of background data: Chronic low back pain disease has a multifactor nature, involving physical, psychological professional and social factors. A functional restoration program (FRP has been included in a multidisciplinary training program which provides an efficient therapeutic solution. However, the effectiveness of an FRP has not been yet established. Methods: 144 subjects (71 males, 73 females with chronic low back pain were included in a functional restoration program. The FRP includes physiotherapy and occupational therapy interventions together with psychological counselling. Patients participated as in- or outpatients 6 h per day, 5 days a week over 5 weeks. Pain intensity, trunk flexibility, trunk strength, lifting ability, quality of life and return to work were recorded before, immediately after, and at 6 months and 12 months after the treatment period. Results: All outcome measures were significantly higher just after the FRP (144 patients and at 6 and 12 months (from available data in 31 subjects compared to pre-treatment values. This FRP for chronic low back pain maintained its benefits whatever the patient’s activities. Conclusions: The effects reflected on all outcome measures, both on short and long term follow-up. The multidisciplinary FRP for chronic low back pain patients durably stopped the de-conditioning syndrome and involved new life-style habits for the patient, daily pain management and a return to work.
Directory of Open Access Journals (Sweden)
LUIS SANZ MENÉNDEZ
2005-01-01
Full Text Available El objetivo de este trabajo es medir la relación de las universidades con la investigación. Se trata de situar a cada universidad en escalas relativas de capacidad investigadora, de esfuerzo u orientación hacia la investigación y de excelencia investigadora. El método utilizado se basa en el análisis de los resultados agregados de la competencia que los investigadores desarrollan por la financiación pública de la I+D. El periodo utilizado para la construcción de los datos corresponde a los proyectos de I+D financiados por la Administración General del Estado entre 1996 y 2001, a través de los Programas Nacionales de I+D y del Programa de Promoción General del Conocimiento (PGC. De modo singular se analizarán las actividades de investigación en el ámbito de las Ciencias Sociales y Económicas.
Applying Open Researchers and Contributors ID in scholarly journals
Directory of Open Access Journals (Sweden)
Jeonghee Im
2015-02-01
Full Text Available Open Researchers and Contributors ID (ORCID launched its registry services in October 2012. Consequently, adding personal information to the ORCID registry became routine work for researchers. To add ORCID to an online article, the tag needs to be included in the Journal Article Tag Suite extensible markup language file, if such a file has been produced by the publisher. Subsequently, all co-authors’ ORCID can be easily and conveniently collected and then integrated into the manuscript management system. In the current age of information and the Internet, journals need to keep pace with the surge of new standards and technologies. Editors should be able to accept and apply these new systems rapidly.
Cha, Seung Bin; Kim, Woo Sik; Kim, Jong-Seok; Kim, Hongmin; Kwon, Kee Woong; Han, Seung Jung; Cho, Sang-Nae; Coler, Rhea N; Reed, Steven G; Shin, Sung Jae
2016-04-27
The majority of tuberculosis (TB) vaccine candidates advanced to clinical trials have been evaluated preclinically using laboratory-adapted strains. However, it has been proposed that challenge with clinical isolates in preclinical vaccine testing could provide further and more practical validation. Here, we tested the ID93/GLA-SE TB vaccine candidate against the clinical Mycobacterium tuberculosis (Mtb) strain K (Mtb K) belonging to the Beijing family, the most prevalent Mtb strain in South Korea. Mice immunized with ID93/GLA-SE exhibited a significant reduction in bacteria and reduced lung inflammation against Mtb K when compared to non-immunized controls. In addition, we analyzed the immune responses in the lungs of ID93/GLA-SE-immunized mice, and showed that ID93/GLA-SE was able to elicit sustained Th1-biased immune responses including antigen-specific multifunctional CD4(+) T cell co-producing IFN-γ, TNF-α, and IL-2 as well as a high magnitude of IFN-γ response for up to 10 weeks post-challenge. Notably, further investigation of T cell subsets in the lung following challenge showed remarkable generation of CD8(+) central memory T cells by ID93/GLA-SE-immunization. Our findings showed that ID93/GLA-SE vaccine confers a high level of robust protection against the hypervirulent Mtb Beijing infection which was characterized by pulmonary Th1-polarized T-cell immune responses. These findings may also provide relevant information for potential utility of this vaccine candidate in East-Asian countries where the Beijing genotype is highly prevalent. Copyright © 2016 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Maho Nagasawa
2017-08-01
Full Text Available Innate lymphoid cells (ILCs have emerged as a key cell type involved in surveillance and maintenance of mucosal tissues. Mouse ILCs rely on the transcriptional regulator Inhibitor of DNA-binding protein 2 (Id2 for their development. Here, we show that Id2 also drives development of human ILC because forced expression of Id2 in human thymic progenitors blocked T cell commitment, upregulated CD161 and promyelocytic leukemia zinc finger (PLZF, and maintained CD127 expression, markers that are characteristic for human ILCs. Surprisingly CD5 was also expressed on these in vitro generated ILCs. This was not an in vitro artifact because CD5 was also found on ex vivo isolated ILCs from thymus and from umbilical cord blood. CD5 was also expressed on small proportions of ILC2 and ILC3. CD5+ ILCs were functionally immature, but could further differentiate into mature CD5− cytokine-secreting ILCs. Our data show that Id2 governs human ILC development from thymic progenitor cells toward immature CD5+ ILCs.
Directory of Open Access Journals (Sweden)
Persent E.
2009-11-01
Full Text Available This paper discusses the development of a 14-inch ID high-pressure hybrid riser (10 000 psi for surface BOP drilling in ultra-deep water (10 000 ft. The high-pressure hybrid riser system is obtained by adapting and combining two existing technologies, previously developed by the IFP for other applications: – the Clip connector, a double breech-block type connector to provide a quick and safe connection for riser joints; – hybrid pipe technology, a steel pipe hoop-wound with tapes of carbon fibers impregnated with polyamide thermoplastic resin. IFP has developed a new 14-inch ID HP Clip connector for the hybrid riser application. The connector is capable of withstanding a 2.8 million pound tension and a 10 000 psi operating pressure. In addition, a 16-inch nominal OD hybrid riser pipe has been designed to replace the steel riser pipe with a thinnerwalled hoop-wound steel pipe. The significant weight savings that can be achieved with the hybrid riser pipe make it possible to design an effective riser architecture to withstand the high pressure and deep water requirements. Pursuant to design studies, a 14-inch ID prototype assembly consisting of two hybrid riser pipe sections with a high-pressure Clip connector was manufactured. A test program, including burst and collapse tests as well as cyclic fatigue testing, was formulated and carried out to qualify the performance of the Clip connector and hybrid riser pipe system. Completion of hybrid pipe additional fatigue testing and realization of a scale-one field testing of the hybrid riser are considered as the next steps of the project. To date, the main test results (burst, collapse, fatigue resistance confirm that the Clip connector and the hybrid pipe technologies are well suited for ultra-deep sea drilling with a surface BOP. However, the fatigue resistance of hybrid riser pipes still needs to be better characterized. Cet article présente le développement d’un riser hybride 14”ID haute
2017-10-01
Reports an error in "Sex differences in left-handedness: A meta-analysis of 144 studies" by Marietta Papadatou-Pastou, Maryanne Martin, Marcus R. Munafò and Gregory V. Jones ( Psychological Bulletin , 2008[Sep], Vol 134[5], 677-699). In the article the statistical evidence is weaker than reported for the moderating effect of writing hand compared to all the other instruments (reported finding: Q (1) = 8.36, p = .02; corrected finding: Q (1) = 3.17, p = .075). While the statistical evidence is thus somewhat weaker on this particular point, the broad conclusions of the article remain unchanged. (The following abstract of the original article appeared in record 2008-11487-004.) Human handedness, a marker for language lateralization in the brain, continues to attract great research interest. A widely reported but not universal finding is a greater male tendency toward left-handedness. Here the authors present a meta-analysis of k = 144 studies, totaling N = 1,787,629 participants, the results of which demonstrate that the sex difference is both significant and robust. The overall best estimate for the male to female odds ratio was 1.23 (95% confidence interval = 1.19, 1.27). The widespread observation of this sex difference is consistent with it being related to innate characteristics of sexual differentiation, and its observed magnitude places an important constraint on current theories of handedness. In addition, the size of the sex difference was significantly moderated by the way in which handedness was assessed (by writing hand or by other means), the location of testing, and the year of publication of the study, implicating additional influences on its development. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
2015-05-15
The Administrator of the Drug Enforcement Administration (DEA) is issuing this final order to extend the temporary placement of (1-pentyl-1H-indol-3-yl)(2,2,3,3-tetramethylcyclopropyl)methanone (UR-144), [1-(5-fluoro-pentyl)-1H-indol-3-yl](2,2,3,3-tetramethylcyclopropyl)methanone (5-fluoro-UR-144, XLR11) and N-(1-adamantyl)-1-pentyl-1H-indazole-3-carboxamide (APINACA, AKB48), including their salts, isomers, and salts of isomers whenever the existence of such salts, isomers, and salts of isomers is possible, in schedule I of the Controlled Substances Act. The current final order temporarily placing UR-144, XLR11, and AKB48 in schedule I is due to expire on May 15, 2015. This final order will extend the temporary scheduling of UR-144, XLR11, and AKB48 to May 15, 2016, or until the permanent scheduling action for these three substances is completed, whichever occurs first.
Watanabe, Shimpei; Kuzhiumparambil, Unnikrishnan; Fu, Shanlin
2018-03-08
The number of new psychoactive substances keeps on rising despite the controlling efforts by law enforcement. Although metabolism of the newly emerging drugs is continuously studied to keep up with the new additions, the exact structures of the metabolites are often not identified due to the insufficient sample quantities for techniques such as nuclear magnetic resonance (NMR) spectroscopy. The aim of the study was to characterise several metabolites of the synthetic cannabinoid (1-pentyl-1H-indol-3-yl) (2,2,3,3-tetramethylcyclopropyl) methanone (UR-144) by NMR spectroscopy after the incubation with the fungus Cunninghamella elegans. UR-144 was incubated with C. elegans for 72 h, and the resulting metabolites were chromatographically separated. Six fractions were collected and analysed by NMR spectroscopy. UR-144 was also incubated with human liver microsomes (HLM), and the liquid chromatography-high resolution mass spectrometry analysis was performed on the HLM metabolites with the characterised fungal metabolites as reference standards. Ten metabolites were characterised by NMR analysis including dihydroxy metabolites, carboxy and hydroxy metabolites, a hydroxy and ketone metabolite, and a carboxy and ketone metabolite. Of these metabolites, dihydroxy metabolite, carboxy and hydroxy metabolites, and a hydroxy and ketone metabolite were identified in HLM incubation. The results indicate that the fungus is capable of producing human-relevant metabolites including the exact isomers. The capacity of the fungus C. elegans to allow for NMR structural characterisation by enabling production of large amounts of metabolites makes it an ideal model to complement metabolism studies.
Hizbollah lubab : "Me tahame ameeriklastega häid suhteid" / Mohamad Afif ; interv. Ivar Soopan
Afif, Mohamad
2005-01-01
Liibanoni shiiitide organisatsiooni Hizbollah meediasuhete direktor ütleb, et Hizbollah ei ole terroriorganisatsioon. Religioosse ja poliitilise grupina tahab Hizbollah häid suhteid teistega kõikjal maailmas, kuid probleem on poliitikas, selles, kuidas USA suhtub nende regiooni, tõekspidamistesse
CD5L Promotes M2 Macrophage Polarization through Autophagy-Mediated Upregulation of ID3
Directory of Open Access Journals (Sweden)
Lucía Sanjurjo
2018-03-01
Full Text Available CD5L (CD5 molecule-like is a secreted glycoprotein that controls key mechanisms in inflammatory responses, with involvement in processes such as infection, atherosclerosis, and cancer. In macrophages, CD5L promotes an anti-inflammatory cytokine profile in response to TLR activation. In the present study, we questioned whether CD5L is able to influence human macrophage plasticity, and drive its polarization toward any specific phenotype. We compared CD5L-induced phenotypic and functional changes to those caused by IFN/LPS, IL4, and IL10 in human monocytes. Phenotypic markers were quantified by RT-qPCR and flow cytometry, and a mathematical algorithm was built for their analysis. Moreover, we compared ROS production, phagocytic capacity, and inflammatory responses to LPS. CD5L drove cells toward a polarization similar to that induced by IL10. Furthermore, IL10- and CD5L-treated macrophages showed increased LC3-II content and colocalization with acidic compartments, thereby pointing to the enhancement of autophagy-dependent processes. Accordingly, siRNA targeting ATG7 in THP1 cells blocked CD5L-induced CD163 and Mer tyrosine kinase mRNA and efferocytosis. In these cells, gene expression profiling and validation indicated the upregulation of the transcription factor ID3 by CD5L through ATG7. In agreement, ID3 silencing reversed polarization by CD5L. Our data point to a significant contribution of CD5L-mediated autophagy to the induction of ID3 and provide the first evidence that CD5L drives macrophage polarization.
Angular momentum distributions for {sup 16}O + {sup 144}Nd
Energy Technology Data Exchange (ETDEWEB)
Duchene, G.; Romain, P.; Beck, F.A.; Benet, P.; Disdier, D.; Haas, B.; Lott, B.; Rauch, V.; Scheibling, F.; Vivien, J.P. [Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires]|[Strasbourg-1 Univ., 67 (France); Basu, S.K. [Bhabha Atomic Research Centre, Calcutta (India). Variable Energy Cyclotron Project; Bozek, E.; Zuber, K. [Institute of Nuclear Physics, Cracow (Poland); Di Gregorio, D.E.; Fernandez-Niello, J. [Comision Nacional de Energia Atomica, Buenos Aires (Argentina). Dept. de Fisica
1992-12-31
Fusion cross sections have been measured for the system {sup 16} O + {sup 144} Nd at bombarding energies in the range 67 MeV {<=}E{sub lab} {<=} 90 MeV by detecting directly evaporation residues in Si detectors and in the range 60 MeV {<=}E{sub lab}{<=} 75 MeV by off-line detection of the K X-rays emitted by the radioactive evaporation residues and daughters. In order to obtain the spin distributions in the compound system gamma-ray multiplicity distributions for the most important neutron evaporation channels were also measured using a 4{pi} - BaF{sub 2} array, in conjunction with Ge detectors. Results are compared with calculations based on models that consider fluctuations in barrier height due to ground state zero point vibrations as well as couplings to various inelastic and transfer channels.
Lipperman-Kreda, Sharon; Grube, Joel W; Friend, Karen B; Mair, Christina
2016-03-01
To estimate the relationships of tobacco outlet density, cigarette sales without ID checks and local enforcement of underage tobacco laws with youth's life-time cigarette smoking, perceived availability of tobacco and perceived enforcement of underage tobacco laws and changes over time. The study involved: (a) three annual telephone surveys, (b) two annual purchase surveys in 2000 tobacco outlets and (c) interviews with key informants from local law enforcement agencies. Analyses were multi-level models (city, individual, time). A sample of 50 mid-sized non-contiguous cities in California, USA. A total of 1478 youths (aged 13-16 at wave 1, 52.2% male); 1061 participated in all waves. Measures at the individual level included life-time cigarette smoking, perceived availability and perceived enforcement. City-level measures included tobacco outlet density, cigarette sales without ID checks and compliance checks. Outlet density was associated positively with life-time smoking [OR = 1.12, P Sales rate without checking IDs was related to greater perceived availability (β = 0.01, P sales without ID checks and enforcement levels may influence beliefs about access to cigarettes and enforcement of underage tobacco sales laws. © 2015 Society for the Study of Addiction.
Applying risk management strategies to strengthen an IDS's investment policy.
Fine, R P
1998-11-01
The increased financial risk that not-for-profit integrated delivery systems have assumed to function under managed care has required them to become increasingly reliant on income and gains from their investment portfolios. This reliance underscores the need for these organizations to take steps to effectively manage their investment risk. Not-for-profit IDSs should establish a systematic approach to investment risk management that is based on maintaining a sound fiduciary infrastructure and having a clear understanding of risk exposures, the most important of which are policy and market risk. Applying reasonable and common-sense risk management strategies to investment policy will enhance an IDS's overall financial and competitive strength.
Evaluation of ACE gene I/D polymorphism in Iranian elite athletes.
Shahmoradi, Somayeh; Ahmadalipour, Ali; Salehi, Mansoor
2014-01-01
Angiotensin converting enzyme (ACE) is an important gene, which is associated with the successful physical activity. The ACE gene has a major polymorphism (I/D) in intron 16 that determines its plasma and tissue levels. In this study, we aimed to determine whether there is an association between this polymorphism and sports performance in our studied population including elite athletes of different sports disciplines. We investigated allele frequency and genotype distribution of the ACE gene in 156 Iranian elite athletes compared to 163 healthy individuals. We also investigated this allele frequency between elite athletes in three functional groups of endurance, power, and mixed sports performances. DNA was extracted from peripheral blood, and polymerase chain reaction (PCR) method was performed on intron 16 of the ACE gene. The ACE genotype was determined for each subject. Statistical analysis was performed by SPSS 15, and results were analyzed by Chi-Square test. There was a significant difference in genotype distribution and allele frequency of the ACE gene in athletes and control group (P = 0.05, P = 0.03, respectively). There was also a significant difference in allele frequency of the ACE gene in 3 groups of athletes with different sports disciplines (P = 0.045). Proportion of the ACE gene D allele was greater in elite endurance athletes (37 high-distance cyclists) than two other groups. Findings of the present study demonstrated that there is an association between the ACE gene I/D polymorphism and sports performance in Iranian elite athletes.
Determination of Trace Elements in Uranium by HPLC-ID-ICP-MS: NTNFC Final Report
Energy Technology Data Exchange (ETDEWEB)
Manard, Benjamin Thomas [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Wylie, Ernest Miller II [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Xu, Ning [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Tandon, Lav [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2017-10-19
This report covers the FY 16 effort for the HPLC-ID-ICP-MS methodology 1) sub-method validation for the group I&II elements, 2) sub-method stood-up and validation for REE, 3) sub-method development for the transition element, and 4) completion of a comprehensive SOP for three families of elements.
Time-and-ID-Based Proxy Reencryption Scheme
Directory of Open Access Journals (Sweden)
Kambombo Mtonga
2014-01-01
Full Text Available Time- and ID-based proxy reencryption scheme is proposed in this paper in which a type-based proxy reencryption enables the delegator to implement fine-grained policies with one key pair without any additional trust on the proxy. However, in some applications, the time within which the data was sampled or collected is very critical. In such applications, for example, healthcare and criminal investigations, the delegatee may be interested in only some of the messages with some types sampled within some time bound instead of the entire subset. Hence, in order to carter for such situations, in this paper, we propose a time-and-identity-based proxy reencryption scheme that takes into account the time within which the data was collected as a factor to consider when categorizing data in addition to its type. Our scheme is based on Boneh and Boyen identity-based scheme (BB-IBE and Matsuo’s proxy reencryption scheme for identity-based encryption (IBE to IBE. We prove that our scheme is semantically secure in the standard model.
Directory of Open Access Journals (Sweden)
Maurílio Onofre DEININGER
1999-04-01
Full Text Available Realizamos análise retrospectiva de todos os pacientes com idade igual ou superior a 70 anos, submetidos à operação de revascularização do miocárdio isolada, no período de janeiro de 1992 a dezembro de 1997, objetivando avaliar a morbimortalidade. Do total de 144 pacientes, 92 (63,9% eram do sexo masculino, idade entre 70 e 84 anos, média de 73,51 anos e desvio padrão de 2,82. A grande maioria encontrava-se com angina classe funcional III ou IV (79,16%. Tiveram relação com a ocorrência de maior mortalidade, a presença no período pré-operatório de: obesidade (p = 0,004, insuficiência cardíaca congestiva (classe III/IV - p = 0,03 e/ou infarto agudo do miocárdio (A retrospective analysis involving seventy-year-old patients as well as those over seventy who have undergone CABG as a single procedure, during Jannuary 1992 to December 1997, was carried out with the purpose of assessing their morbidity with mortality. Of the 144 patients, 92 (63.9% were males, aged 70 to 84 (average age 73.51 and standard deviation 2.82. Most of those, 114 (79.16%, suffered from angina belonging to the functional class III or IV. The occurrence in the pre-operative period of obesity (p = 0.004, heart failure (III/IV class - p = 0.03 and/or acute myocardial infection (less than 21 days - p = 0.01 demonstrated a definite relationship with mortality. There were 120 (83.34% patients with lesions in three or more vessels (average 3.48 anastomoses/patients.The pediculate internal mammary artery was employed in 126 patients (87.5% and that rate increased to 98.9% in the last two years. The main complications in the post-operation period leading to death were either infections (p < 0.0001, prolonged ventilatory support (p < 0.0001, renal failure with dialysis (p < 0.0001 and/or low cardiac output (p = 0.003. As to statistical analysis the Student T test, the Chi-square test and Fisher's exact test were used. Surgical mortality totalling 5.5% (8/144 in the
Agarande, M; Benzoubir, S; Bouisset, P; Calmet, D
2001-08-01
Trace levels (pg kg(-1)) of 241Am in sediments were determined by isotope dilution high resolution inductively coupled plasma mass spectrometry (ID HR ICP-MS) using a microconcentric nebulizer. 241Am was isolated from major elements like Ca and Fe by different selective precipitations. In further steps. Am was first separated from other transuranic elements and purified by anion exchange and extraction chromatography prior to the mass spectrometric measurements. The ID HR ICP-MS results are compared with isotope dilution alpha spectrometry.
2011-06-23
... DEPARTMENT OF AGRICULTURE Forest Service Salmon-Challis National Forest, ID; Forestwide Invasive... to the biological diversity and ecological integrity within and outside the Salmon-Challis National... loss of recreational opportunities. Within the 3,108,904 acres of the of the Salmon-Challis National...
DD genotype of ACE gene in boys: may it be a risk factor for minimal change nephrotic syndrome?
Alasehirli, Belgin; Balat, Ayşe; Büyükçelik, Mithat
2012-01-01
It has been shown that angiotensin-converting enzyme (ACE) gene insertion/deletion (I/D) polymorphism affects the circulating and cellular levels of ACE and may be a risk factor in several renal diseases. We analyzed the association of ACE gene I/D polymorphism with the clinical presentation of minimal change nephrotic syndrome (MCNS) in a Turkish child population. This study consisted of 97 children with MCNS and 144 healthy controls. Genotyping of ACE gene was performed using polymerase chain reaction (PCR). The distributions of ACE genotypes were II in 13%, ID in 49%, and DD in 38% in patient group, and 9%, 49%, and 42% in control group, respectively. The frequency of the D allele was 63% and that of the I allele was 37% in patients. There were no relevant differences in the allele frequencies and genotypes of ACE I/D polymorphism between patients and controls. However, DD genotype was higher in boys in children with MCNS (78.4%. vs. 50.0%, p = 0.004). The frequencies of DD genotype and D allele in boys were 7.25 and 2.56 times higher than II genotype and I allele in the patient group, respectively. We suggest that DD genotype in boys may be one of the risk factors for MCNS.
Support and Self-Efficacy among Latino and White Parents of Children with ID
Cohen, Shana R.; Holloway, Susan D.; Dominguez-Pareto, Irenka; Kuppermann, Miriam
2015-01-01
Research indicates that mothers of children with ID who receive familial support experience less stress than those who receive less support. Less is known about the relation of support to mothers' evaluation of parenting self-efficacy, particularly in Latino families. We examined the relationship of different types of family support to life…
What's Going on in Your Professor's Head? Demonstrating the Id, Ego, and Superego
Segrist, Dan J.
2009-01-01
This article describes an in-class activity designed to demonstrate Freud's structural theory of the psyche, specifically the roles of the id, ego, and superego, as well as the interplay among them. Additionally, the activity visually illustrates Freud's ideas about the levels of consciousness associated with these 3 components. Pre-post quiz…
Oversættelsesperspektiver på idéers møde med praksis
DEFF Research Database (Denmark)
Scheuer, John Damm
-netværksteoriens oversættelsesbegreb blevet søgt indarbejdet i ny-institutionel oversættelsesteori ? 2. Hvordan kan forståelsen af oversættelsesprocessen udvikles videre på et empirisk grundlag ? Det konstateres, at Latours definition og idémodellens socialkonstruktivistiske teoretisering af oversættelsesprocessen er blevet taget...
Chandrasekar Rajendran, S C; Chamlagain, B; Kariluoto, S; Piironen, V; Saris, P E J
2017-06-01
Lactococcus lactis N8 and Saccharomyces boulardii SAA655 were investigated for their ability to synthesize B-vitamins (riboflavin and folate) and their functional role as microbial starters in idli fermentation. In this study, ultra-high performance liquid chromatography and microbiological assay were used to determine the total riboflavin and folate content respectively. Increased levels of folate were evident in both L. lactis N8 and S. boulardii SAA655 cultivated medium. Enhanced riboflavin levels were found only in S. boulardii SAA655 grown medium, whereas decreased riboflavin level was found in L. lactis N8 cultivated medium. To evaluate the functional role of microbial starter strains, L. lactis N8 and S. boulardii SAA655 were incorporated individually and in combination into idli batter, composed of wet grounded rice and black gram. For the experiments, naturally fermented idli batter was considered as control. The results indicated that natural idli fermentation did not enhance the riboflavin level and depleted folate levels by half. In comparison with control, L. lactis N8 and S. boulardii SAA655 incorporated idli batter (individually and in combination) increased riboflavin and folate levels by 40-90%. Apart from compensating the folate loss caused by natural fermentation, S. boulardii SAA655 fermented idli batter individually and in combination with L. lactis N8 also showed the highest leavening character. Moreover, the microbial starter incorporation did not significantly influence the pH of idli batter. Incorporation of L. lactis N8 and S. boulardii SAA655 can evidently enhance the functional and technological characteristics of idli batter. UN General Assembly declared 2016 the International Year of pulses emphasizing the importance of legumes as staple food. Furthermore, this is the first experimental report of in situ biofortifcation of riboflavin and folate using microbes in pulse based fermented staple food. The current study suggests possible
The Use of Water During the Crew 144, Mars Desert Research Station, Utah Desert
De Morais Mendonca Teles, Antonio
2016-07-01
Well. from November 29th to December 14th, 2014, the author conducted astrobiological and geological surveys, as analog astronaut member of the international Crew 144, at the site of the Mars Society's Mars Desert Research Station, located at a remote location in the Utah desert, United States. The use of water for drinking, bathing, cleaning, etc., in the crew was a major issue for consideration for a human expedition to the planet Mars in the future. The author would like to tell about the factors of the rationalized use of water.
Directory of Open Access Journals (Sweden)
Eduardo Miguel De la Hoz
2012-01-01
Full Text Available Con el pasar de los años, en el ámbito de la seguridad informática el problema de la intrusión se desarrolla cada día más, incrementando la existencia de programas que buscan afectar a computadoras tanto a nivel local como a toda una red informática. Esta dinámica lleva a entender los ataques y la mejor manera de contrarrestarlos, ya sea previniéndolos o detectándolos a tiempo, procurando que su impacto sea menor al esperado por el atacante. En este artículo se presenta una revisión de los ataques a sistemas informáticos, ahondando en los Sistemas de Detección de Intrusos (IDS y en la implementación de técnicas de agrupamiento de datos —como las redes neuronales—, con el fin de encontrar métodos con altas precisiones en la detección de anomalías. Esta propuesta presenta la aplicación de GHSOM en IDS, utilizando el conjunto de datos NSL-KDD, y mostrando las mejoras encontradas en la detección de ataques en el proceso de búsqueda.
Implementing New-age Authentication Techniques using OpenID for Security Automation
Dharmendra Choukse; Umesh Kumar Singh; Deepak Sukheja; Rekha Shahapurkar
2010-01-01
Security of any software can be enhanced manifolds if multiple factors for authorization and authentication are used .The main aim of this work was to design and implement an Academy Automation Software for IPS Academy which uses OpenID and Windows CardSpace as Authentication Techniques in addition to Role Based Authentication (RBA) System to ensure that only authentic users can access the predefined roles as per their Authorization level. The Automation covers different computing hardware an...
Energy Technology Data Exchange (ETDEWEB)
Nishida, S., E-mail: shohei.nishida@kek.jp [High Energy Accelerator Research Organization (KEK), Tsukuba (Japan); Adachi, I. [High Energy Accelerator Research Organization (KEK), Tsukuba (Japan); Hamada, N. [Toho University, Funabashi (Japan); Hara, K. [High Energy Accelerator Research Organization (KEK), Tsukuba (Japan); Iijima, T. [Nagoya University, Nagoya (Japan); Iwata, S.; Kakuno, H. [Tokyo Metropolitan University, Hachioji (Japan); Kawai, H. [Chiba University, Chiba (Japan); Korpar, S.; Krizan, P. [Jozef Stefan Institute, Ljubljana (Slovenia); Ogawa, S. [Toho University, Funabashi (Japan); Pestotnik, R.; Ŝantelj, L.; Seljak, A. [Jozef Stefan Institute, Ljubljana (Slovenia); Sumiyoshi, T. [Tokyo Metropolitan University, Hachioji (Japan); Tabata, M. [Chiba University, Chiba (Japan); Tahirovic, E. [Jozef Stefan Institute, Ljubljana (Slovenia); Yoshida, K. [Tokyo Metropolitan University, Hachioji (Japan); Yusa, Y. [Niigata University, Niigata (Japan)
2015-07-01
The Belle II detector, a follow up of the very successful Belle experiment, is under construction at the SuperKEKB electron–positron collider at KEK in Japan. For the PID system in the forward region of the spectrometer, a proximity-focusing ring-imaging Cherenkov counter with an aerogel radiator is being developed. For the position sensitive photon sensor, a 144-channel Hybrid Avalanche Photo-Detector has been developed with Hamamatsu Photonics K.K. In this report, we describe the specification of the Hybrid Avalanche Photo-Detector and the status of the mass production.
Energy Technology Data Exchange (ETDEWEB)
Petelenz, B. [The H. Niewodniczanski Inst. of Nuclear Physics, Cracow (Poland)
1997-09-01
General assumptions for project of target activation stand at AIC-144 cyclotron are presented. The project predicts production of {sup 67}Ga, {sup 111}In, {sup 201}Tl, {sup 139}Ce, {sup 88}Y, {sup 123}I and {sup 211}At isotopes using various target backings. Directions concerning target cooling and beam parameters are also described 25 refs, 1 tab
Forsström, J
1992-01-01
The ID3 algorithm for inductive learning was tested using preclassified material for patients suspected to have a thyroid illness. Classification followed a rule-based expert system for the diagnosis of thyroid function. Thus, the knowledge to be learned was limited to the rules existing in the knowledge base of that expert system. The learning capability of the ID3 algorithm was tested with an unselected learning material (with some inherent missing data) and with a selected learning material (no missing data). The selected learning material was a subgroup which formed a part of the unselected learning material. When the number of learning cases was increased, the accuracy of the program improved. When the learning material was large enough, an increase in the learning material did not improve the results further. A better learning result was achieved with the selected learning material not including missing data as compared to unselected learning material. With this material we demonstrate a weakness in the ID3 algorithm: it can not find available information from good example cases if we add poor examples to the data.
Angular momentum distributions for [sup 16]O+[sup 144]Nd
Energy Technology Data Exchange (ETDEWEB)
Duchene, G.; Romain, P.; Beck, F.A.; Benet, P.; Disdier, D.; Haas, B.; Lott, B.; Rauch, V.; Scheibling, F.; Vivien, J.P. (Centre de Recherches Nucleaires, Institut National de Physique Nucleaire et de Physique des Particules, Universite Louis Pasteur, BP 20, 67037 Strasbourg CEDEX (France)); Basu, S.K. (Variable Energy Cyclotron Centre, Bhabha Atomic Research Centre, I/AF Bidhan Nagar, Calcutta 700064 (India)); Bozek, E.; Zuber, K. (Institute of Nuclear Physics Krakow, 30-342 Krakow (Poland)); Di Gregorio, D.; Fernandez-Niello, J. (Departamento de Fisica, Comision Nacional de Energia Atomica, 1429 Buenos Aires (Argentina))
1993-05-01
Fusion cross sections have been measured for the system [sup 16]O+[sup 144]Nd at bombarding energies in the range 67 MeV[le][ital E][sub lab][le]90 MeV by detecting directly evaporation residues in Si detectors and in the range 60 MeV[le][ital E][sub lab][le]75 MeV by off-line detection of the K x rays emitted by the radioactive evaporation residues and daughters. In order to obtain the spin distributions in the compound system gamma-ray multiplicity distributions for the most important neutron evaporation channels were also measured using a 4[pi] BaF[sub 2] array, in conjunction with Ge detectors. Results are compared with calculations based on models that consider fluctuations in barrier height due to ground-state zero-point vibrations as well as couplings to various inelastic and transfer channels.
Transfer reactions in sup(32,36)S + sup(144,154)Sm
International Nuclear Information System (INIS)
Pacheco, A.J.; Tada, M. di; Fernandez Niello, J.; Testoni, J.E.
1990-01-01
The deformation of spherical nuclei in transfer reactions near to the coulomb barrier is studied. The sup(32,36)S + sup(144,154)Sm reactions were carried out using sup(32)S beams produced by TANDAR accelerator in Buenos Aires with energies of 148 MeV and 160 MeV and sup(36)S beams produced by tandem accelerator of Laboratorio Nazionale di Legnaro with energies of 142 MeV and 155 MeV. The angular distributions were measured for sup(32)S reaction using gas ionization chamber and position sensitive detector. The mass spectra of reaction products were obtained measuring time of flight between time detectors, in the sup(36)S reaction. (M.C.K.)
Blairon, Laurent; Maza, Mengi L; Wybo, Ingrid; Piérard, Denis; Dediste, Anne; Vandenberg, Olivier
2010-08-01
The Vitek 2 Anaerobe and Corynebacterium Identification Card (ANC) was recently evaluated in a multicentre study. In the present work, this system was compared with the BBL Crystal Anaerobe and RapID ANA II panels. These kits were tested using 196 strains of anaerobes that had been previously identified by gas-liquid chromatography. Identification to the species or to the genus level was 75.0%, 81.1% and 70.9% for Crystal, RapID and Vitek, respectively. Vitek ANC failed to provide any identification in 20.4% of the strains, but it had fewer misidentifications than RapID. The confidence factors provided on the results report of each kit were not always correlated with a lower risk of major errors, with the exception of Vitek 2 in which a confidence factor higher than 0.86 excluded the risk of misidentification in more than 87% of isolates. The lower rate of identification by the Vitek and Crystal panels is mostly due the lower ability of these systems to identify the Clostridia. Overall, the three panels are comparable but need improvement to a better accuracy. Copyright (c) 2010 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Paul F McKay
Full Text Available The induction of high levels of systemic and mucosal humoral immunity is a key goal for many prophylactic vaccines. However, adjuvant strategies developed in mice have often performed poorly in the clinic. Due to their closer similarity to humans, minipigs may provide a more accurate picture of adjuvant performance. Based on their complementary signalling pathways, we assessed humoral immune responses to model antigens after co-administration with the toll-like receptor 4 (TLR4 stimulator glucopyranosyl lipid adjuvant (GLA-AF or the TLR7/8 agonist resiquimod (R848 (alone and in combination via the intradermal (ID, intranasal (IN or combined routes in the Gottingen minipig animal model. Surprisingly, we discovered that while GLA-AF additively enhanced the adjuvant effect of R848 when injected ID, it abrogated the adjuvant activity of R848 after IN inoculation. We then performed a route comparison study using a CN54 gp140 HIV Envelope model antigen adjuvanted with R848 + GLA-AF (ID or R848 alone (IN. Animals receiving priming inoculations via one route were then boosted by the alternate route. Although differences were observed in the priming phase (IN or ID, responses converged upon boosting by the alternative route with no observable impact resultant from the order of administration (ID/IN vs IN/ID. Specific IgG responses were measured at a distal mucosal site (vaginal, although there was no evidence of mucosal linkage as these closely reflected serum antibody levels. These data indicate that the complex in vivo cross-talk between innate pathways are likely tissue specific and cannot be predicted by simple in vitro models.