WorldWideScience

Sample records for osc trichoides chlorosomes

  1. Temperature shift effect on the Chlorobaculum tepidum chlorosomes.

    Science.gov (United States)

    Tang, Joseph Kuo-Hsiang; Xu, Ying; Muhlmann, Guillermo M; Zare, Farrokh; Khin, Yadana; Tam, Sun W

    2013-05-01

    Chlorobaculum [Cba.] tepidum is known to grow optimally at 48-52 °C and can also be cultured at ambient temperatures. In this paper, we prepared constant temperature, temperature shift, and temperature shift followed by backshift cultures and investigated the intrinsic properties and spectral features of chlorosomes from those cultures using various approaches, including temperature-dependent measurements on circular dichroism (CD), UV-visible, and dynamic light scattering. Our studies indicate that (1) chlorosomes from constant temperature cultures at 50 and 30 °C exhibited more resistance to heat relative to temperature shift cultures; (2) as temperature increases bacteriochlorophyll c (BChl c) in chlorosomes is prone to demetalation, which forms bacteriopheophytin c, and degradation under aerobic conditions. Some BChl c aggregates inside reduced chlorosomes prepared in low-oxygen environments can reform after heat treatments; (3) temperature shift cultures synthesize and incorporate more BChl c homologs with a smaller substituent at C-8 on the chlorin ring and less BChl c homologs with a larger long-chain alcohol at C-17(3) versus constant-temperature cultures. We hypothesize that the long-chain alcohol at C-17(3) (and perhaps together with the substituent at C-8) may account for thermal stability of chlorosomes and the substituent at C-8 may assist self-assembling BChls; and (4) while almost identical absorption spectra are detected, chlorosomes from different growth conditions exhibited differences in the rotational length of the CD signal, and aerobic and reduced chlorosomes also display different Qy CD intensities. Further, chlorosomes exhibited changes of CD features in response to temperature increases. Additionally, we compare temperature-dependent studies for the Cba. tepidum chlorosomes and previous studies for the Chloroflexus aurantiacus chlorosomes. Together, our work provides useful and novel insights on the properties and organization of

  2. Coherent or hopping like energy transfer in the chlorosome ?

    Science.gov (United States)

    Nalbach, Peter

    2014-08-01

    Chlorosomes, as part of the light-harvesting system of green bacteria, are the largest and most efficient antennae systems in nature. We have studied energy transfer dynamics in the chlorosome in a simplified toy model employing a master equation. Dephasing and relaxation due to environmental fluctuations are included by Lindblad dephasing and Redfield thermalization rates. We find at room temperature three separate time scales, i.e. 25 fs, 250 fs and 2.5 ps and determine the according energy pathways through the hierarchical structure in the chlorosome. Quantum coherence lives up to 150 fs at which time the energy is spread over roughly 12 pigments in our model.

  3. Molecular contacts for chlorosome envelope proteins revealed by cross-linking studies with chlorosomes from Chlorobium tepidum

    DEFF Research Database (Denmark)

    Li, Hui; Frigaard, Niels-Ulrik; Bryant, Donald A

    2006-01-01

    type and mutants lacking a single chlorosome protein were cross-linked with the zero-length cross-linker 1-ethyl-3-[3-(dimethylamino)propyl]carbodiimide (EDC) and analyzed by gel electrophoresis. Similar cross-linking products were observed when the time and temperature were varied or when EDC...... was replaced with glutaraldehyde. Specific interactions between chlorosome proteins in cross-linked products were identified by immunoblotting with polyclonal antibodies raised against recombinant chlorosome proteins. We confirmed these interactions by demonstrating that these products were missing...... in appropriate mutants. Confirming the location of CsmA in the paracrystalline baseplate, cross-linking showed that CsmA forms dimers, trimers, and homomultimers as large as dodecamers and that CsmA directly interacts with the Fenna-Matthews-Olson protein. Cross-linking further suggests that the precursor form...

  4. Is OSCE successful in pediatrics?

    Directory of Open Access Journals (Sweden)

    M Imani

    2009-02-01

    Full Text Available Background: The Faculty of Medical Sciences, University of Zahedan implemented the Objective Structured Clinical Examination (OSCE in the final Examination during the 2003–2004 academic year. Simultaneously, the pediatric department initiated faculty and student training, and instituted the OSCE as an assessment instrument during the pediatric clerkship in year 5. The study set out to explore student acceptance of the OSCE as part of an evaluation of the Pediatric clerkship.Purpose: This study implemented to evaluate a new method of assessment in medical education in pediatrics.Methods: A self-administered questionnaire was completed by successive groups of students immediately after the OSCE at the end of each clerkship rotation. Main outcome measures were student perception of examination attributes, which included the quality of instructions and organization, the quality of performance, authenticity and transparency of the process, and usefulness of the OSCE as an assessment instrument compared to other methods.Results: There was overwhelming acceptance of the OSCE in Pediatric with respect to the comprehensiveness (90%, transparency (87%, fairness (57% and authenticity of the required tasks (58–78%. However, students felt that it was a strong anxiety-producing experience. And concerns were expressed regarding the ambiguity of some questions and inadequacy of time for expected tasks.Conclusion: Student feedback was invaluable in influencing faculty teaching, curriculum direction and appreciation of student opinion. Further psychometric evaluation will strengthen the development of the OSCE.Key words: OSCE, COMPETENCE ASSESSMENT

  5. Circular dichroism measured on single chlorosomal light-harvesting complexes of green photosynthetic bacteria

    KAUST Repository

    Furumaki, Shu

    2012-12-06

    We report results on circular dichroism (CD) measured on single immobilized chlorosomes of a triple mutant of green sulfur bacterium Chlorobaculum tepidum. The CD signal is measured by monitoring chlorosomal bacteriochlorphyll c fluorescence excited by alternate left and right circularly polarized laser light with a fixed wavelength of 733 nm. The excitation wavelength is close to a maximum of the negative CD signal of a bulk solution of the same chlorosomes. The average CD dissymmetry parameter obtained from an ensemble of individual chlorosomes was gs = -0.025, with an intrinsic standard deviation (due to variations between individual chlorosomes) of 0.006. The dissymmetry value is about 2.5 times larger than that obtained at the same wavelength in the bulk solution. The difference can be satisfactorily explained by taking into account the orientation factor in the single-chlorosome experiments. The observed distribution of the dissymmetry parameter reflects the well-ordered nature of the mutant chlorosomes. © 2012 American Chemical Society.

  6. Circular dichroism measured on single chlorosomal light-harvesting complexes of green photosynthetic bacteria

    KAUST Repository

    Furumaki, Shu; Yabiku, Yu; Habuchi, Satoshi; Tsukatani, Yusuke; Bryant, Donald A.; Vá cha, Martin

    2012-01-01

    We report results on circular dichroism (CD) measured on single immobilized chlorosomes of a triple mutant of green sulfur bacterium Chlorobaculum tepidum. The CD signal is measured by monitoring chlorosomal bacteriochlorphyll c fluorescence excited by alternate left and right circularly polarized laser light with a fixed wavelength of 733 nm. The excitation wavelength is close to a maximum of the negative CD signal of a bulk solution of the same chlorosomes. The average CD dissymmetry parameter obtained from an ensemble of individual chlorosomes was gs = -0.025, with an intrinsic standard deviation (due to variations between individual chlorosomes) of 0.006. The dissymmetry value is about 2.5 times larger than that obtained at the same wavelength in the bulk solution. The difference can be satisfactorily explained by taking into account the orientation factor in the single-chlorosome experiments. The observed distribution of the dissymmetry parameter reflects the well-ordered nature of the mutant chlorosomes. © 2012 American Chemical Society.

  7. Selective Protein Extraction from Chlorobium tepidum Chlorosomes Using Detergents. Evidence That CsmA Forms Multimers and Binds Bacteriochlorophyll a

    DEFF Research Database (Denmark)

    Bryant, Donald A; Vassilieva, Elena V; Frigaard, Niels-Ulrik

    2002-01-01

    and location of this BChl a are not yet clearly understood. Chlorosomes were treated with sodium dodecyl sulfate (SDS), Lubrol PX, or Triton X-100, separately or in combination with 1-hexanol, and the extracted components were separated from the residual chlorosomes by ultrafiltration on centrifugal filters....... When chlorosomes were treated with low concentrations of SDS, all proteins except CsmA were extracted. However, this treatment did not significantly alter the size and shape of the chlorosomes, did not extract the BChl a, and caused only minor changes in the absorption spectrum of the chlorosomes....... Cross-linking studies with SDS-treated chlorosomes revealed the presence of multimers of the major chlorosome protein, CsmA, up to homooctamers. Extraction of chlorosomes with SDS and 1-hexanol solubilized all ten chlorosome envelope proteins as well as BChl a. Although the size and shape...

  8. Unraveling the nature of coherent beatings in chlorosomes

    Energy Technology Data Exchange (ETDEWEB)

    Dostál, Jakub [Department of Chemical Physics, Lund University, P.O. Box 124, SE-22100 Lund (Sweden); Faculty of Mathematics and Physics, Charles University in Prague, Ke Karlovu 3, 121 16 Prague (Czech Republic); Mančal, Tomáš; Pšenčík, Jakub [Faculty of Mathematics and Physics, Charles University in Prague, Ke Karlovu 3, 121 16 Prague (Czech Republic); Vácha, František [Faculty of Science, University of South Bohemia, Branišovská 31, 370 05 České Budějovice (Czech Republic); Zigmantas, Donatas, E-mail: donatas.zigmantas@chemphys.lu.se [Department of Chemical Physics, Lund University, P.O. Box 124, SE-22100 Lund (Sweden)

    2014-03-21

    Coherent two-dimensional (2D) spectroscopy at 80 K was used to study chlorosomes isolated from green sulfur bacterium Chlorobaculum tepidum. Two distinct processes in the evolution of the 2D spectrum are observed. The first being exciton diffusion, seen in the change of the spectral shape occurring on a 100-fs timescale, and the second being vibrational coherences, realized through coherent beatings with frequencies of 91 and 145 cm{sup −1} that are dephased during the first 1.2 ps. The distribution of the oscillation amplitude in the 2D spectra is independent of the evolution of the 2D spectral shape. This implies that the diffusion energy transfer process does not transfer coherences within the chlorosome. Remarkably, the oscillatory pattern observed in the negative regions of the 2D spectrum (dominated by the excited state absorption) is a mirror image of the oscillations found in the positive part (originating from the stimulated emission and ground state bleach). This observation is surprising since it is expected that coherences in the electronic ground and excited states are generated with the same probability and the latter dephase faster in the presence of fast diffusion. Moreover, the relative amplitude of coherent beatings is rather high compared to non-oscillatory signal despite the reported low values of the Huang-Rhys factors. The origin of these effects is discussed in terms of the vibronic and Herzberg-Teller couplings.

  9. Quenching of bacteriochlorophyll fluorescence in chlorosomes from Chloroflexus aurantiacus by exogenous quinones

    DEFF Research Database (Denmark)

    Tokita, S; Frigaard, N-U; Hirota, M

    2000-01-01

    The quenching of bacteriochlorophyll (BChl) c fluorescence in chlorosomes isolated from Chloroflexus aurantiacus was examined by the addition of various benzoquinones, naphthoquinones (NQ), and anthraquinones (AQ). Many quinones showed strong quenching in the micromolar or submicromolar range. Th...

  10. The Psychiatry OSCE: a 20-year retrospective.

    Science.gov (United States)

    Hodges, Brian D; Hollenberg, Elisa; McNaughton, Nancy; Hanson, Mark D; Regehr, Glenn

    2014-02-01

    Twenty years ago researchers at the University of Toronto launched the Psychiatry Skills Assessment Project (PSAP), a research program exploring Objective Structured Clinical Examinations (OSCEs) in psychiatry. Between 1994 and 2005 PSAP produced publications on the feasibility, reliability, validity, ethics, and practical concerns of OSCEs in psychiatry. The current review has two parts: a review of the state of the art of OSCEs in psychiatry 20 years after they were introduced and documentation of the impact of the PSAP research program. A literature search identified all publications on OSCEs and psychiatry. Articles were coded thematically, and locations of agreement and controversies were identified. Bibliometric analysis identified citations of PSAP research papers, which were analyzed thematically. As of May 2013, there were 250 publications related to OSCEs in psychiatry (not including 10 PSAP papers), published in 29 different countries and ten languages. Prominent topics were the validity and acceptability of OSCEs and SPs, systems issues in adopting OSCEs in psychiatry, and the effects on learning. Eighty-eight percent of all publications cited PSAP work (300 citations). Citations were employed for four purposes: as evidence/justification (54 %); to frame replication research (14 %); to support adaptation of OSCEs in other countries and professions (15 %); and for debate (18 %). Over the past 20 years, use of OSCEs has grown steadily in psychiatry, and several national certification organizations have adopted OSCEs. PSAP work, introduced two decades ago, continues to provide a scholarly foundation for psychometric, practical, and ethical issues of interest to this field.

  11. Supramolecular organization of photosynthetic membrane proteins in the chlorosome-containing bacterium Chloroflexus aurantiacus

    Czech Academy of Sciences Publication Activity Database

    Bína, David; Gardian, Zdenko; Vácha, František; Litvín, Radek

    2014-01-01

    Roč. 122, č. 1 (2014), s. 13-21 ISSN 0166-8595 R&D Projects: GA ČR GBP501/12/G055; GA ČR(CZ) GAP205/11/1164 Institutional support: RVO:60077344 Keywords : Photosynthesis * LH1 * Chlorosome * Chloroflexus aurantiacus Subject RIV: BO - Biophysics Impact factor: 3.502, year: 2014

  12. Beta-carotene to bacteriochlorophyll-c energy transfer in self-assembled aggregates mimicking chlorosomes

    Czech Academy of Sciences Publication Activity Database

    Alster, J.; Polívka, Tomáš; Arellano, J.B.; Chábera, P.; Vácha, František; Pšenčík, J.

    2010-01-01

    Roč. 373, 1-2 (2010), s. 90-97 ISSN 0301-0104 R&D Projects: GA ČR GA206/09/0375 Institutional research plan: CEZ:AV0Z50510513 Keywords : carotenoids * chlorosomes * energy transfer Subject RIV: BO - Biophysics Impact factor: 2.017, year: 2010

  13. Pabriks denied in OSCE challenge / Lelde Benke

    Index Scriptorium Estoniae

    Benke, Lelde

    2010-01-01

    OSCE parlamentaarse assamblee peasekretäriks sai uuesti Spencer Oliver, keda toetas 95% hääletanutest. Läti endine välisminister Artis Pabriks, kes tahtis muuta OSCE PA peasekretäri valimisprotsessi ja hääletussüsteemi, kaotas

  14. Temporary tattoos: a novel OSCE assessment tool.

    Science.gov (United States)

    Gormley, Gerry; Menary, Allison; Layard, Brooke; Hart, Nigel; McCourt, Collette

    2013-08-01

    There are many issues regarding the use of real patients in objective structured clinical examinations (OSCEs). In dermatology OSCE stations, standardised patients (SPs) with clinical photographs are often used. Temporary transfer tattoos can potentially simulate skin lesions when applied to an SP. This study aims to appraise the use of temporary malignant melanoma tattoos within an OSCE framework. Within an 11-station OSCE, a temporary malignant melanoma tattoo was developed and applied to SPs in a 'skin lesion' OSCE station. A questionnaire captured the opinions of the candidate, SP and examiners, and the degree of perceived realism of each station was determined. Standard post hoc OSCE analysis determined the psychometric reliability of the stations. The response rates were 95.9 per cent of candidates and 100 per cent of the examiners and SPs. The 'skin lesion' station achieved the highest realism score compared with other stations: 89.0 per cent of candidates felt that the skin lesion appeared realistic; only 28 per cent of candidates had ever seen a melanoma before in training. The psychometric performance of the melanoma station was comparable with, and in many instances better than, other OSCE stations. Transfer tattoo technology facilitates a realistic dermatology OSCE station encounter. Temporary tattoos, alongside trained SPs, provide an authentic, standardised and reliable experience, allowing the assessment of integrated dermatology clinical skills. © 2013 John Wiley & Sons Ltd.

  15. Bacteriochlorophyll f: properties of chlorosomes containing the “forbidden chlorophyll”

    Directory of Open Access Journals (Sweden)

    Kajetan Vogl

    2012-08-01

    Full Text Available The chlorosomes of green sulfur bacteria (GSB are mainly assembled from one of three types of bacteriochlorophylls (BChls, BChls c, d, and e. By analogy to the relationship between BChl c and BChl d (20-desmethyl-BChl c, a fourth type of BChl, BChl f (20-desmethyl-BChl e, should exist but has not yet been observed in nature. The bchU gene (bacteriochlorophyllide C-20 methyltransferase of the brown-colored green sulfur bacterium Chlorobaculum limnaeum was inactivated by conjugative transfer from Eshcerichia coli and homologous recombination of a suicide plasmid carrying a portion of the bchU. The resulting bchU mutant was greenish brown in color and synthesized BChl fF. The chlorosomes of the bchU mutant had similar size and polypeptide composition as those of the wild type (WT, but the Qy absorption band of the BChl f aggregates was blue-shifted 16 nm (705 nm vs. 721 nm for the WT. Fluorescence spectroscopy showed that energy transfer to the baseplate was much less efficient in chlorosomes containing BChl f than in WT chlorosomes containing BChl e. When cells were grown at high irradiance with tungsten or fluorescent light, the WT and bchU mutant had identical growth rates. However, the WT grew about 40% faster than the bchU mutant at low irradiance (10 μmol photons m−2 s-1. Less efficient energy transfer from BChl f aggregates to BChl a in the baseplate, the much slower growth of the strain producing BChl f relative to the WT, and competition from other phototrophs, may explain why BChl f is not observed naturally.

  16. {beta}-Carotene to bacteriochlorophyll c energy transfer in self-assembled aggregates mimicking chlorosomes

    Energy Technology Data Exchange (ETDEWEB)

    Alster, J. [Faculty of Mathematics and Physics, Charles University, Ke Karlovu 3, 121 16 Praha (Czech Republic); Polivka, T. [Institute of Physical Biology, University of South Bohemia, Zamek 136, 373 33 Nove Hrady (Czech Republic); Biology Centre, Academy of Sciences of the Czech Republic, Branisovska 31, 370 05 Ceske Budejovice (Czech Republic); Arellano, J.B. [Instituto de Recursos Naturales y Agrobiologia de Salamanca (IRNASA-CSIC), Apdo. 257, 37071 Salamanca (Spain); Chabera, P. [Institute of Physical Biology, University of South Bohemia, Zamek 136, 373 33 Nove Hrady (Czech Republic); Vacha, F. [Institute of Physical Biology, University of South Bohemia, Zamek 136, 373 33 Nove Hrady (Czech Republic); Biology Centre, Academy of Sciences of the Czech Republic, Branisovska 31, 370 05 Ceske Budejovice (Czech Republic); Psencik, J., E-mail: psencik@karlov.mff.cuni.cz [Faculty of Mathematics and Physics, Charles University, Ke Karlovu 3, 121 16 Praha (Czech Republic); Institute of Physical Biology, University of South Bohemia, Zamek 136, 373 33 Nove Hrady (Czech Republic)

    2010-07-19

    Carotenoids are together with bacteriochlorophylls important constituents of chlorosomes, the light-harvesting antennae of green photosynthetic bacteria. Majority of bacteriochlorophyll molecules form self-assembling aggregates inside the chlorosomes. Aggregates of bacteriochlorophylls with optical properties similar to those of chlorosomes can also be prepared in non-polar organic solvents or in aqueous environments when a suitable non-polar molecule is added. In this work, the ability of {beta}-carotene to induce aggregation of bacteriochlorophyll c in aqueous buffer was studied. Excitation relaxation and energy transfer in the carotenoid-bacteriochlorophyll assemblies were measured using femtosecond and nanosecond transient absorption spectroscopy. A fast, {approx}100-fs energy transfer from the S{sub 2} state of {beta}-carotene to bacteriochlorophyll c was revealed, while no evidence for significant energy transfer from the S{sub 1} state was found. Picosecond formation of the carotenoid triplet state (T{sub 1}) was observed, which was likely generated by singlet homo-fission from the S{sub 1} state of {beta}-carotene.

  17. X-ray scattering and electron cryomicroscopy study on the effect of carotenoid biosynthesis to the structure of Chlorobium tepidum chlorosomes

    DEFF Research Database (Denmark)

    Ikonen, T P; Li, H; Psencík, J

    2007-01-01

    effect on chlorosome biogenesis and structure. The results indicate that carotenoids with a sufficiently long conjugated system are important for the biogenesis of the chlorosome baseplate. Defects in the baseplate structure affected the shape of the chlorosomes and were correlated with differences...... studied by means of x-ray scattering and electron cryomicroscopy. The chlorosomes from each mutant strain exhibited a lamellar arrangement of the bacteriochlorophyll c aggregates, which are the major constituents of the chlorosome interior. However, the carotenoid content and composition had a pronounced...... in the arrangement of lamellae and spacing between the lamellar planes of bacteriochlorophyll aggregates. In addition, comparisons among the various mutants enabled refinement of the assignments of the x-ray scattering peaks. While the main scattering peaks come from the lamellar structure of bacteriochlorophyll c...

  18. Back to the future: An online OSCE Management Information System for nursing OSCEs.

    Science.gov (United States)

    Meskell, Pauline; Burke, Eimear; Kropmans, Thomas J B; Byrne, Evelyn; Setyonugroho, Winny; Kennedy, Kieran M

    2015-11-01

    The Objective Structured Clinical Examination (OSCE) is an established tool in the repertoire of clinical assessment methods in nurse education. The use of OSCEs facilitates the assessment of psychomotor skills as well as knowledge and attitudes. Identified benefits of OSCE assessment include development of students' confidence in their clinical skills and preparation for clinical practice. However, a number of challenges exist with the traditional paper methodology, including documentation errors and inadequate student feedback. To explore electronic OSCE delivery and evaluate the benefits of using an electronic OSCE management system. To explore assessors' perceptions of and attitudes to the computer based package. This study was conducted using electronic software in the management of a four station OSCE assessment with a cohort of first year undergraduate nursing students delivered over two consecutive years (n=203) in one higher education institution in Ireland. A quantitative descriptive survey methodology was used to obtain the views of the assessors on the process and outcome of using the software. OSCE documentation was converted to electronic format. Assessors were trained in the use of the OSCE management software package and laptops were procured to facilitate electronic management of the OSCE assessment. Following the OSCE assessment, assessors were invited to evaluate the experience. Electronic software facilitated the storage and analysis of overall group and individual results thereby offering considerable time savings. Submission of electronic forms was allowed only when fully completed thus removing the potential for missing data. The feedback facility allowed the student to receive timely evaluation on their performance and to benchmark their performance against the class. Assessors' satisfaction with the software was high. Analysis of assessment results can highlight issues around internal consistency being moderate and examiners variability

  19. Taking OSCE examiner training on the road: reaching the masses.

    Science.gov (United States)

    Reid, Katharine; Smallwood, David; Collins, Margo; Sutherland, Ruth; Dodds, Agnes

    To ensure the rigour of objective structured clinical examinations (OSCEs) in assessing medical students, medical school educators must educate examiners with a view to standardising examiner assessment behaviour. Delivering OSCE examiner training is a necessary yet challenging part of the OSCE process. A novel approach to implementing training for current and potential OSCE examiners was trialled by delivering large-group education sessions at major teaching hospitals. The 'OSCE Roadshow' comprised a short training session delivered in the context of teaching hospital 'Grand Rounds' to current and potential OSCE examiners. The training was developed to educate clinicians about OSCE processes, clarify the examiners' role and required behaviours, and to review marking guides and mark allocation in an effort to standardise OSCE processes and encourage consistency in examiner marking behaviour. A short exercise allowed participants to practise marking a mock OSCE to investigate examiner marking behaviour after the training. OSCE Roadshows at four metropolitan and one rural teaching hospital were well received and well attended by 171 clinicians across six sessions. Unexpectedly, medical students also attended in large numbers ( n= 220). After training, participants' average scores for the mock OSCE clustered closely around the ideal score of 28 (out of 40), and the average scores did not differ according to the levels of clinical experience. The OSCE Roadshow demonstrated the potential of brief familiarisation training in reaching large numbers of current and potential OSCE examiners in a time and cost-effective manner to promote standardisation of OSCE processes.

  20. Electronic acquisition of OSCE performance using tablets

    Directory of Open Access Journals (Sweden)

    Hochlehnert, Achim

    2015-10-01

    Full Text Available Background: Objective Structured Clinical Examinations (OSCEs often involve a considerable amount of resources in terms of materials and organization since the scores are often recorded on paper. Computer-assisted administration is an alternative with which the need for material resources can be reduced. In particular, the use of tablets seems sensible because these are easy to transport and flexible to use.Aim: User acceptance concerning the use of tablets during OSCEs has not yet been extensively investigated. The aim of this study was to evaluate tablet-based OSCEs from the perspective of the user (examiner and the student examinee.Method: For two OSCEs in Internal Medicine at the University of Heidelberg, user acceptance was analyzed regarding tablet-based administration (satisfaction with functionality and the subjective amount of effort as perceived by the examiners. Standardized questionnaires and semi-standardized interviews were conducted (complete survey of all participating examiners. In addition, for one OSCE, the subjective evaluation of this mode of assessment was gathered from a random sample of participating students in semi-standardized interviews.Results: Overall, the examiners were very satisfied with using tablets during the assessment. The subjective amount of effort to use the tablet was found on average to be “hardly difficult”. The examiners identified the advantages of this mode of administration as being in particular the ease of use and low rate of error. During the interviews of the examinees, acceptance for the use of tablets during the assessment was also detected.Discussion: Overall, it was found that the use of tablets during OSCEs was well accepted by both examiners and examinees. We expect that this mode of assessment also offers advantages regarding assessment documentation, use of resources, and rate of error in comparison with paper-based assessments; all of these aspects should be followed up on in

  1. Task Demands in OSCEs Influence Learning Strategies.

    Science.gov (United States)

    Lafleur, Alexandre; Laflamme, Jonathan; Leppink, Jimmie; Côté, Luc

    2017-01-01

    Models on pre-assessment learning effects confirmed that task demands stand out among the factors assessors can modify in an assessment to influence learning. However, little is known about which tasks in objective structured clinical examinations (OSCEs) improve students' cognitive and metacognitive processes. Research is needed to support OSCE designs that benefit students' metacognitive strategies when they are studying, reinforcing a hypothesis-driven approach. With that intent, hypothesis-driven physical examination (HDPE) assessments ask students to elicit and interpret findings of the physical exam to reach a diagnosis ("Examine this patient with a painful shoulder to reach a diagnosis"). When studying for HDPE, students will dedicate more time to hypothesis-driven discussions and practice than when studying for a part-task OSCE ("Perform the shoulder exam"). It is expected that the whole-task nature of HDPE will lead to a hypothesis-oriented use of the learning resources, a frequent use of adjustment strategies, and persistence with learning. In a mixed-methods study, 40 medical students were randomly paired and filmed while studying together for two hypothetical OSCE stations. Each 25-min study period began with video cues asking to study for either a part-task OSCE or an HDPE. In a crossover design, sequences were randomized for OSCEs and contents (shoulder or spine). Time-on-task for discussions or practice were categorized as "hypothesis-driven" or "sequence of signs and maneuvers." Content analysis of focus group interviews summarized students' perception of learning resources, adjustment strategies, and persistence with learning. When studying for HDPE, students allocate significantly more time for hypothesis-driven discussions and practice. Students use resources contrasting diagnoses and report persistence with learning. When studying for part-task OSCEs, time-on-task is reversed, spent on rehearsing a sequence of signs and maneuvers. OSCEs with

  2. Does student performance on preclinical OSCEs relate to clerkship grades?

    Directory of Open Access Journals (Sweden)

    Margot Chima

    2016-06-01

    Full Text Available Background: Objective structured clinical examinations (OSCEs have been used to assess the clinical competence and interpersonal skills of healthcare professional students for decades. However, the relationship between preclinical (second year or M2 OSCE grades and clerkship performance had never been evaluated, until it was explored to provide information to educators at the University of Nebraska Medical Center (UNMC. In addition, the relationship between M2 OSCE communication scores (which is a portion of the total score and third-year (M3 Internal Medicine (IM clerkship OSCE scores was also explored. Lastly, conflicting evidence exists about the relationship between the amount of previous clinical experience and OSCE performance. Therefore, the relationship between M3 IM clerkship OSCE scores and the timing of the clerkship in the academic year was explored. Methods: Data from UNMC M2 OSCEs and M3 IM clerkship OSCEs were obtained for graduates of the 2013 and 2014 classes. Specifically, the following data points were collected: M2 fall OSCE total, M2 fall OSCE communication; M2 spring OSCE total, M2 spring OSCE communication; and M3 IM clerkship OSCE total percentages. Data were organized by class, M3 IM clerkship OSCE performance, and timing of the clerkship. Microsoft Excel and SPSS were used for data organization and analysis. Results: Of the 245 records, 229 (93.5% had data points for all metrics of interest. Significant differences between the classes of 2013 and 2014 existed for average M2 spring total, M2 spring communication, and M3 IM clerkship OSCEs. Retrospectively, there were no differences in M2 OSCE performances based on how students scored on the M3 IM clerkship OSCE. M3 IM clerkship OSCE performance improved for those students who completed the clerkship last in the academic year. Conclusions: There were inconsistencies in OSCE performances between the classes of 2013 and 2014, but more information is needed to determine if

  3. Does student performance on preclinical OSCEs relate to clerkship grades?

    Science.gov (United States)

    Chima, Margot; Dallaghan, Gary Beck

    2016-01-01

    Objective structured clinical examinations (OSCEs) have been used to assess the clinical competence and interpersonal skills of healthcare professional students for decades. However, the relationship between preclinical (second year or M2) OSCE grades and clerkship performance had never been evaluated, until it was explored to provide information to educators at the University of Nebraska Medical Center (UNMC). In addition, the relationship between M2 OSCE communication scores (which is a portion of the total score) and third-year (M3) Internal Medicine (IM) clerkship OSCE scores was also explored. Lastly, conflicting evidence exists about the relationship between the amount of previous clinical experience and OSCE performance. Therefore, the relationship between M3 IM clerkship OSCE scores and the timing of the clerkship in the academic year was explored. Data from UNMC M2 OSCEs and M3 IM clerkship OSCEs were obtained for graduates of the 2013 and 2014 classes. Specifically, the following data points were collected: M2 fall OSCE total, M2 fall OSCE communication; M2 spring OSCE total, M2 spring OSCE communication; and M3 IM clerkship OSCE total percentages. Data were organized by class, M3 IM clerkship OSCE performance, and timing of the clerkship. Microsoft Excel and SPSS were used for data organization and analysis. Of the 245 records, 229 (93.5%) had data points for all metrics of interest. Significant differences between the classes of 2013 and 2014 existed for average M2 spring total, M2 spring communication, and M3 IM clerkship OSCEs. Retrospectively, there were no differences in M2 OSCE performances based on how students scored on the M3 IM clerkship OSCE. M3 IM clerkship OSCE performance improved for those students who completed the clerkship last in the academic year. There were inconsistencies in OSCE performances between the classes of 2013 and 2014, but more information is needed to determine if this is because of testing variability or heterogeneity

  4. Awarding global grades in OSCEs: evaluation of a novel eLearning resource for OSCE examiners.

    Science.gov (United States)

    Gormley, Gerard J; Johnston, Jenny; Thomson, Clare; McGlade, Kieran

    2012-01-01

    A novel online resource has been developed to aid OSCE examiner training comprising a series of videos of OSCE performances that allow inter-examiner comparison of global grade decisions. To evaluate this training resource in terms of usefulness and ability to improve examiner confidence in awarding global grades in OSCEs. Data collected from the first 200 users included global grades awarded, willingness to change grades following peer comparison and confidence in awarding grades before and after training. Most (86.5%) agreed that the resource was useful in developing global grade scoring ability in OSCEs, with a significant improvement in confidence in awarding grades after using the training package (p<0.001). This is a useful and effective online training package. As an adjunct to traditional training it offers a practical solution to the problem of availability of examiners.

  5. Taking OSCE examiner training on the road: reaching the masses

    Directory of Open Access Journals (Sweden)

    Katharine Reid

    2016-09-01

    Full Text Available Background: To ensure the rigour of objective structured clinical examinations (OSCEs in assessing medical students, medical school educators must educate examiners with a view to standardising examiner assessment behaviour. Delivering OSCE examiner training is a necessary yet challenging part of the OSCE process. A novel approach to implementing training for current and potential OSCE examiners was trialled by delivering large-group education sessions at major teaching hospitals. Methods: The ‘OSCE Roadshow’ comprised a short training session delivered in the context of teaching hospital ‘Grand Rounds’ to current and potential OSCE examiners. The training was developed to educate clinicians about OSCE processes, clarify the examiners’ role and required behaviours, and to review marking guides and mark allocation in an effort to standardise OSCE processes and encourage consistency in examiner marking behaviour. A short exercise allowed participants to practise marking a mock OSCE to investigate examiner marking behaviour after the training. Results: OSCE Roadshows at four metropolitan and one rural teaching hospital were well received and well attended by 171 clinicians across six sessions. Unexpectedly, medical students also attended in large numbers (n=220. After training, participants’ average scores for the mock OSCE clustered closely around the ideal score of 28 (out of 40, and the average scores did not differ according to the levels of clinical experience. Conclusion: The OSCE Roadshow demonstrated the potential of brief familiarisation training in reaching large numbers of current and potential OSCE examiners in a time and cost-effective manner to promote standardisation of OSCE processes.

  6. Association of bacteriochlorophyll a with the CsmA protein in chlorosomes of the photosynthetic green filamentous bacterium Chloroflexus aurantiacus

    DEFF Research Database (Denmark)

    Sakuragi, Y; Frigaard, N-U; Shimada, K

    1999-01-01

    with molecular masses of 11 and 18 kDa (CsmN and CmsM), whereas the spectral properties of BChl a and BChl c were not changed. By the new hexanol-detergent (HD) treatment, most BChl c and all of the detected proteins except CsmA were removed from the chlorosomes without changing the BChl a spectral properties....... Subsequent proteinase K treatment of these HD-treated chlorosomes caused digestion of CsmA and a simultaneous decrease of the BChl a absorption band. Based on these results, we suggest that CsmA is associated with BChl a in the chlorosomes. This suggestion was supported by the measured stoichiometric ratio...... of BChl a to CsmA in isolated chlorosomes, which was estimated to be between 1.2 and 2.7 by amino acid analysis of the SDS-PAGE-resolved protein bands....

  7. Kremlin's OSCE Ministerial Council-related demarches / Rokas M. Tracevskis

    Index Scriptorium Estoniae

    Tracevskis, Rokas M.

    2011-01-01

    Detsembril alguses Vilniuses toimunud OSCE kohtumisel kritiseeris USA riigisekretär Hillary Clinton Venemaa parlamendivalimiste korraldamist. Venemaa peaminister Vladimir Putin ütles, et USA riigisekretäri kõne saatis Vene opositsioonile tegutsemissignaali. Venemaa välisministri Sergei Lavrovi ja Leedu välisministri Audronius Azubalise ebasõbralikust kohtumisest. Venemaa blokeeris OSCE-s internetivabaduse kaitsele suunatud deklaratsiooni

  8. Pigments and proteins in green bacterial chlorosomes studied by matrix-assisted laser desorption ionization mass spectrometry

    DEFF Research Database (Denmark)

    Persson, S; Sönksen, C P; Frigaard, N U

    2000-01-01

    We have used matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI-TOF-MS) for mass determination of pigments and proteins in chlorosomes, the light-harvesting organelles from the photosynthetic green sulfur bacterium Chlorobium tepidum. By applying a small volume (1...... microL) of a concentrated suspension of isolated chlorosomes directly to the target of the mass spectrometer we have been able to detect bacteriochlorophyll a and all the major homologs of bacteriochlorophyll c. The peak heights of the different bacteriochlorophyll c homologs in the MALDI spectra were...... proportional to peak areas obtained from HPLC analysis of the same sample. The same result was also obtained when whole cells of Chl. tepidum were applied to the target, indicating that MALDI-MS can provide a rapid method for obtaining a semiquantitative determination or finger-print of the bacteriochlorophyll...

  9. Rasch analysis on OSCE data : An illustrative example.

    Science.gov (United States)

    Tor, E; Steketee, C

    2011-01-01

    The Objective Structured Clinical Examination (OSCE) is a widely used tool for the assessment of clinical competence in health professional education. The goal of the OSCE is to make reproducible decisions on pass/fail status as well as students' levels of clinical competence according to their demonstrated abilities based on the scores. This paper explores the use of the polytomous Rasch model in evaluating the psychometric properties of OSCE scores through a case study. The authors analysed an OSCE data set (comprised of 11 stations) for 80 fourth year medical students based on the polytomous Rasch model in an effort to answer two research questions: (1) Do the clinical tasks assessed in the 11 OSCE stations map on to a common underlying construct, namely clinical competence? (2) What other insights can Rasch analysis offer in terms of scaling, item analysis and instrument validation over and above the conventional analysis based on classical test theory? The OSCE data set has demonstrated a sufficient degree of fit to the Rasch model (Χ(2) = 17.060, DF=22, p=0.76) indicating that the 11 OSCE station scores have sufficient psychometric properties to form a measure for a common underlying construct, i.e. clinical competence. Individual OSCE station scores with good fit to the Rasch model (p > 0.1 for all Χ(2) statistics) further corroborated the characteristic of unidimensionality of the OSCE scale for clinical competence. A Person Separation Index (PSI) of 0.704 indicates sufficient level of reliability for the OSCE scores. Other useful findings from the Rasch analysis that provide insights, over and above the analysis based on classical test theory, are also exemplified using the data set. The polytomous Rasch model provides a useful and supplementary approach to the calibration and analysis of OSCE examination data.

  10. Hubungan Tingkat Kecemasan dalam Menghadapi Objective Structured Clinical Examination (OSCE dengan Kelulusan OSCE pada Mahasiswa Fakultas Kedokteran Universitas Andalas

    Directory of Open Access Journals (Sweden)

    Dinda Putri Amir

    2016-01-01

    Full Text Available AbstrakKecemasan adalah normal terjadi dalam kehidupan, namun kecemasan dapat menjadi abnormal jika respons terhadap stimulus berlebihan. Pada mahasiswa, kecemasan berpengaruh terhadap proses pendidikan. OSCE merupakan salah satu bagian dari ujian komprehensif yang menguji keterampilan medis mahasiswa yang akan memasuki kepaniteraan klinik. Ujian ini hampir sama dengan ujian skills lab, tapi materi ujian lebih banyak dan setting ujian juga berbeda sehingga situasi tersebut menimbulkan kecemasan pada mahasiswa menjelang OSCE. Tujuan penelitian ini adalah menentukan hubungan tingkat kecemasan dalam menghadapi OSCE dengan kelulusan OSCE pada mahasiwa FK Unand. Jenis penelitian ini adalah deskriptif analitik dengan sampel sebanyak 34 orang. Data diperoleh melalui wawancara kepada peserta OSCE menggunakan kuesioner Hamilton Rating Scale for Anxiety (HRS-A dan Bagian Akademik FK Unand yang selanjutnya dianalisis melalui uji korelasi Gamma dan Somers’d. Hasil penelitian ini didapatkan nilai koefisien korelasi (r sebesar -0,106 dan nilai signifikansi p>0,05. Berdasarkan hasil penelitian dapat disimpulkan bahwa tidak terdapat hubungan yang bermakna antara tingkat kecemasan dalam menghadapi OSCE dengan kelulusan OSCE pada mahasiwa FK Unand.Kata kunci: kecemasan, ujian, OSCE, HRS-A AbstractAnxiety normally occurs in life, but anxiety can become abnormal if the response to the stimulus is excessive. In student, anxiety affects the educational process. OSCE is a part of comprehensive exam that examine medical skills of the students who will enter their clinical stage. Although this exam is similiar like skills lab exam but the matters of exam is more complex and the setting of exam is different too, so these situations cause anxiety in students toward OSCE. The objective of this study was to determine the correlation between anxiety level in facing OSCE to students’ graduation of OSCE in Faculty of Medicine Andalas University. This study was a

  11. Implementation of an OSCE at Kaohsiung Medical University

    Directory of Open Access Journals (Sweden)

    Yu-Sheng Huang

    2007-04-01

    Full Text Available The Objective Structured Clinical Examination (OSCE, a tool to objectively and fairly assess medical students' clinical competences, has become widely used in medical education worldwide. However, most medical schools in Taiwan have just begun to adopt this assessment method. In 2003, Kaohsiung Medical University (KMU established the first standardized patient (SP program in Taiwan and applied SPs with an OSCE. This study reports the process of the implementation of an OSCE at KMU, which includes collecting information, visiting leading clinical skills centers, consulting medical educators from other countries, holding international conferences, establishing an OSCE committee, writing cases, training SPs, administrating the OSCE, and receiving feedback from medical students. Most students were satisfied with the assessment and appreciated the learning experience. Based on the experience in 2003, the OSCE committee decided to incorporate the OSCE into the medical curriculum as a measure to assess medical students' clinical competences. In addition to assessing medical students' clinical competence, the OSCE can also be applied to other professional health education, such as dentistry, nursing, and pharmacy. We are currently sharing our experience with other colleges at KMU.

  12. Increased Authenticity in Practical Assessment Using Emergency Case OSCE Stations

    Science.gov (United States)

    Ruesseler, Miriam; Weinlich, Michael; Byhahn, Christian; Muller, Michael P.; Junger, Jana; Marzi, Ingo; Walcher, Felix

    2010-01-01

    In case of an emergency, a fast and structured patient management is crucial for patient's outcome. The competencies needed should be acquired and assessed during medical education. The objective structured clinical examination (OSCE) is a valid and reliable assessment format to evaluate practical skills. However, traditional OSCE stations examine…

  13. Rasch analysis on OSCE data : An illustrative example

    Directory of Open Access Journals (Sweden)

    Tor E

    2011-06-01

    Full Text Available BackgroundThe Objective Structured Clinical Examination (OSCE is awidely used tool for the assessment of clinical competencein health professional education. The goal of the OSCE is tomake reproducible decisions on pass/fail status as well asstudents’ levels of clinical competence according to theirdemonstrated abilities based on the scores. This paperexplores the use of the polytomous Rasch model inevaluating the psychometric properties of OSCE scoresthrough a case study.MethodThe authors analysed an OSCE data set (comprised of 11stations for 80 fourth year medical students based on thepolytomous Rasch model in an effort to answer tworesearch questions: (1 Do the clinical tasks assessed in the11 OSCE stations map on to a common underlyingconstruct, namely clinical competence? (2 What otherinsights can Rasch analysis offer in terms of scaling, itemanalysis and instrument validation over and above theconventional analysis based on classical test theory?ResultsThe OSCE data set has demonstrated a sufficient degree offit to the Rasch model (χ2 = 17.060, DF=22, p=0.76indicating that the 11 OSCE station scores have sufficientpsychometric properties to form a measure for a commonunderlying construct, i.e. clinical competence. IndividualOSCE station scores with good fit to the Rasch model (p >0.1 for all χ2 statistics further corroborated thecharacteristic of unidimensionality of the OSCE scale forclinical competence. A Person Separation Index (PSI of0.704 indicates sufficient level of reliability for the OSCEscores. Other useful findings from the Rasch analysis thatprovide insights, over and above the analysis based onclassical test theory, are also exemplified using the data set.ConclusionThe polytomous Rasch model provides a useful andsupplementary approach to the calibration and analysis ofOSCE examination data.

  14. Objective structured clinical examination (OSCE in pharmacy education - a trend

    Directory of Open Access Journals (Sweden)

    Shirwaikar A

    2015-12-01

    Full Text Available Pharmacy education has undergone a radical change as it evolves towards becoming a more patient oriented profession. With a greater emphasis on problem based teaching and competency, the Objective Structured Clinical Examination (OSCE, supported by its reliability and validity became the gold standard for the evaluation of clinical skills of undergraduate students of medicine and pharmacy worldwide. Core competency evaluation has become a mandatory and critical norm for accountability of educational objectives as the traditional testing tools cannot evaluate clinical competence. Interpersonal and communication skills, professional judgment, skills of resolution etc., may be best assessed through a well- structured OSCE in comparison to oral examinations, multiple choice tests and other methods of assessment. Though OSCEs as an objective method of evaluation offer several advantages to both students and teachers, it also has disadvantages and pitfalls in implementation. This article reviews the OSCE as a trend in pharmacy education.

  15. Russia coordinates new broadside against OSCE / Liz Fuller

    Index Scriptorium Estoniae

    Fuller, Liz

    2004-01-01

    SRÜ maade poolt 8. juulil 2004 Viinis tehtud avaldusest, mille kohaselt sekkub Euroopa Julgeoleku- ja Koostööorganisatsioon (OSCE) riikide siseasjadesse ning rakendab topeltstandardeid. Avaldusega ei ühinenud Gruusia ja Aserbaidžaan

  16. Item Analysis to Improve Reliability for an Internal Medicine Undergraduate OSCE

    Science.gov (United States)

    Auewarakul, Chirayu; Downing, Steven M.; Praditsuwan, Rungnirand; Jaturatamrong, Uapong

    2005-01-01

    Utilization of objective structured clinical examinations (OSCEs) for final assessment of medical students in Internal Medicine requires a representative sample of OSCE stations. The reliability and generalizability of OSCE scores provides validity evidence for OSCE scores and supports its contribution to the final clinical grade of medical…

  17. The use of the OSCE in postgraduate education.

    Science.gov (United States)

    Arnold, R C; Walmsley, A D

    2008-08-01

    The Objective Structured Clinical Examination (OSCE) is a method of assessing the clinical skills of undergraduates in medicine, dentistry and other health sciences and is employed increasingly in postgraduate education. To describe the application of the OSCE to the development of Lifelong Learning and Continuing Professional Development (CPD) for General Dental Practitioners (GDPs). A postgraduate course was designed as an OSCE for GDPs. The OSCE comprised 12 stations covering different aspects of general dentistry. After an introductory seminar outlining the aim of the course, the participants spent 7 min at each station. Each question or task required 10 answers and was designed to highlight areas of weakness or interest and to stimulate further study of the presenting topic. Solutions and answers were provided at each station for self-assessment along with a list of locally presented courses related to that subject. Participants were invited to leave contact details and to make suggestions for future postgraduate courses. The final session consisted of a group discussion and participants were invited to complete an evaluation form to express opinions on the course. The evaluation demonstrated that most candidates found participation in the OSCE stimulated their interest in CPD. The OSCE also highlighted areas of weakness in knowledge of certain clinical procedures. Group discussion confirmed that practitioners found the hands-on component valuable and that they were likely to participate in further OSCEs to enhance their CPD. Suggestions received during the discussion were used to modify the course. The OSCE course fulfilled its aim of assisting practitioners to organise their CPD. The reflective nature of the course was helpful in evaluating clinical knowledge and the unique multidisciplinary style fulfilled its objective in promoting thoughts regarding future study.

  18. Feedback in the OSCE: What Do Residents Remember?

    Science.gov (United States)

    Humphrey-Murto, Susan; Mihok, Marika; Pugh, Debra; Touchie, Claire; Halman, Samantha; Wood, Timothy J

    2016-01-01

    The move to competency-based education has heightened the importance of direct observation of clinical skills and effective feedback. The Objective Structured Clinical Examination (OSCE) is widely used for assessment and affords an opportunity for both direct observation and feedback to occur simultaneously. For feedback to be effective, it should include direct observation, assessment of performance, provision of feedback, reflection, decision making, and use of feedback for learning and change. If one of the goals of feedback is to engage students to think about their performance (i.e., reflection), it would seem imperative that they can recall this feedback both immediately and into the future. This study explores recall of feedback in the context of an OSCE. Specifically, the purpose of this study was to (a) determine the amount and the accuracy of feedback that trainees remember immediately after an OSCE, as well as 1 month later, and (b) assess whether prompting immediate recall improved delayed recall. Internal medicine residents received 2 minutes of verbal feedback from physician examiners in the context of an OSCE. The feedback was audio-recorded and later transcribed. Residents were randomly allocated to the immediate recall group (immediate-RG; n = 10) or the delayed recall group (delayed-RG; n = 8). The immediate-RG completed a questionnaire prompting recall of feedback received immediately after the OSCE, and then again 1 month later. The delayed-RG completed a questionnaire only 1 month after the OSCE. The total number and accuracy of feedback points provided by examiners were compared to the points recalled by residents. Results comparing recall at 1 month between the immediate-RG and the delayed-RG were also studied. Physician examiners provided considerably more feedback points (M = 16.3) than the residents recalled immediately after the OSCE (M = 2.61, p feedback points recalled upon completion of the OSCE (2.61) compared to 1 month later (M = 1

  19. Detection Learning Style Vark For Out Of School Children (OSC)

    Science.gov (United States)

    Amran, Ali; Desiani, Anita; Hasibuan, MS

    2017-04-01

    Learning style is different for every learner especially for out of school children or OSC. They are not like formal students, they are learners but they don’t have a teacher as a guide for learning. E-learning is one of the solutions to help OSC to get education. E-learning should have preferred learning styles of learners. Data for identifying the learning style in this study were collected with a VARK questionnaire from 25 OSC in junior high school level from 5 municipalities in Palembang. The validity of the questionnaire was considered on basis of experts’ views and its reliability was calculated by using Cronbach’s alpha coefficients (α=0.68). Overall, 55% preferred to use a single learning style (Uni-modal). Of these, 27,76% preferred Aural, 20,57% preferred Reading Writing, 33,33% preferred Kinaesthetic and 23,13% preferred Visual. 45% of OSC preferred more than one style, 30% chose two-modes (bimodal), and 15% chose three-modes (tri-modal). The Most preferred Learning style of OSC is kinaesthetic learning. Kinaesthetic learning requires body movements, interactivities, and direct contacts with learning materials, these things can be difficult to implement in eLearning, but E-learning should be able to adopt any learning styles which are flexible in terms of time, period, curriculum, pedagogy, location, and language.

  20. OSCEs for undergraduate clinical examination in orthopaedics: inter ...

    African Journals Online (AJOL)

    ... D (Group 2) was 8.625. The p-value was 0.001148 (95% confidence interval). Conclusion: There was statistically significant inter-examiner variability. We recommend that for all OSCE exams, examiners be paired with a deliberate attempt to pair a “Hawk” with a “Dove”. Statistical correction of biases is also recommended.

  1. USA ja Venemaa ristasid piike OSCE tuleviku pärast / Ahto Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Ahto, 1970-

    2006-01-01

    OSCE välisministrite kohtumiselt ei jõutud organisatsiooni tulevikus kokkuleppele. Kui USA nõuab, et OSCE-d tuleb tugevdada demokraatia edendajana ning valimiste aususe tagaja ja inimõiguste kaitsjana, siis Venemaa näeb sellises suunas liigset sekkumist liikmesriikide siseasjadesse

  2. OSCE vs. TEM: Different approaches to assess clinical skills of nursing students

    Directory of Open Access Journals (Sweden)

    Prasuna Jelly

    2017-01-01

    Full Text Available Introduction: Nurses are trained with specific clinical skills, and objective structured clinical examination (OSCE could be a better approach to assess clinical skills of nursing students. Materials and Methods: A comparative study was conducted by observational checklist regarding antenatal care and opinionnaire on the usefulness of OSCE and tradition evaluation method (TEM was used to assess the clinical skills and to get opinion. Results: The mean score of OSCE was more than TEM and the difference was statistically significant (P < 0.001. The opinion of students regarding the usefulness of OSCE was higher than TEM. Conclusions: The study concluded that implementing OSCE will overweigh the advantages of the TEM.

  3. Nurse educators’ perceptions of OSCE as a clinical evaluation method

    Directory of Open Access Journals (Sweden)

    MM Chabeli

    2001-09-01

    Full Text Available The South African Qualifications Authority, and the South African Nursing Council are in pursuit of quality nursing education to enable the learners to practise as independent and autonomous practitioners. The educational programme should focus on the facilitation of critical and reflective thinking skills that will help the learner to make rational decisions and solve problems. A way of achieving this level of functioning is the use of assessment and evaluation methods that measure the learners’ clinical competence holistically. This article is focused on the perceptions of twenty nurse educators, purposively selected from three Nursing Colleges affiliated to a university in Gauteng, regarding the use of OSCE (Objective Structured Clinical Examination as a clinical evaluation method within a qualitative and descriptive research strategy. Three focus group interviews were conducted in different sessions. A descriptive content analysis was used. Trustworthiness was ensured by using Lincoln and Guba’s model (1985. The results revealed both positive and negative aspects of OSCE as a clinical evaluation method with regard to: administrative aspects; evaluators; learners; procedures/instruments and evaluation. The conclusion drawn from the related findings is that OSCE does not measure the learners’ clinical competence holistically. It is therefore recommended that the identified negative perception be taken as challenges faced by nurse educators and that the positive aspects be strengthened. One way of meeting these recommendations is the use of varied alternative methods for clinical assessment and evaluation that focus on the holistic measurement of the learners’ clinical competence.

  4. Application of best practice guidelines for OSCEs-An Australian evaluation of their feasibility and value.

    Science.gov (United States)

    Mitchell, Marion L; Henderson, Amanda; Jeffrey, Carol; Nulty, Duncan; Groves, Michele; Kelly, Michelle; Knight, Sabina; Glover, Pauline

    2015-05-01

    Objective Structured Clinical Examinations (OSCEs) are widely used in health professional education and should be based on sound pedagogical foundations. The aim of this study is to evaluate the feasibility and utility of using Best Practice Guidelines (BPGs) within an OSCE format in a broad range of tertiary education settings with under-graduate and post-graduate nursing and midwifery students. We evaluated how feasible it was to apply the BPGs to modify OSCEs in a course; students' perspective of the OSCE; and finally, if the BPG-revised OSCEs better prepared students for clinical practice when compared with the original OSCEs. A mixed method with surveys, focus groups and semi-structured interviews evaluated the BPGs within an OSCE. Four maximally different contexts across four sites in Australia were used. Participants included lecturers and undergraduate nursing students in high and low fidelity simulation settings; under-graduate midwifery students; and post-graduate rural and remote area nursing students. 691 students participated in revised OSCEs. Surveys were completed by 557 students; 91 students gave further feedback through focus groups and 14 lecturers participated in interviews. At all sites the BPGs were successfully used to modify and implement OSCEs. Students valued the realistic nature of the modified OSCEs which contributed to students' confidence and preparation for clinical practice. The lecturers considered the revised OSCEs enhanced student preparedness for their clinical placements. The BPGs have a broad applicability to OSCEs in a wide range of educational contexts with improved student outcomes. Students and lecturers identified the revised OSCEs enhanced student preparation for clinical practice. Subsequent examination of the BPGs saw further refinement to a set of eight BPGs that provide a sequential guide to their application in a way that is consistent with best practice curriculum design principles. Copyright © 2015 Elsevier Ltd

  5. Enhancing OSCE preparedness with video exemplars in undergraduate nursing students. A mixed method study.

    Science.gov (United States)

    Massey, D; Byrne, J; Higgins, N; Weeks, B; Shuker, M-A; Coyne, E; Mitchell, M; Johnston, A N B

    2017-07-01

    Objective structured clinical examinations (OSCEs) are designed to assess clinical skill performance and competency of students in preparation for 'real world' clinical responsibilities. OSCEs are commonly used in health professional education and are typically associated with high levels of student anxiety, which may present a significant barrier to performance. Students, including nursing students, have identified that flexible access to exemplar OSCEs might reduce their anxiety and enable them to better prepare for such examinations. To implement and evaluate an innovative approach to preparing students for OSCEs in an undergraduate (registration) acute care nursing course. A set of digitized OSCE exemplars were prepared and embedded in the University-based course website as part of usual course learning activities. Use of the exemplars was monitored, pre and post OSCE surveys were conducted, and qualitative data were collected to evaluate the approach. OSCE grades were also examined. The online OSCE exemplars increased self-rated student confidence, knowledge, and capacity to prepare and provided clarity around assessment expectations. OSCE exemplars were accessed frequently and positively received; but did not impact on performance. Video exemplars aid student preparation for OSCEs, providing a flexible, innovative and clear example of the assessment process. Video exemplars improved self-rated student confidence and understanding of performance expectations, leading to increased engagement and reduced anxiety when preparing for the OSCE, but not overall OSCE performance. Such OSCE exemplars could be used to increase staff capacity and improve the quality of the student learning experience. Crown Copyright © 2017. Published by Elsevier Ltd. All rights reserved.

  6. Theoretical Study on the Rational Design of Cyano-Substituted P3HT Materials for OSCs

    DEFF Research Database (Denmark)

    Qiu, Meng; Brandt, Rasmus Guldbæk; Niu, Yingli

    2015-01-01

    Calculations have been made regarding the strong electron-withdrawing cyano (-CN) group, which was introduced onto the backbone of poly(3-hexylthiophene) (P3HT), as an effective way to improve the parameters essential for the photovoltaic performance of organic solar cells (OSCs). The substitution...... useful information for better design strategy for OSCs....

  7. Assessing the Organizational Social Context (OSC) of Child Welfare Systems: Implications for Research and Practice

    Science.gov (United States)

    Glisson, Charles; Green, Philip; Williams, Nathaniel J.

    2012-01-01

    Objective: The study: (1) provides the first assessment of the a "priori" measurement model and psychometric properties of the Organizational Social Context (OSC) measurement system in a US nationwide probability sample of child welfare systems; (2) illustrates the use of the OSC in constructing norm-based organizational culture and climate…

  8. OSCE as a Summative Assessment Tool for Undergraduate Students of Surgery-Our Experience.

    Science.gov (United States)

    Joshi, M K; Srivastava, A K; Ranjan, P; Singhal, M; Dhar, A; Chumber, S; Parshad, R; Seenu, V

    2017-12-01

    Traditional examination has inherent deficiencies. Objective Structured Clinical Examination (OSCE) is considered as a method of assessment that may overcome many such deficits. OSCE is being increasingly used worldwide in various medical specialities for formative and summative assessment. Although it is being used in various disciplines in our country as well, its use in the stream of general surgery is scarce. We report our experience of assessment of undergraduate students appearing in their pre-professional examination in the subject of general surgery by conducting OSCE. In our experience, OSCE was considered a better assessment tool as compared to the traditional method of examination by both faculty and students and is acceptable to students and faculty alike. Conducting OSCE is feasible for assessment of students of general surgery.

  9. Student evaluation of an OSCE in paediatrics at the University of the West Indies, Jamaica

    Directory of Open Access Journals (Sweden)

    Branday J Michael

    2004-10-01

    Full Text Available Abstract Background The Faculty of Medical Sciences, University of the West Indies first implemented the Objective Structured Clinical Examination (OSCE in the final MB Examination in Medicine and Therapeutics during the 2000–2001 academic year. Simultaneously, the Child Health Department initiated faculty and student training, and instituted the OSCE as an assessment instrument during the Child Health (Paediatric clerkship in year 5. The study set out to explore student acceptance of the OSCE as part of an evaluation of the Child Health clerkship. Methods A self-administered questionnaire was completed by successive groups of students immediately after the OSCE at the end of each clerkship rotation. Main outcome measures were student perception of examination attributes, which included the quality of instructions and organisation, the quality of performance, authenticity and transparency of the process, and usefulness of the OSCE as an assessment instrument compared to other formats. Results There was overwhelming acceptance of the OSCE in Child Health with respect to the comprehensiveness (90%, transparency (87%, fairness (70% and authenticity of the required tasks (58–78%. However, students felt that it was a strong anxiety-producing experience. And concerns were expressed regarding the ambiguity of some questions and inadequacy of time for expected tasks. Conclusion Student feedback was invaluable in influencing faculty teaching, curriculum direction and appreciation of student opinion. Further psychometric evaluation will strengthen the development of the OSCE.

  10. The Dental School Interview As a Predictor of Dental Students' OSCE Performance.

    Science.gov (United States)

    Park, Sang E; Price, Mirissa D; Karimbux, Nadeem Y

    2018-03-01

    The aim of this study was to evaluate the use of the dental school admissions interview score as a noncognitive indicator of performance in predoctoral dental education, with specific attention to whether a correlation existed between the admissions interview scores and performance on the objective structured clinical examination (OSCE). The study population consisted of all 175 students in the Harvard School of Dental Medicine (HSDM) DMD Classes of 2012 through 2016. Data on students' gender and age on entering dental school were self-reported using their applications for admission to the HSDM DMD program. Data on students' OSCE scores for three examination sessions were collected from the Office of Dental Education. The results showed that the students' interview scores did not significantly correlate with OSCE performance on any of the three exams. Performance on the first and second OSCEs did, however, correlate with performance on the third OSCE (pinterview score. These results suggest that although the admissions interview scores can serve as an important resource in student selection, with the lack of association between interview and OSCE scores, it is possible that the communication skills required for the interview do not directly overlap with those required for OSCE success.

  11. Hubungan Self Assessment-Peer Assessment dengan Nilai Kelulusan OSCE Mahasiswa Fakultas Kedokteran Unisba

    Directory of Open Access Journals (Sweden)

    Santun Bhekti Rahimah

    2017-02-01

    Full Text Available Abstrak Objective structured clinical examination (OSCE adalah cara penilaian kompetensi klinik mahasiswa secara komprehensif dan konsisten serta dapat dijadikan media untuk meningkatkan hasil belajar. Feedback dapat dilakukan oleh mahasiswa itu sendiri (self assessment maupun mahasiswa lain yang satu level (peer assessment. Self dan peer assessment diharapkan akan meningkatkan kemampuan mahasiswa dalam melihat tujuan pembelajaran, meningkatkan rasa percaya diri, kemampuan berpikir kritis, dan bertindak tepat dalam menghadapi ujian. Tujuan penelitian ini melihat hubungan self assessment dan peer assessment dengan nilai kelulusan OSCE mahasiswa tingkat dua dan empat FK Unisba tahun akademik 2012/2013. Nilai hasil ujian OSCE yang dipergunakan adalah pada periode Desember 2012–Juni 2013. Self dan peer assessment dilaksanakan setelah ujian OSCE. Self assessment dilakukan oleh mahasiswa itu sendiri, sedangkan peer assessment didapatkan dari lima orang mahasiswa lain yang pernah berada dalam satu kelompok dengan subjek. Hasil penelitian menunjukkan untuk mahasiswa tingkat dua terdapat korelasi bermakna self assessment dan peer assessment dengan nilai OSCE (p<0,001, arah hubungan antara keduanya positif, serta kekuatan hubungan keduanya sedang (R=0,426. Pada mahasiswa tingkat empat terdapat korelasi bermakna antara self assessment dan nilai OSCE (p<0,001 dengan kekuatan hubungan keduanya sedang (R=0,451, serta terdapat korelasi yang bermakna antara penilaian peer assessment dan nilai OSCE. Simpulan, self assessment mempunyai korelasi positif terhadap nilai kelulusan OSCE pada mahasiswa tingkat dua dan tingkat empat, sedangkan peer assessment mempunyai korelasi positif dengan nilai kelulusan OSCE hanya pada mahasiswa tingkat dua. Self assessment mempunyai korelasi positif dengan peer assessment pada mahasiswa tingkat dua dan tingkat empat FK Unisba tahun akademik 2012/2013. Abstract Objective structured clinical examination (OSCE is a tools to assess

  12. Student evaluation of an OSCE in General Medicine at Mamata Medical College, Andhra Pradesh

    Directory of Open Access Journals (Sweden)

    Dharma Rao V, Pramod Kumar Reddy M, Rajaneesh Reddy M, HanumiahA, Shyam Sunder P, Narasingha Reddy T, Kishore Babu SPV

    2014-04-01

    Full Text Available The assessment of student’s clinical competence is of paramount importance, and there are several means of evaluating student performance in medical examinations. The OSCE is an approach to student assessment in which aspects of clinical competence are evaluated in a comprehensive, consistent and structured manner with close attention to the objectivity of the process. The faculty of general medicine in collaboration with other clinical departments, Mamata Medical College, Khammam first implemented the objective structured clinical examination (OSCE in the final MBBS Part-II examination during the internal assessment examination for the 2011-2012 academic years. The study was set out to explore student acceptance of the OSCE as part of an evaluation of final MBBS students. A self-administered questionnaire was completed by successive groups of students immediately after the OSCE. Main outcome measures were student perception of examination attributes, which included the quality of instructions and organization, the quality of performance, authenticity and transparency of the process, and usefulness of the OSCE as an assessment instrument compared to other formats. There was an overwhelming acceptance of OSCE in general medicine with respect to comprehensiveness (90% transparency (90% & authenticity of required tasks. Students felt that it was a useful form of examination. Student’s feedback was invaluable in influencing faculty teaching curriculum direction and appreciation of student opinion and overall the students were agreeable with newer form of OSCE. The majority of the students felt that OSCE is a fair assessment tool compared to traditional long and short cases and it covers a wide range of knowledge and clinical skills in general medicine.

  13. Self-assembly of natural light-harvesting bacteriochlorophylls of green sulfur photosynthetic bacteria in silicate capsules as stable models of chlorosomes.

    Science.gov (United States)

    Saga, Yoshitaka; Akai, Sho; Miyatake, Tomohiro; Tamiaki, Hitoshi

    2006-01-01

    Naturally occurring bacteriochlorophyll(BChl)s-c, -d, and -e from green sulfur photosynthetic bacteria were self-assembled in an aqueous solution in the presence of octadecyltriethoxysilane and tetraethoxysilane, followed by polycondensation of the alkoxysilanes by incubation for 50 h at 25 degrees C. The resulting BChl self-assemblies in silicate capsules exhibited visible absorption and circular dichroism spectra similar to the corresponding natural light-harvesting systems (chlorosomes) of green sulfur bacteria. Dynamic light scattering measurements indicated that the silicate capsules had an average hydrodynamic diameter of several hundred nanometers. BChl self-aggregates in silicate capsules were significantly stable to a nonionic surfactant Triton X-100, which was apt to decompose the BChl aggregates to their monomeric form, compared with conventional micelle systems. BChls in silicate capsules were more tolerant to demetalation of the central magnesium under acidic conditions than the natural systems.

  14. Student reflections on learning cross-cultural skills through a 'cultural competence' OSCE.

    Science.gov (United States)

    Miller, Elizabeth; Green, Alexander R

    2007-05-01

    Medical schools use OSCEs (objective structured clinical examinations) to assess students' clinical knowledge and skills, but the use of OSCEs in the teaching and assessment of cross-cultural care has not been well described. To examine medical students' reflections on a cultural competence OSCE station as an educational experience. Students at Harvard Medical School in Boston completed a 'cultural competence' OSCE station (about a patient with uncontrolled hypertension and medication non-adherence). Individual semi-structured interviews were conducted with a convenience sample of twenty-two second year medical students, which were recorded, transcribed, and analysed. Students' reflections on what they learned as the essence of the case encompassed three categories: (1) eliciting the patient's perspective on their illness; (2) examining how and why patients take their medications and inquiring about alternative therapies; and (3) exploring the range of social and cultural factors associated with medication non-adherence. A cultural competence OSCE station that focuses on eliciting patients' perspectives and exploring medication non-adherence can serve as a unique and valuable teaching tool. The cultural competence OSCE station may be one pedagogic method for incorporating cross-cultural care into medical school curricula.

  15. A core competency-based objective structured clinical examination (OSCE) can predict future resident performance.

    Science.gov (United States)

    Wallenstein, Joshua; Heron, Sheryl; Santen, Sally; Shayne, Philip; Ander, Douglas

    2010-10-01

    This study evaluated the ability of an objective structured clinical examination (OSCE) administered in the first month of residency to predict future resident performance in the Accreditation Council for Graduate Medical Education (ACGME) core competencies. Eighteen Postgraduate Year 1 (PGY-1) residents completed a five-station OSCE in the first month of postgraduate training. Performance was graded in each of the ACGME core competencies. At the end of 18 months of training, faculty evaluations of resident performance in the emergency department (ED) were used to calculate a cumulative clinical evaluation score for each core competency. The correlations between OSCE scores and clinical evaluation scores at 18 months were assessed on an overall level and in each core competency. There was a statistically significant correlation between overall OSCE scores and overall clinical evaluation scores (R = 0.48, p competencies of patient care (R = 0.49, p competencies. An early-residency OSCE has the ability to predict future postgraduate performance on a global level and in specific core competencies. Used appropriately, such information can be a valuable tool for program directors in monitoring residents' progress and providing more tailored guidance. © 2010 by the Society for Academic Emergency Medicine.

  16. Interactions of oversulfated chondroitin sulfate (OSCS) from different sources with unfractionated heparin.

    Science.gov (United States)

    Gray, Angel; Litinas, Evangelos; Jeske, Walter; Fareed, Jawed; Hoppensteadt, Debra

    2012-01-01

    In 2008, oversulfated chondroitin sulfate (OSCS) was identified as the main contaminant in recalled heparin. Oversulfated chondroitin sulfate can be prepared from bovine (B), porcine (P), shark (Sh), or skate (S) origin and may produce changes in the antithrombotic, bleeding, and hemodynamic profile of heparins. This study examines the interactions of various OSCSs on heparin in animal models of thrombosis and bleeding, as well as on the anticoagulant and antiprotease effects in in vitro assays. Mixtures of 70% unfractionated heparin (UFH) with 30% OSCS from different sources were tested. In the in vitro activated partial thromboplastin time (aPTT) assay, all contaminant mixtures showed a decrease in clotting times. In addition, a significant increase in bleeding time compared to the control (UFH/saline) was observed. In the thrombosis model, no significant differences were observed. The OSCSs significantly increased anti-Xa activity in ex vivo blood samples. These results indicate that various sources of OSCS affect the hemostatic properties of heparin.

  17. Evaluation of the OSC-TV iterative reconstruction algorithm for cone-beam optical CT.

    Science.gov (United States)

    Matenine, Dmitri; Mascolo-Fortin, Julia; Goussard, Yves; Després, Philippe

    2015-11-01

    The present work evaluates an iterative reconstruction approach, namely, the ordered subsets convex (OSC) algorithm with regularization via total variation (TV) minimization in the field of cone-beam optical computed tomography (optical CT). One of the uses of optical CT is gel-based 3D dosimetry for radiation therapy, where it is employed to map dose distributions in radiosensitive gels. Model-based iterative reconstruction may improve optical CT image quality and contribute to a wider use of optical CT in clinical gel dosimetry. This algorithm was evaluated using experimental data acquired by a cone-beam optical CT system, as well as complementary numerical simulations. A fast GPU implementation of OSC-TV was used to achieve reconstruction times comparable to those of conventional filtered backprojection. Images obtained via OSC-TV were compared with the corresponding filtered backprojections. Spatial resolution and uniformity phantoms were scanned and respective reconstructions were subject to evaluation of the modulation transfer function, image uniformity, and accuracy. The artifacts due to refraction and total signal loss from opaque objects were also studied. The cone-beam optical CT data reconstructions showed that OSC-TV outperforms filtered backprojection in terms of image quality, thanks to a model-based simulation of the photon attenuation process. It was shown to significantly improve the image spatial resolution and reduce image noise. The accuracy of the estimation of linear attenuation coefficients remained similar to that obtained via filtered backprojection. Certain image artifacts due to opaque objects were reduced. Nevertheless, the common artifact due to the gel container walls could not be eliminated. The use of iterative reconstruction improves cone-beam optical CT image quality in many ways. The comparisons between OSC-TV and filtered backprojection presented in this paper demonstrate that OSC-TV can potentially improve the rendering of

  18. Assessing the Organizational Social Context (OSC) of child welfare systems: implications for research and practice.

    Science.gov (United States)

    Glisson, Charles; Green, Philip; Williams, Nathaniel J

    2012-09-01

    The study: (1) provides the first assessment of the a priori measurement model and psychometric properties of the Organizational Social Context (OSC) measurement system in a US nationwide probability sample of child welfare systems; (2) illustrates the use of the OSC in constructing norm-based organizational culture and climate profiles for child welfare systems; and (3) estimates the association of child welfare system-level organizational culture and climate profiles with individual caseworker-level job satisfaction and organizational commitment. The study applies confirmatory factor analysis (CFA) and hierarchical linear models (HLM) analysis to a US nationwide sample of 1,740 caseworkers from 81 child welfare systems participating in the second National Survey of Child and Adolescent Wellbeing (NSCAW II). The participating child welfare systems were selected using a national probability procedure reflecting the number of children served by child welfare systems nationwide. The a priori OSC measurement model is confirmed in this nationwide sample of child welfare systems. In addition, caseworker responses to the OSC scales generate acceptable to high scale reliabilities, moderate to high within-system agreement, and significant between-system differences. Caseworkers in the child welfare systems with the best organizational culture and climate profiles report higher levels of job satisfaction and organizational commitment. Organizational climates characterized by high engagement and functionality, and organizational cultures characterized by low rigidity are associated with the most positive work attitudes. The OSC is the first valid and reliable measure of organizational culture and climate with US national norms for child welfare systems. The OSC provides a useful measure of Organizational Social Context for child welfare service improvement and implementation research efforts which include a focus on child welfare system culture and climate. Copyright © 2012

  19. Modification of an OSCE format to enhance patient continuity in a high-stakes assessment of clinical performance

    Directory of Open Access Journals (Sweden)

    Cuncic Cary

    2011-05-01

    Full Text Available Abstract Background Traditional Objective Structured Clinical Examinations (OSCEs are psychometrically sound but have the limitation of fragmenting complex clinical cases into brief stations. We describe a pilot study of a modified OSCE that attempts to balance a typical OSCE format with a semblance of a continuous, complex, patient case. Methods Two OSCE scenarios were developed. Each scenario involved a single standardized patient and was subdivided into three sequential 10 minute sections that assessed separate content areas and competencies. Twenty Canadian PGY-4 internal medicine trainees were assessed by trained examiner pairs during each OSCE scenario. Paired examiners rated participant performance independent of each other, on each section of each scenario using a validated global rating scale. Inter-rater reliabilities and Pearson correlations between ratings of the 3 sections of each scenario were calculated. A generalizability study was conducted. Participant and examiner satisfaction was surveyed. Results There was no main effect of section or scenario. Inter-rater reliability was acceptable. The g-coefficient was 0.68; four scenarios would achieve 0.80. Moderate correlations between sections of a scenario suggest a possible halo effect. The majority of examiners and participants felt that the modified OSCE provided a sense of patient continuity. Conclusions The modified OSCE provides another approach to the assessment of clinical performance. It attempts to balance the advantages of a traditional OSCE with a sense of patient continuity.

  20. Effect of Clinically Discriminating, Evidence-Based Checklist Items on the Reliability of Scores from an Internal Medicine Residency OSCE

    Science.gov (United States)

    Daniels, Vijay J.; Bordage, Georges; Gierl, Mark J.; Yudkowsky, Rachel

    2014-01-01

    Objective structured clinical examinations (OSCEs) are used worldwide for summative examinations but often lack acceptable reliability. Research has shown that reliability of scores increases if OSCE checklists for medical students include only clinically relevant items. Also, checklists are often missing evidence-based items that high-achieving…

  1. Medical students review of formative OSCE scores, checklists, and videos improves with student-faculty debriefing meetings.

    Science.gov (United States)

    Bernard, Aaron W; Ceccolini, Gabbriel; Feinn, Richard; Rockfeld, Jennifer; Rosenberg, Ilene; Thomas, Listy; Cassese, Todd

    2017-01-01

    Performance feedback is considered essential to clinical skills development. Formative objective structured clinical exams (F-OSCEs) often include immediate feedback by standardized patients. Students can also be provided access to performance metrics including scores, checklists, and video recordings after the F-OSCE to supplement this feedback. How often students choose to review this data and how review impacts future performance has not been documented. We suspect student review of F-OSCE performance data is variable. We hypothesize that students who review this data have better performance on subsequent F-OSCEs compared to those who do not. We also suspect that frequency of data review can be improved with faculty involvement in the form of student-faculty debriefing meetings. Simulation recording software tracks and time stamps student review of performance data. We investigated a cohort of first- and second-year medical students from the 2015-16 academic year. Basic descriptive statistics were used to characterize frequency of data review and a linear mixed-model analysis was used to determine relationships between data review and future F-OSCE performance. Students reviewed scores (64%), checklists (42%), and videos (28%) in decreasing frequency. Frequency of review of all metric and modalities improved when student-faculty debriefing meetings were conducted (p<.001). Among 92 first-year students, checklist review was associated with an improved performance on subsequent F-OSCEs (p = 0.038) by 1.07 percentage points on a scale of 0-100. Among 86 second year students, no review modality was associated with improved performance on subsequent F-OSCEs. Medical students review F-OSCE checklists and video recordings less than 50% of the time when not prompted. Student-faculty debriefing meetings increased student data reviews. First-year student's review of checklists on F-OSCEs was associated with increases in performance on subsequent F-OSCEs, however this

  2. Reacting to Conflict: Civilian Capabilities in the EU, UN and OSCE

    NARCIS (Netherlands)

    Dijkstra, Hylke; Petrov, Petar; Mahr, Ewa

    2016-01-01

    This report analyses how the EU, UN and OSCE make resources available for civilian missions. It starts with an overview of civilian missions around the world before comparing civilian planning and conduct procedures in these international organisations. The report zooms in on EU civilian

  3. A fast 4D cone beam CT reconstruction method based on the OSC-TV algorithm.

    Science.gov (United States)

    Mascolo-Fortin, Julia; Matenine, Dmitri; Archambault, Louis; Després, Philippe

    2018-01-01

    Four-dimensional cone beam computed tomography allows for temporally resolved imaging with useful applications in radiotherapy, but raises particular challenges in terms of image quality and computation time. The purpose of this work is to develop a fast and accurate 4D algorithm by adapting a GPU-accelerated ordered subsets convex algorithm (OSC), combined with the total variation minimization regularization technique (TV). Different initialization schemes were studied to adapt the OSC-TV algorithm to 4D reconstruction: each respiratory phase was initialized either with a 3D reconstruction or a blank image. Reconstruction algorithms were tested on a dynamic numerical phantom and on a clinical dataset. 4D iterations were implemented for a cluster of 8 GPUs. All developed methods allowed for an adequate visualization of the respiratory movement and compared favorably to the McKinnon-Bates and adaptive steepest descent projection onto convex sets algorithms, while the 4D reconstructions initialized from a prior 3D reconstruction led to better overall image quality. The most suitable adaptation of OSC-TV to 4D CBCT was found to be a combination of a prior FDK reconstruction and a 4D OSC-TV reconstruction with a reconstruction time of 4.5 minutes. This relatively short reconstruction time could facilitate a clinical use.

  4. Belarus and Russia in OSCE Ministerial Council focus / Rokas M. Tracevskis

    Index Scriptorium Estoniae

    Tracevskis, Rokas M.

    2011-01-01

    6.-7. detsembril Vilniuses toimunud OSCE Ministrite Nõukogu kohtumisel räägiti inimõiguste probleemidest, meediavabadusest, Afganistanist, Araabia kevadest, Valgevenes toimuvast ja Venemaal toimunud parlamendivalimistest. Kohtumise avas Leedu president Dalia Grybauskaite. 6. detsembril kohtus USA riigisekretär Hillary Clinton president Dalia Grybauskaite ja välisminister Audronius Azubalisega

  5. Use of the OSCE to Evaluate Brief Communication Skills Training for Dental Students

    Science.gov (United States)

    Cannick, Gabrielle F.; Horowitz, Alice M.; Garr, David R.; Reed, Susan G.; Neville, Brad W.; Day, Terry A.; Woolson, Robert F.; Lackland, Daniel T.

    2009-01-01

    Although communications competency is recommended by the American Dental Education Association, only a few (n=5) dental schools report evaluating students’ skills using a competency examination for communication. This study used an objective structured clinical examination (OSCE) to evaluate dental students’ competency in interpersonal and tobacco cessation communication skills. All students were evaluated on their interpersonal communication skills at baseline and at six months post-OSCE by standardized patients and on their tobacco cessation communication skills by two independent raters. First- and second-year dental students (n=104) were randomized to a control or intervention group. One month after the baseline OSCE, students in the intervention group participated in a two-hour training session in which faculty members communicated with a standardized patient during a head and neck examination and counseled the patient about tobacco cessation. There were no statistically significant differences from baseline to post-test between the intervention and control group students as measured by the OSCE. However, among first-year students, both the intervention (n=23) and control (n=21) groups significantly increased in tobacco cessation communication scores. Second-year students in both intervention (n=24) and control (n=28) groups declined in interpersonal communication skills from baseline to post-test. Overall, this one-shot intervention was not successful, and results suggest that a comprehensive communication skills training course may be more beneficial than a single, brief training session for improving dental students’ communication skills. PMID:17761627

  6. A Procedural Skills OSCE: Assessing Technical and Non-Technical Skills of Internal Medicine Residents

    Science.gov (United States)

    Pugh, Debra; Hamstra, Stanley J.; Wood, Timothy J.; Humphrey-Murto, Susan; Touchie, Claire; Yudkowsky, Rachel; Bordage, Georges

    2015-01-01

    Internists are required to perform a number of procedures that require mastery of technical and non-technical skills, however, formal assessment of these skills is often lacking. The purpose of this study was to develop, implement, and gather validity evidence for a procedural skills objective structured clinical examination (PS-OSCE) for internal…

  7. Correlation between MMI performance and OSCE performance – a pilot study

    Directory of Open Access Journals (Sweden)

    Adetokunbo Oluwasanjo

    2015-06-01

    Full Text Available Objective: The multiple mini-interview (MMI has been shown to have a positive correlation with early medical school performance, clerkship evaluations, and national licensing examinations. There is limited data on its predictive validity at the postgraduate level. Methods: Six hundred and nineteen internship candidates were interviewed using the MMI format by the internal medicine residency program of The Reading Health System, between September 2011 and February 2014. Fifty-two interns were recruited. Each intern participated in an objective structured clinical examination (OSCE 3–4 months after the start of the program. The OSCE score of each intern was used as the independent variable to test the relationship with both the MMI interpersonal score and the MMI overall score. Results: There was a moderate positive correlation between the average MMI interpersonal score and the communication score on the OSCE, r=0.384, n=52, p=0.005, and a negligible relationship between the average MMI overall score and the communication score on the OSCE, r=0.175, n=52, p=0.214. Conclusion: The MMI is a useful tool for residency programs to assess interpersonal and communication skills prior to matriculation into residency training. This study provides evidence for its validity in assessing these competencies.

  8. A Comparison of Standard-Setting Procedures for an OSCE in Undergraduate Medical Education.

    Science.gov (United States)

    Kaufman, David M.; Mann, Karen V.; Muijtjens, Arno M. M.; van der Vleuten, Cees P. M.

    2000-01-01

    Compared four standard-setting procedures for an objective structure clinical examination (OSCE) in medical education. Applied Angoff, borderline, relative, and holistic procedures to the data used to establish a cutoff score for a pass/fail decision. The Angoff and borderline procedures gave similar results; however, the relative and holistic…

  9. M-OSCE as a method to measure dental hygiene students' critical thinking: a pilot study.

    Science.gov (United States)

    McComas, Martha J; Wright, Rebecca A; Mann, Nancy K; Cooper, Mary D; Jacks, Mary E

    2013-04-01

    Educators in all academic disciplines have been encouraged to utilize assessment strategies to evaluate students' critical thinking. The purpose of this study was to assess the viability of the modified objective structured clinical examination (m-OSCE) to evaluate critical thinking in dental hygiene education. This evaluation utilized a convenience sample of senior dental hygiene students. Students participated in the m-OSCE in which portions of a patient case were revealed at four stations. The exam consisted of multiple-choice questions intended to measure students' ability to utilize critical thinking skills. Additionally, there was one fill-in-the-blank question and a treatment plan that was completed at the fifth station. The results of this study revealed that the m-OSCE did not reliably measure dental hygiene students' critical thinking. Statistical analysis found no satisfactory reliability within the multiple-choice questions and moderately reliable results within the treatment planning portion of the examination. In addition, the item analysis found gaps in students' abilities to transfer clinical evidence/data to basic biomedical knowledge as demonstrated through the multiple-choice questioning results. This outcome warrants further investigation of the utility of the m-OSCE, with a focus on modifications to the evaluation questions, grading rubric, and patient case.

  10. 77 FR 28638 - OSC Forms And Survey Renewal for FY 2012-Request for Comment

    Science.gov (United States)

    2012-05-15

    ... employees; and (2) the interpretation and enforcement of Hatch Act provisions on political activity in... Possible Prohibited Political Activity (Violation of the Hatch Act)); (4) Office of Special Counsel (OSC... seeking assistance was fully apprised of their rights; (2) determine whether the individual was successful...

  11. Evaluating verbal and non-verbal communication skills, in an ethnogeriatric OSCE.

    Science.gov (United States)

    Collins, Lauren G; Schrimmer, Anne; Diamond, James; Burke, Janice

    2011-05-01

    Communication during medical interviews plays a large role in patient adherence, satisfaction with care, and health outcomes. Both verbal and non-verbal communication (NVC) skills are central to the development of rapport between patients and healthcare professionals. The purpose of this study was to assess the role of non-verbal and verbal communication skills on evaluations by standardized patients during an ethnogeriatric Objective Structured Clinical Examination (OSCE). Interviews from 19 medical students, residents, and fellows in an ethnogeriatric OSCE were analyzed. Each interview was videotaped and evaluated on a 14 item verbal and an 8 item non-verbal communication checklist. The relationship between verbal and non-verbal communication skills on interview evaluations by standardized patients were examined using correlational analyses. Maintaining adequate facial expression (FE), using affirmative gestures (AG), and limiting both unpurposive movements (UM) and hand gestures (HG) had a significant positive effect on perception of interview quality during this OSCE. Non-verbal communication skills played a role in perception of overall interview quality as well as perception of culturally competent communication. Incorporating formative and summative evaluation of both verbal and non-verbal communication skills may be a critical component of curricular innovations in ethnogeriatrics, such as the OSCE. Copyright © 2010 Elsevier Ireland Ltd. All rights reserved.

  12. Calibration of communication skills items in OSCE checklists according to the MAAS-Global.

    Science.gov (United States)

    Setyonugroho, Winny; Kropmans, Thomas; Kennedy, Kieran M; Stewart, Brian; van Dalen, Jan

    2016-01-01

    Communication skills (CS) are commonly assessed using 'communication items' in Objective Structured Clinical Examination (OSCE) station checklists. Our aim is to calibrate the communication component of OSCE station checklists according to the MAAS-Global which is a valid and reliable standard to assess CS in undergraduate medical education. Three raters independently compared 280 checklists from 4 disciplines contributing to the undergraduate year 4 OSCE against the 17 items of the MAAS-Global standard. G-theory was used to analyze the reliability of this calibration procedure. G-Kappa was 0.8. For two raters G-Kappa is 0.72 and it fell to 0.57 for one rater. 46% of the checklist items corresponded to section three of the MAAS-Global (i.e. medical content of the consultation), whilst 12% corresponded to section two (i.e. general CS), and 8.2% to section one (i.e. CS for each separate phase of the consultation). 34% of the items were not considered to be CS. A G-Kappa of 0.8 confirms a reliable and valid procedure for calibrating OSCE CS checklist items using the MAAS-Global. We strongly suggest that such a procedure is more widely employed to arrive at a stable (valid and reliable) judgment of the communication component in existing checklists for medical students' communication behaviours. It is possible to measure the 'true' caliber of CS in OSCE stations. Students' results are thereby comparable between and across stations, students and institutions. A reliable calibration procedure requires only two raters. Copyright © 2015. Published by Elsevier Ireland Ltd.

  13. Generalized Optimal-State-Constraint Extended Kalman Filter (OSC-EKF)

    Science.gov (United States)

    2017-02-01

    algorithms is demonstrated by achieving reasonable consistency and accuracy on a challenging micro aerial vehicle dataset. simultaneous localization...platforms exist,4 and many others have been constructed with low-cost components. Visual-inertial simultaneous localization and mapping (SLAM) and...epipolar constraints. The OSC-EKF used a window size of 10 frames. The SAM problem was constructed using an inverse -depth feature position param

  14. The first OSCE; does students' experience of performing in public affect their results?

    Science.gov (United States)

    Chan, Michael; Bax, Nigel; Woodley, Caroline; Jennings, Michael; Nicolson, Rod; Chan, Philip

    2015-03-26

    Personal qualities have been shown to affect students' exam results. We studied the effect of experience, and level, of public performance in music, drama, dance, sport, and debate at the time of admission to medical school as a predictor of student achievement in their first objective structured clinical examination (OSCE). A single medical school cohort (n = 265) sitting their first clinical exam in 2011 as third year students were studied. Pre-admission statements made at the time of application were coded for their stated achievements in the level of public performance; participation in each activity was scored 0-3, where 0 was no record, 1 = leisure time activity, 2 = activity at school or local level, 3 = activity at district, regional or national level. These scores were correlated to OSCE results by linear regression and t-test. Comparison was made between the highest scoring students in each area, and students scoring zero by t-test. There was a bell shaped distribution in public performance score in this cohort. There was no significant linear regression relationship between OSCE results and overall performance score, or between any subgroups. There was a significant difference between students with high scores in theatre, debate and vocal music areas, grouped together as verbal performance, and students scoring zero in these areas. (p < 0.05, t-test) with an effect size of 0.4. We found modest effects from pre-admission experience of verbal performance on students' scores in the OSCE examination. As these data are taken from students' admission statements, we call into question the received wisdom that such statements are unreliable.

  15. Communication Skills assessed at OSCE are not affected by Participation in the Adolescent Healthy Sexuality Program

    Directory of Open Access Journals (Sweden)

    Deborah Penava

    2002-12-01

    Full Text Available We proposed that first year medical students who voluntarily participated in the Healthy Sexuality adolescent program would perform better than their peers on an adolescent counseling station at the year-end OSCE (Objective Structured Clinical Examination. In addition we compared medical students’ communication skills at the time of the program as assessed by self, peers and participating adolescents. Methods: Nineteen first year medical students voluntarily participated in the ongoing Healthy Sexuality program. Adolescent participants, medical student peer participants and medical students assessed communication components on a 7-point Likert scale at the end of the program. At the year-end OSCE, all first year medical students at the University of Western Ontario were assessed at an adolescent counseling station by a standardized patient (SP and a physician examiner. Statistical analysis examined differences between the two groups. Results: Students who participated in the Healthy Sexuality program did not perform better than their colleagues on the year-end OSCE. A statistically significant correlation between physician examiner and SP evaluations was found (r = 0.62. Adolescent participants communication skills assessments in the Healthy Sexuality Program demonstrated no significant correlation with medical student assessments (self or peer. Conclusions:Voluntary intervention with adolescents did not result in improved communication skills at the structured year-end examination. Further investigation will be directed towards delineating differences between SP and physician examiner assessments.

  16. Using Item Analysis to Assess Objectively the Quality of the Calgary-Cambridge OSCE Checklist

    Directory of Open Access Journals (Sweden)

    Tyrone Donnon

    2011-06-01

    Full Text Available Background:  The purpose of this study was to investigate the use of item analysis to assess objectively the quality of items on the Calgary-Cambridge Communications OSCE checklist. Methods:  A total of 150 first year medical students were provided with extensive teaching on the use of the Calgary-Cambridge Guidelines for interviewing patients and participated in a final year end 20 minute communication OSCE station.  Grouped into either the upper half (50% or lower half (50% communication skills performance groups, discrimination, difficulty and point biserial values were calculated for each checklist item. Results:  The mean score on the 33 item communication checklist was 24.09 (SD = 4.46 and the internal reliability coefficient was ? = 0.77. Although most of the items were found to have moderate (k = 12, 36% or excellent (k = 10, 30% discrimination values, there were 6 (18% identified as ‘fair’ and 3 (9% as ‘poor’. A post-examination review focused on item analysis findings resulted in an increase in checklist reliability (? = 0.80. Conclusions:  Item analysis has been used with MCQ exams extensively. In this study, it was also found to be an objective and practical approach to use in evaluating the quality of a standardized OSCE checklist.

  17. Forging Consensus for Atrocity Prevention: Assessing the Record of the OSCE

    Directory of Open Access Journals (Sweden)

    Matthew Levinger

    2018-03-01

    Full Text Available This essay examines the record of the Organization for Security and Cooperation in Europe (OSCE in fostering norms and collaborative practices for preventing mass atrocities in Eurasia. Comprising fifty-seven participating states “from Vancouver to Vladivostok,” the OSCE is the sole regional security organization spanning all of the members of NATO and the former Warsaw Pact. Its consensus-based approach to advancing “common and comprehensive security” has proved successful in preventing escalation or containing levels of violence in various conflicts in the Baltic states, Ukraine, Southeastern Europe, and the Caucasus. Since the late 1990s, however, rising geopolitical tensions between NATO and the Russian Federation have undermined the effectiveness of the OSCE’s conflict prevention initiatives. In order for the OSCE to play a more robust role in enhancing human security in Eurasia, it will need to find a path toward rebuilding the normative consensus between Russia and its Western participating states.

  18. Standardised clients as assessors in a veterinary communication OSCE: a reliability and validity study.

    Science.gov (United States)

    Artemiou, E; Adams, C L; Hecker, K G; Vallevand, A; Violato, C; Coe, J B

    2014-11-22

    In human medicine, standardised patients (SP) have been shown to reliably and accurately assess learners' communication performance in high-stakes certification Objective Structured Clinical Examinations (OSCE), offering a feasible way to reduce the need for recruitment, time commitment and coordination of faculty assessors. In this study, we evaluated the use of standardised clients (SC) as a viable option for assessing veterinary students' communication performance. We designed a four-station, two-track communication skills OSCE. SC assessors used an adapted nine-item Liverpool Undergraduate Communication Assessment Scale (LUCAS). Faculty used a 21-item checklist derived from the Calgary-Cambridge Guide (CCG) and a five-point global rating scale. Participants were second year veterinary students (n=96). For the four stations, intrastation reliability (α) ranged from 0.63 to 0.82 for the LUCAS, and 0.73 to 0.87 for the CCG. The interstation reliability coefficients were 0.85 for the LUCAS and 0.89 for the CGG. The calculated Generalisability (G) coefficients were 0.62 for the LUCAS and 0.60 for the CGG. Supporting construct validity, SC and faculty assessors showed a significant correlation between the LUCAS and CCG total percent scores (r=0.45, PStudy results support that SC assessors offer a reliable and valid approach for assessing veterinary communication OSCE. British Veterinary Association.

  19. Assessing Communication Skills of Medical Students in Objective Structured Clinical Examinations (OSCE)--A Systematic Review of Rating Scales.

    Science.gov (United States)

    Cömert, Musa; Zill, Jördis Maria; Christalle, Eva; Dirmaier, Jörg; Härter, Martin; Scholl, Isabelle

    2016-01-01

    Teaching and assessment of communication skills have become essential in medical education. The Objective Structured Clinical Examination (OSCE) has been found as an appropriate means to assess communication skills within medical education. Studies have demonstrated the importance of a valid assessment of medical students' communication skills. Yet, the validity of the performance scores depends fundamentally on the quality of the rating scales used in an OSCE. Thus, this systematic review aimed at providing an overview of existing rating scales, describing their underlying definition of communication skills, determining the methodological quality of psychometric studies and the quality of psychometric properties of the identified rating scales. We conducted a systematic review to identify psychometrically tested rating scales, which have been applied in OSCE settings to assess communication skills of medical students. Our search strategy comprised three databases (EMBASE, PsycINFO, and PubMed), reference tracking and consultation of experts. We included studies that reported psychometric properties of communication skills assessment rating scales used in OSCEs by examiners only. The methodological quality of included studies was assessed using the COnsensus based Standards for the selection of health status Measurement INstruments (COSMIN) checklist. The quality of psychometric properties was evaluated using the quality criteria of Terwee and colleagues. Data of twelve studies reporting on eight rating scales on communication skills assessment in OSCEs were included. Five of eight rating scales were explicitly developed based on a specific definition of communication skills. The methodological quality of studies was mainly poor. The psychometric quality of the eight rating scales was mainly intermediate. Our results reveal that future psychometric evaluation studies focusing on improving the methodological quality are needed in order to yield psychometrically

  20. Assessing Communication Skills of Medical Students in Objective Structured Clinical Examinations (OSCE) - A Systematic Review of Rating Scales

    Science.gov (United States)

    Cömert, Musa; Zill, Jördis Maria; Christalle, Eva; Dirmaier, Jörg; Härter, Martin; Scholl, Isabelle

    2016-01-01

    Background Teaching and assessment of communication skills have become essential in medical education. The Objective Structured Clinical Examination (OSCE) has been found as an appropriate means to assess communication skills within medical education. Studies have demonstrated the importance of a valid assessment of medical students’ communication skills. Yet, the validity of the performance scores depends fundamentally on the quality of the rating scales used in an OSCE. Thus, this systematic review aimed at providing an overview of existing rating scales, describing their underlying definition of communication skills, determining the methodological quality of psychometric studies and the quality of psychometric properties of the identified rating scales. Methods We conducted a systematic review to identify psychometrically tested rating scales, which have been applied in OSCE settings to assess communication skills of medical students. Our search strategy comprised three databases (EMBASE, PsycINFO, and PubMed), reference tracking and consultation of experts. We included studies that reported psychometric properties of communication skills assessment rating scales used in OSCEs by examiners only. The methodological quality of included studies was assessed using the COnsensus based Standards for the selection of health status Measurement INstruments (COSMIN) checklist. The quality of psychometric properties was evaluated using the quality criteria of Terwee and colleagues. Results Data of twelve studies reporting on eight rating scales on communication skills assessment in OSCEs were included. Five of eight rating scales were explicitly developed based on a specific definition of communication skills. The methodological quality of studies was mainly poor. The psychometric quality of the eight rating scales was mainly intermediate. Discussion Our results reveal that future psychometric evaluation studies focusing on improving the methodological quality are needed

  1. Using modified information delivery to enhance the traditional pharmacy OSCE program at TMU - a pilot study.

    Science.gov (United States)

    Lin, Che-Wei; Chang, Elizabeth H; Clinciu, Daniel L; Peng, Yun-Ting; Huang, Wen-Chen; Wu, Chien-Chih; Wu, Jen-Chieh; Li, Yu-Chuan

    2018-05-01

    Objective Structured Clinical Examination (OSCE) has been used in many areas of healthcare training over the years. However, it constantly needs to be upgraded and enhanced due to technological and teaching changes. We aim at implementing an integrative OSCE method which employs informatics via the virtual patient within the pharmacy education curriculum at Taipei Medical University to enhance the pharmacy students' competence for using and disseminating information and to also improve critical thinking and clinical reasoning. We propose an integrated pharmacy OSCE which uses standardized patients and virtual patients (DxR Clinician). To evaluate this method, we designed four simulated stations and pilot tested with 19 students in the first year of the Master in Clinical Pharmacy program. Three stations were simulated as the inpatient pharmacy: 1) History and lab data collection; 2) Prescription review; 3) Calling physician to discuss potential prescription problems. The fourth was simulated as the patient ward station to provide patient education. A satisfaction questionnaire was administered at the end of the study. Students rated their ability of 2.84, 2.37, 2.37, and 3.63 of 5 for each of the four stations, with the second and third being the most difficult stations. The method obtained an average rating of 4.32 of 5 for relevance, 4.16 for improving clinical ability, 4.32 for practicality in future healthcare work, and 4.28 for willing to have another similar learning experience. The integration of Virtual Patient in this study reveals that this assessment method is efficient and practical in many aspects. Most importantly, it provides the test taker with a much closer real-life clinical encounter. Although it is in many ways more difficult, it also provides for better "learning from mistakes" opportunities for test-takers. Copyright © 2017. Published by Elsevier B.V.

  2. Production of nuclear ceramic fuel for nuclear power plants at 'Ulba metallurgical plant' OSC

    International Nuclear Information System (INIS)

    Khadeev, V.G.

    2000-01-01

    The paper describes the flow-sheet of production of uranium dioxide powders and nuclear ceramic fuel pellets of them existing at the facility. 'UMP' OSC applies ADU extraction process of UO2 powders production. An indisputable success of the process is the possibility of use of the wide range of raw materials. Uranium hexafluoride, uranium oxides, uranium metal, uranium tetrafluoride, uranyl salts, uranium ore concentrates, all possible types of uranium-containing materials the processing of which by routine methods is difficult (ashes, scraps, etc.) are used as the raw materials. In addition, a reprocessed nuclear fuel can be used for fuel production. The quality of uranium dioxide powder produced does not depend on the type of uranium raw material used. High selectivity of extraction refining makes possible to obtain material with rather low impurities content that meets practically all specifications for uranium dioxide known to us. Ceramic and process features of uranium dioxide powders, namely, specific surface, bulk density, grain size and sinterability make possible to produce nuclear ceramic fuel with specified features. Quality of uranium dioxide powders produced by 'UMP' OSC was highly rated by General Electric company that is one of the leading companies from fuel manufactures in the USA market . It has certified 'UMP' OSC as its supplier. Currently, our company makes great efforts on establishing production of uranium dioxide powders with natural isotopes content for production of fuel for CANDU reactors. Trial lots of such powders are under tests at some companies manufacturing fuel for this type reactors in Canada, USA and Corea

  3. The quality of feedback during formative OSCEs depends on the tutors’ profile

    Directory of Open Access Journals (Sweden)

    Noelle Junod Perron

    2016-11-01

    Full Text Available Abstract Background During their pre-clinical years, medical students are given the opportunity to practice clinical skills with simulated patients. During these formative objective structured clinical encounters (OSCEs, tutors from various backgrounds give feedback on students’ history taking, physical exam, and communication skills. The aim of the study was to evaluate whether the content and process of feedback varied according to the tutors’ profile. Methods During 2013, all 2nd and 3rd year medical students and tutors involved in three formative OSCEs were asked to fill in questionnaires, and their feedback sessions were audiotaped. Tutors were divided into two groups: 1 generalists: primary care, general internist and educationalist physicians 2 specialists involved in the OSCE related to their field of expertise. Outcome measures included the students’ perceptions of feedback quality and utility and objective assessment of feedback quality. Results Participants included 251 medical students and 38 tutors (22 generalists and 16 specialists. Students self-reported that feedback was useful to improve history taking, physical exam and communication skills. Objective assessment showed that feedback content essentially focused on history taking and physical exam skills, and that elaboration on clinical reasoning or communication/professionalism issues was uncommon. Multivariate analyses showed that generalist tutors used more learner-centered feedback skills than specialist tutors (stimulating student’s self-assessment (p < .001; making the student active in finding solutions, p < .001; checking student’s understanding, p < .001 and elaborated more on communication and professionalism issues (p < 0.001. Specialists reported less training in how to provide feedback than generalists. Conclusion These findings suggest that generalist tutors are more learner-centered and pay more attention to communication and

  4. Understanding the application of OSC policy 9.1 during a takeover transaction

    International Nuclear Information System (INIS)

    Hayduk, M.F.; Rasmuson, M.A.

    1998-01-01

    Legal aspects of ownership of publicly traded companies in Canada are explored, with particular emphasis on transactions involving 'related parties'. In this context, Policy 9.1 of the Ontario Securities Commission is examined. The policy seeks to enhance minority shareholder protection by providing for independent valuation, majority of minority approval, enhanced disclosure and review of substantial transactions by independent directors. This paper focuses on four types of transactions governed by Policy 9.1, i.e. insider bids, issuer bids, going private transactions, related party transactions and the recent proposed rule reformulation proposed by the Ontario Securities Commission (OSC)

  5. Las Organizaciones de la Sociedad Civil (OSC) y la agenda internacional del desarrollo: escenario latinoamericano

    OpenAIRE

    Revilla Blanco, María Luisa

    2012-01-01

    En este artículo se analiza la acción de las organizaciones de la sociedad civil latinoamericanas: su evolución y el papel que juegan en la definición de la agenda internacional del desarrollo desde América Latina. Para ello, me detendré en los siguientes puntos: 1. Los hitos más importantes en la generación de consensos sobre los contenidos de esa agenda de desarrollo en lo que va de siglo y el reconocimiento del papel de las OSC. 2. La situación de América Latina en este contexto. ...

  6. Improved OSC Amtec generator design to meet goals of JPL's candidate Europa Orbiter mission

    International Nuclear Information System (INIS)

    Schock, A.; Noravian, H.; Or, C.; Kumar, V.

    1998-01-01

    The preceding paper (Paper IECEC.98.244) described OSC's initial designs of AMTEC (Alkali Metal Thermal-to-Electrical Conversion) power systems, consisting of one or two generators, each with 2, 3, or 4 General Purpose Heat Source (GPHS) modules and with 16 refractory AMTEC cells containing 5 Beta Alumina Solid Electrolyte (BASE) tubes; and presented the effect of heat input and voltage output on the generator's BOM evaporator and clad temperatures and on its EOM system efficiency and power output. Comparison of the computed results with JPL's goals for the Europa Orbiter mission showed that all of the initial 16-cell design options yielded either excessive evaporator and clad temperatures or insufficient EOM power to satisfy the JPL-specified mission goals. The present paper describes modified OSC generator designs with different numbers of AMTEC cells, cell diameters, cell lengths, cell materials, BASE tube lengths, and number of tubes per cell. These efforts succeeded in identifying generator designs with only half the number of AMTEC cells which -- for the same assumptions -- can produce EOM power outputs substantially in excess of JPL's goals for NASA's Europa Orbiter mission while operating well below the prescribed BOM limits on evaporator and clad temperature; and revealed that lowering the emissivity of the generator's housing to raise the cells' condenser temperatures can achieve substantial additional performance improvement. Finally, the paper culminates in programmatic recommendations

  7. How well do second-year students learn physical diagnosis? Observational study of an objective structured clinical examination (OSCE

    Directory of Open Access Journals (Sweden)

    Simon Steven R

    2002-01-01

    Full Text Available Abstract Background Little is known about using the Objective Structured Clinical Examination (OSCE in physical diagnosis courses. The purpose of this study was to describe student performance on an OSCE in a physical diagnosis course. Methods Cross-sectional study at Harvard Medical School, 1997–1999, for 489 second-year students. Results Average total OSCE score was 57% (range 39–75%. Among clinical skills, students scored highest on patient interaction (72%, followed by examination technique (65%, abnormality identification (62%, history-taking (60%, patient presentation (60%, physical examination knowledge (47%, and differential diagnosis (40% (p Conclusions Students scored higher on interpersonal and technical skills than on interpretive or integrative skills. Station scores identified specific content that needs improved teaching.

  8. Development and testing of an objective structured clinical exam (OSCE) to assess socio-cultural dimensions of patient safety competency

    Science.gov (United States)

    Ginsburg, Liane R; Tregunno, Deborah; Norton, Peter G; Smee, Sydney; de Vries, Ingrid; Sebok, Stefanie S; VanDenKerkhof, Elizabeth G; Luctkar-Flude, Marian; Medves, Jennifer

    2015-01-01

    Background Patient safety (PS) receives limited attention in health professional curricula. We developed and pilot tested four Objective Structured Clinical Examination (OSCE) stations intended to reflect socio-cultural dimensions in the Canadian Patient Safety Institute's Safety Competency Framework. Setting and participants 18 third year undergraduate medical and nursing students at a Canadian University. Methods OSCE cases were developed by faculty with clinical and PS expertise with assistance from expert facilitators from the Medical Council of Canada. Stations reflect domains in the Safety Competency Framework (ie, managing safety risks, culture of safety, communication). Stations were assessed by two clinical faculty members. Inter-rater reliability was examined using weighted κ values. Additional aspects of reliability and OSCE performance are reported. Results Assessors exhibited excellent agreement (weighted κ scores ranged from 0.74 to 0.82 for the four OSCE stations). Learners’ scores varied across the four stations. Nursing students scored significantly lower (p<0.05) than medical students on three stations (nursing student mean scores=1.9, 1.9 and 2.7; medical student mean scores=2.8, 2.9 and 3.5 for stations 1, 2 and 3, respectively where 1=borderline unsatisfactory, 2=borderline satisfactory and 3=competence demonstrated). 7/18 students (39%) scored below ‘borderline satisfactory’ on one or more stations. Conclusions Results show (1) four OSCE stations evaluating socio-cultural dimensions of PS achieved variation in scores and (2) performance on this OSCE can be evaluated with high reliability, suggesting a single assessor per station would be sufficient. Differences between nursing and medical student performance are interesting; however, it is unclear what factors explain these differences. PMID:25398630

  9. GPU-accelerated few-view CT reconstruction using the OSC and TV techniques

    Energy Technology Data Exchange (ETDEWEB)

    Matenine, Dmitri [Montreal Univ., QC (Canada). Dept. de Physique; Hissoiny, Sami [Ecole Polytechnique de Montreal, QC (Canada). Dept. de Genie Informatique et Genie Logiciel; Despres, Philippe [Centre Hospitalier Univ. de Quebec, QC (Canada). Dept. de Radio-Oncologie

    2011-07-01

    The present work proposes a promising iterative reconstruction technique designed specifically for X-ray transmission computed tomography (CT). The main objective is to reduce diagnostic radiation dose through the reduction of the number of CT projections, while preserving image quality. The second objective is to provide a fast implementation compatible with clinical activities. The proposed tomographic reconstruction technique is a combination of the Ordered Subsets Convex (OSC) algorithm and the Total Variation minimization (TV) regularization technique. The results in terms of image quality and computational speed are discussed. Using this technique, it was possible to obtain reconstructed slices of relatively good quality with as few as 100 projections, leading to potential dose reduction factors of up to an order of magnitude depending on the application. The algorithm was implemented on a Graphical Processing Unit (GPU) and yielded reconstruction times of approximately 185 ms per slice. (orig.)

  10. Is the OSCE more stressful? Examination anxiety and its consequences in different assessment methods in dental education

    NARCIS (Netherlands)

    Brand, H.S.; Schoonheim-Klein, M.

    2009-01-01

    Objective: To measure the levels of anxiety, self-perception of preparation and expectation for success induced by an objective structured clinical examination (OSCE), a written examination and a preclinical preparation test, and to examine the effects of the three predictive variables on the

  11. Exploration of Nursing Faculty Members' Lived Experiences of Objective Structured Clinical Examination (OSCE) in Undergraduate Nursing Education

    Science.gov (United States)

    Obizoba, Cordelia O.

    2014-01-01

    The purpose of this phenomenological study was to gain an understanding of nursing faculty members' lived experiences of Objective Structured Clinical Examination (OSCE) in undergraduate nursing education. As owners of their programs' curriculum, nursing faculties are charged with the responsibility of providing needed knowledge, skills, and…

  12. The use of global rating scales for OSCEs in veterinary medicine.

    Directory of Open Access Journals (Sweden)

    Emma K Read

    Full Text Available OSCEs (Objective Structured Clinical Examinations are widely used in health professions to assess clinical skills competence. Raters use standardized binary checklists (CL or multi-dimensional global rating scales (GRS to score candidates performing specific tasks. This study assessed the reliability of CL and GRS scores in the assessment of veterinary students, and is the first study to demonstrate the reliability of GRS within veterinary medical education. Twelve raters from two different schools (6 from University of Calgary [UCVM] and 6 from Royal (Dick School of Veterinary Studies [R(DSVS] were asked to score 12 students (6 from each school. All raters assessed all students (video recordings during 4 OSCE stations (bovine haltering, gowning and gloving, equine bandaging and skin suturing. Raters scored students using a CL, followed by the GRS. Novice raters (6 R(DSVS were assessed independently of expert raters (6 UCVM. Generalizability theory (G theory, analysis of variance (ANOVA and t-tests were used to determine the reliability of rater scores, assess any between school differences (by student, by rater, and determine if there were differences between CL and GRS scores. There was no significant difference in rater performance with use of the CL or the GRS. Scores from the CL were significantly higher than scores from the GRS. The reliability of checklist scores were .42 and .76 for novice and expert raters respectively. The reliability of the global rating scale scores were .7 and .86 for novice and expert raters respectively. A decision study (D-study showed that once trained using CL, GRS could be utilized to reliably score clinical skills in veterinary medicine with both novice and experienced raters.

  13. Performance of OSC's initial Amtec generator design, and comparison with JPL's Europa Orbiter goals

    International Nuclear Information System (INIS)

    Schock, A.; Noravian, H.; Or, C.; Kumar, V.

    1998-01-01

    The procedure for the analysis (with overpotential correction) of multitube AMTEC (Alkali Metal Thermal-to-Electrical Conversion) cells described in Paper IECEC 98-243 was applied to a wide range of multicell radioisotope space power systems. System design options consisting of one or two generators, each with 2, 3, or 4 stacked GPHS (General Purpose Heat Source) modules, identical to those used on previous NASA missions, were analyzed and performance-mapped. The initial generators analyzed by OSC had 8 AMTEC cells on each end of the heat source stack, with five beta-alumina solid electrolyte (BASE) tubes per cell. The heat source and converters in the Orbital generator designs are embedded in a thermal insulation system consisting of Min-K fibrous insulation surrounded by graded-length molybdenum multifoils. Detailed analyses in previous Orbital studies found that such an insulation system could reduce extraneous heat losses to about 10%. For the above design options, the present paper presents the system mass and performance (i.e., the EOM system efficiency and power output and the BOM evaporator and clad temperatures) for a wide range of heat inputs and load voltages, and compares the results with JPL's preliminary goals for the Europa Orbiter mission to be launched in November 2003. The analytical results showed that the initial 16-cell generator designs resulted in either excessive evaporator and clad temperatures and/or insufficient power outputs to meet the JPL-specified mission goals. The computed performance of modified OSC generators with different numbers of AMTEC cells, cell diameters, cell lengths, cell materials, BASE tube lengths, and number of tubes per cell are described in Paper IECEC.98.245 in these proceedings

  14. Assessing nursing clinical skills competence through objective structured clinical examination (OSCE) for open distance learning students in Open University Malaysia.

    Science.gov (United States)

    Oranye, Nelson Ositadimma; Ahmad, Che'an; Ahmad, Nora; Bakar, Rosnida Abu

    2012-06-01

    The objective structured clinical skills examination (OSCE) has over the years emerged as a method of evaluating clinical skills in most medical and allied professions. Although its validity and objectivity has evoked so much debate in the literature, little has been written about its application in non-traditional education systems such as in distance learning. This study examined clinical skills competence among practising nursing students who were enrolled in a distance learning programme. The study examined the effect of work and years of nursing practice on nurses' clinical skills competence. This study used observational design whereby nursing students' clinical skills were observed and scored in five OSCE stations. Two instruments were used for the data collection - A self-administered questionnaire on the students' bio-demographic data, and a check list on the clinical skills which the examiners rated on a four point scale. The findings revealed that 14% of the nurses had level four competence, which indicated that they could perform the tasks correctly and complete. However, 12% failed the OSCE, even though they had more than 10 years experience in nursing and post basic qualifications. Inter-rater reliability was 0.92 for the five examiners. Factor analysis indicated that five participant factors accounted for 74.1% of the variations in clinical skills performance. An OSCE is a necessary assessment tool that should be continuously applied in nursing education, regardless of the mode of the education program, the student's years of experience or his/her clinical placement. This study validates the need for OSCE in both the design of tertiary nursing degree programs and the assessment of nurses' clinical competency level.

  15. Development, implementation, and evaluation of an integrated multidisciplinary Objective Structured Clinical Examination (OSCE) in primary health care settings within limited resources.

    Science.gov (United States)

    Abdelaziz, Adel; Hany, Mohamed; Atwa, Hani; Talaat, Wagdy; Hosny, Somaya

    2016-01-01

    In ordinary circumstances, objective structured clinical examination (OSCE) is a resource-intensive assessment method. In case of developing and implementing multidisciplinary OSCE, there is no doubt that the cost will be greater. Through this study a research project was conducted to develop, implement and evaluate a multidisciplinary OSCE model within limited resources. This research project went through the steps of blueprinting, station writing, resources reallocation, implementation and finally evaluation. The developed model was implemented in the Primary Health Care (PHC) program which is one of the pillars of the Community-Based undergraduate curriculum of the Faculty of Medicine, Suez Canal University (FOM-SCU). Data for evaluation of the implemented OSCE model were derived from two resources. First, feedback of the students and assessors through self-administered questionnaires was obtained. Second, evaluation of the OSCE psychometrics was done. The deliverables of this research project included a set of validated integrated multi-disciplinary and low cost OSCE stations with an estimated reliability index of 0.6. After having this experience, we have a critical mass of faculty members trained on blueprinting and station writing and a group of trained assessors, facilitators and role players. Also there is a state of awareness among students on how to proceed in this type of OSCE which renders future implementation more feasible.

  16. Team OSCE: A Teaching Modality for Promotion of Multidisciplinary Work in Mental Health Settings.

    Science.gov (United States)

    Sharma, Manoj Kumar; Chandra, Prabha S; Chaturvedi, Santosh K

    2015-01-01

    The objective structured clinical examination has been in use both as an assessment and a teaching modality within the mental health profession. It focuses on individual skill enhancement, the inter-professional understanding of role obligation is helpful in promoting competence as a team as well as role of other team members. The Team OSCE (TOSCE) is an effective way in promoting inter-professional learning. The present work assesses the trainee experience with TOSCE and its utility in clinical care. Twenty-two mental health trainees (17 male and 5 female from psychiatry, clinical psychology and psychiatric social work) got exposure to weekly OSCAF training as well as 2-3 Team OSCAFS on various aspects of clinical work as a part of their clinical training for 3 months. Rating from the trainees were taken on TOSCE feedback checklist. TOSCE was helpful in promoting the understanding role of other team members; shared decision-making, problem-solving, handling unexpected events, giving feedback and closure. The TOSCE may be introduced as a way to work on clinical performance, shared decision-making and inter-professional understanding.

  17. An innovative OSCE clinical log station: a quantitative study of its influence on Log use by medical students

    Directory of Open Access Journals (Sweden)

    Hudson Judith N

    2012-11-01

    Full Text Available Abstract Background A Clinical Log was introduced as part of a medical student learning portfolio, aiming to develop a habit of critical reflection while learning was taking place, and provide feedback to students and the institution on learning progress. It was designed as a longitudinal self-directed structured record of student learning events, with reflection on these for personal and professional development, and actions planned or taken for learning. As incentive was needed to encourage student engagement, an innovative Clinical Log station was introduced in the OSCE, an assessment format with established acceptance at the School. This study questions: How does an OSCE Clinical Log station influence Log use by students? Methods The Log station was introduced into the formative, and subsequent summative, OSCEs with careful attention to student and assessor training, marking rubrics and the standard setting procedure. The scoring process sought evidence of educational use of the log, and an ability to present and reflect on key learning issues in a concise and coherent manner. Results Analysis of the first cohort’s Log use over the four-year course (quantified as number of patient visits entered by all students revealed limited initial use. Usage was stimulated after introduction of the Log station early in third year, with some improvement during the subsequent year-long integrated community-based clerkship. Student reflection, quantified by the mean number of characters in the ‘reflection’ fields per entry, peaked just prior to the final OSCE (mid-Year 4. Following this, very few students continued to enter and reflect on clinical experience using the Log. Conclusion While the current study suggested that we can’t assume students will self-reflect unless such an activity is included in an assessment, ongoing work has focused on building learner and faculty confidence in the value of self-reflection as part of being a competent

  18. Student´s self-assessment of clinical competence and objective clinical performance in OSCE evaluation

    OpenAIRE

    Jünger, J; Schellberg, D; Nikendei, C

    2006-01-01

    [english] Overestimating one's clinical competence can be dangerous to patient's safety. Therefore the goal of this study was to identify students with high confidence in their own clinical competence but low performance in objective assessment. 171 students in the 14 week course in internal medicine completed the clinical skills-related self-assessment expectations (SE) and were tested in a 12 station OSCE. Both measures were obtained within three days. In total we identified 16% of students...

  19. Objective Structured Clinical Examinations (OSCEs, psychiatry and the Clinical assessment of Skills and Competencies (CASCSame Evidence, Different Judgement

    Directory of Open Access Journals (Sweden)

    Marwaha Steven

    2011-05-01

    Full Text Available Abstract Background The Objective Structured Clinical Examination (OSCE, originally developed in the 1970's, has been hailed as the "gold standard" of clinical assessments for medical students and is used within medical schools throughout the world. The Clinical assessment of Skills and Competencies (CASC is an OSCE used as a clinical examination gateway, granting access to becoming a senior Psychiatrist in the UK. Discussion Van der Vleuten's utility model is used to examine the CASC from the viewpoint of a senior psychiatrist. Reliability may be equivalent to more traditional examinations. Whilst the CASC is likely to have content validity, other forms of validity are untested and authenticity is poor. Educational impact has the potential to change facets of psychiatric professionalism and influence future patient care. There are doubts about acceptability from candidates and more senior psychiatrists. Summary Whilst OSCEs may be the best choice for medical student examinations, their use in post graduate psychiatric examination in the UK is subject to challenge on the grounds of validity, authenticity and educational impact.

  20. Testing clinical competencies in undergraduate nursing education using Objective Structured Clinical Examination (OSCE) – a literature review of international practice

    Science.gov (United States)

    Beyer, Angelika; Dreier, Adina; Kirschner, Stefanie; Hoffmann, Wolfgang

    2016-07-01

    Background: In response to demographic trends in Germany nursing competencies are currently reevaluated. Since these have to be taught and trained in nursing education programs, efficient verification of the success is necessary. OSCEs are internationally well-recognized as a comprehensive tool for that. Aim: In this analysis we identified competencies worldwide, which are tested by OSCEs in undergraduate nursing education programs. Method: An international literature research was conducted. The selection criterion for an article was the specification of at least one verifiable competency. Afterwards the competencies were categorized into knowledge, skills and attitudes according to the German “Fachqualifikationsrahmen Pflege für die hochschulische Bildung”. Results: A total of 36 publications fulfilled all inclusion criteria. Relevant studies were predominantly initiated in the UK, Canada and Australia. Within all categories a total of n = 166 different competencies are mentioned. OSCEs are developed and performed in a broad range of methods. Most frequently skills were verified. The most common topic was sure handling of medication. Other important themes were communicative competencies in relation to patients and the ability of self-evaluation. Discussion/Conclusions: A variation in examination methods is appropriate as different competencies are acquired in preparation of the test. Evaluation took place on an individual or institutional level. Further research is needed.

  1. Modifying the organic/electrode interface in Organic Solar Cells (OSCs) and improving the efficiency of solution-processed phosphorescent Organic Light-Emitting Diodes (OLEDs)

    Energy Technology Data Exchange (ETDEWEB)

    Xiao, Teng [Iowa State Univ., Ames, IA (United States)

    2012-01-01

    Organic semiconductors devices, such as, organic solar cells (OSCs), organic light-emitting diodes (OLEDs) and organic field-effect transistors (OFETs) have drawn increasing interest in recent decades. As organic materials are flexible, light weight, and potentially low-cost, organic semiconductor devices are considered to be an alternative to their inorganic counterparts. This dissertation will focus mainly on OSCs and OLEDs. As a clean and renewable energy source, the development of OSCs is very promising. Cells with 9.2% power conversion efficiency (PCE) were reported this year, compared to < 8% two years ago. OSCs belong to the so-called third generation solar cells and are still under development. While OLEDs are a more mature and better studied field, with commercial products already launched in the market, there are still several key issues: (1) the cost of OSCs/OLEDs is still high, largely due to the costly manufacturing processes; (2) the efficiency of OSCs/OLEDs needs to be improved; (3) the lifetime of OSCs/OLEDs is not sufficient compared to their inorganic counterparts; (4) the physics models of the behavior of the devices are not satisfactory. All these limitations invoke the demand for new organic materials, improved device architectures, low-cost fabrication methods, and better understanding of device physics. For OSCs, we attempted to improve the PCE by modifying the interlayer between active layer/metal. We found that ethylene glycol (EG) treated poly(3,4-ethylenedioxythiophene): polystyrenesulfonate (PEDOT: PSS) improves hole collection at the metal/polymer interface, furthermore it also affects the growth of the poly(3- hexylthiophene) (P3HT):phenyl-C61-butyric acid methyl ester (PCBM) blends, making the phase segregation more favorable for charge collection. We then studied organic/inorganic tandem cells. We also investigated the effect of a thin LiF layer on the hole-collection of copper phthalocyanine (CuPc)/C70-based small molecular OSCs. A

  2. Subjektive Kompetenzeinschätzung von Studierenden und ihre Leistung im OSCE [Student´s self-assessment of clinical competence and objective clinical performance in OSCE evaluation

    Directory of Open Access Journals (Sweden)

    Jünger, Jana

    2006-08-01

    Full Text Available [english] Overestimating one's clinical competence can be dangerous to patient's safety. Therefore the goal of this study was to identify students with high confidence in their own clinical competence but low performance in objective assessment. 171 students in the 14 week course in internal medicine completed the clinical skills-related self-assessment expectations (SE and were tested in a 12 station OSCE. Both measures were obtained within three days. In total we identified 16% of students who overestimated their performance in clinical skills compared to their OSCE-results. Male students significantly more oversestimated their clinical compltence (31% than female students. One possible cause may be the lack of corrective experiences during clinical traineeship leading to the misconception of own performance. Further validation and the integration of a counselling program for these students seem necessary. [german] Die Selbstüberschätzung ärztlicher Kompetenzen kann weitereichende Konsequenzen für die Patientensicherheit haben. Aus diesem Grunde initiierten wir eine Studie zur Identifizierung von Studierenden, die ihre klinische Kompetenz als sehr gut einschätzen, jedoch eine unzufriedenstellende objektive klinisch-praktische Performanz aufweisen. 171 Studierende des 14-wöchigen Blockes Innere Medizin an der Medizinischen Universitätsklinik Heidelberg füllten einen Selbsteinschätzungsfragebogen zur klinischen Kompetenz aus und wurden in einem 12-Stationen OSCE evaluiert. Beide Messungen wurden innerhalb von drei Tagen vollzogen. Insgesamt konnten 16% der Studierenden identifiziert werden, die sich verglichen mit den OSCE-Ergebnissen, bezüglich ihrer klinisch-praktischen Fertigkeit selbst überschätzen. Dabei überschätzen sich signifikant mehr männliche (31% als weibliche (8% Studierende. Eine mögliche Erklärung für den Sachverhalt der studentischen Fehleinschätzung klinischer Kompetenzen könnte in fehlenden korrigierenden R

  3. Evaluation of a multi-methods approach to the collection and dissemination of feedback on OSCE performance in dental education.

    Science.gov (United States)

    Wardman, M J; Yorke, V C; Hallam, J L

    2018-05-01

    Feedback is an essential part of the learning process, and students expect their feedback to be personalised, meaningful and timely. Objective Structured Clinical Examination (OSCE) assessments allow examiners to observe students carefully over the course of a number of varied station types, across a number of clinical knowledge and skill domains. They therefore present an ideal opportunity to record detailed feedback which allows students to reflect on and improve their performance. This article outlines two methods by which OSCE feedback was collected and then disseminated to undergraduate dental students across 2-year groups in a UK dental school: (i) Individual written feedback comments made by examiners during the examination, (ii) General audio feedback recorded by groups of examiners immediately following the examination. Evaluation of the feedback was sought from students and staff examiners. A multi-methods approach utilising Likert questionnaire items (quantitative) and open-ended feedback questions (qualitative) was used. Data analysis explored student and staff perceptions of the audio and written feedback. A total of 131 students (response rate 68%) and 52 staff examiners (response rate 83%) completed questionnaires. Quantitative data analysis showed that the written and audio formats were reported as a meaningful source of feedback for learning by both students (93% written, 89% audio) and staff (96% written, 92% audio). Qualitative data revealed the complementary nature of both types of feedback. Written feedback gives specific, individual information whilst audio shares general observations and allows students to learn from others. The advantages, limitations and challenges of the feedback methods are discussed, leading to the development of an informed set of implementation guidelines. Written and audio feedback methods are valued by students and staff. It is proposed that these may be very easily applied to OSCEs running in other dental schools.

  4. The Objective Structured Clinical Examination (OSCE) as a strategy for assessing clinical competence in midwifery education in Ireland: a critical review.

    Science.gov (United States)

    Smith, Valerie; Muldoon, Kathryn; Biesty, Linda

    2012-09-01

    In Ireland, to register as a midwife, all student midwives must be deemed competent to practice with the assessment of competence an essential component of midwifery education. A variety of assessment strategies, including observed practice, clinical interviews, portfolios of reflection, the Objective Structured Clinical Examination (OSCE) and written examination papers, are utilised to assess midwifery students' clinical competence. In this paper, a critical review of the OSCE as a strategy for assessing clinical competence in one third level institution in Ireland is offered. Although utilised for assessing competence across a range of areas (e.g. obstetric emergencies and pharmacology/drug administration), the use of the OSCE for assessing midwifery students' competence in lactation and infant feeding practices, as an example for this paper, is described. The advantages, disadvantages, validity and reliability of the OSCE, as an assessment strategy, are critically explored. Recognising that no single assessment strategy can provide all the information required to assess something as complex as clinical performance, the OSCE, when viewed alongside other forms of assessment, and with relevance to the topic under examination, may be considered a valuable strategy for enhancing the assessment of students' clinical competence, and for embracing diversity within midwifery education and training. Copyright © 2012 Elsevier Ltd. All rights reserved.

  5. Wahlfach Teamarbeit: Ergebnisse eines Pilotprojektes zur interprofessionellen und interdisziplinären Ausbildung mit formativem Team-OSCE (TOSCE [Teamwork elective: Results of a German pilot project on interprofessional and interdisciplinary education with formative team OSCE

    Directory of Open Access Journals (Sweden)

    Schmidt, Anita

    2010-08-01

    Full Text Available [english] Aims: There is a growing need to implement teamworking in medical education. In reality, interdisciplinary and interprofessional education is often absent. Here we describe a pilot trial developed jointly by the nursing college and the medical faculty in Erlangen (Germany in which nursing students and undergraduate medical students formed interprofessional teams and were confronted with interprofessional cases using simulated patients (SPs and phantoms. The elective was planned using standard curriculum planning instruments and finally evaluated with a novel formative team OSCE (Objective Structured Clinical Evaluation instrument.Methods: During one year, 20 nursing students participated voluntarily in the project and 10 medical students took the course as an elective. Results: The pilot project was first performed with two tutors, one from the medical school and one from the nursing school, as well as one to two SPs. During the second course, there was only one tutor. Overall evaluation of the voluntary students was good, with some elements (acute stroke, factual knowledge, and general organizational problems that needed to be improved. Performance of a four-station team OSCE was feasible, but raters reported problems in assessing individuals and the team at the same time. Interobserver agreement was satisfactory (kappa 0.35.Conclusions: Interdisciplinary and interprofessional education between a nursing school and a medical school is feasible within an elective, but requires substantial personnel resources. Design and performance of a team OSCE is possible. The validity of the test has to be shown on follow-up.[german] Zielsetzung: Das Lernziel „Fähigkeit zur interprofessionellen und interdisziplinären Teamarbeit“ wird sowohl in der aktuellen Approbationsordnung für Ärzte als auch im Krankenpflegegesetz gefordert. In der Realität gibt es in beiden Ausbildungen kaum gemeinsame Lehreinheiten. Wir beschreiben ein Pilotprojekt

  6. Feedback promotes learning success! Which kind of feedback for the faculty is given by an interdisciplinary OSCE with focus on decision-making?

    Directory of Open Access Journals (Sweden)

    Stibane, Tina

    2016-08-01

    Full Text Available Clinical skills such as history taking, diagnostic reasoning, therapy planning, and giving advice are even more complex than practical skills like lung auscultation and have to be applied in complex clinical situations. We judged this competence in an interdisciplinary formative OSCE conducted with students of Marburg University. Results of 218 students passing 643 OSCE stations composed of 37 different scenarios were analyzed. As a competence based examination that reflects the practical skills gained during clinical training, the here presented analysis serves also as a feedback instrument for clinical teachers, their respective disciplines and the medical faculty as a whole.

  7. Assessing third-year medical students' ability to address a patient's spiritual distress using an OSCE case.

    Science.gov (United States)

    McEvoy, Mimi; Schlair, Sheira; Sidlo, Zsuzsanna; Burton, William; Milan, Felise

    2014-01-01

    To inform curricular development by assessing the ability of third-year medical students to address a patient's spiritual distress during an acute medical crisis in the context of an objective structured clinical examination (OSCE) case. During March and April 2010, 170 third-year medical students completed an eight-station videotaped OSCE at Albert Einstein College of Medicine of Yeshiva University. One of the standardized patients (SPs) was a 65-year-old man with acute chest pain who mentioned his religious affiliation and fear of dying. If prompted, he revealed his desire to speak with a chaplain. The SP assessed students' history taking, physical examination, and communication skills. In a postencounter written exercise, students reported their responses to the patient's distress via four open-ended questions. Analysis of the postencounter notes was conducted by three coders for emergent themes. Clinical skills performance was compared between students who reported making chaplain referral and those who did not. A total of 108 students (64%) reported making a chaplain referral; 4 (2%) directly addressed the patient's religious/spiritual beliefs. Students' clinical performance scores showed no significant association with whether they made a chaplain referral. Findings suggest that the majority of medical students without robust training in addressing patients' spiritual needs can make a chaplain referral when faced with a patient in spiritual crisis. Yet, few students explicitly engaged the patient in a discussion of his beliefs. Thus, future studies are needed to develop more precise assessment measures that can inform development in spirituality and medicine curricula.

  8. 'Hello, my name is Gabriel, I am the house officer, may I examine you?' or the Objective Santa Christmas Examination (OSCE).

    Science.gov (United States)

    Wood, D; Roberts, T; Bradley, P; Lloyd, D; O'Neill, P

    1999-12-01

    To design a clinical examination of high content validity suitable for use as a formative assessment tool with pre-registration house officers (PRHO'S) towards the end of their first house officer post. A multicentre collaboration between four UK medical schools who offer undergraduate curricula which are problem-based, systems-based, patient-orientated, student-centred, jargon-laden and utterly staff-bewildering. An objective structured clinical examination (OSCE) which is suitable for use with graduates of UK medical schools. It assesses the knowledge, skills and attitudes essential for future careers in a hierarchical system where protecting the senior staff from all forms of irritation is paramount. PRHO'S who excel in this examination get better references. The OSCE format can be used to provide 'real-life' scenarios appropriate to the season.

  9. [Implementation of bedside training and advanced objective structured clinical examination (OSCE) trial to learn and confirm about pharmacy clinical skills].

    Science.gov (United States)

    Tokunaga, Jin; Takamura, Norito; Ogata, Kenji; Setoguchi, Nao; Sato, Keizo

    2013-01-01

    Bedside training for fourth-year students, as well as seminars in hospital pharmacy (vital sign seminars) for fifth-year students at the Department of Pharmacy of Kyushu University of Health and Welfare have been implemented using patient training models and various patient simulators. The introduction of simulation-based pharmaceutical education, where no patients are present, promotes visually, aurally, and tactilely simulated learning regarding the evaluation of vital signs and implementation of physical assessment when disease symptoms are present or adverse effects occur. A patient simulator also promotes the creation of training programs for emergency and critical care, with which basic as well as advanced life support can be practiced. In addition, an advanced objective structured clinical examination (OSCE) trial has been implemented to evaluate skills regarding vital signs and physical assessments. Pharmacists are required to examine vital signs and conduct physical assessment from a pharmaceutical point of view. The introduction of these pharmacy clinical skills will improve the efficacy of drugs, work for the prevention or early detection of adverse effects, and promote the appropriate use of drugs. It is considered that simulation-based pharmaceutical education is essential to understand physical assessment, and such education will ideally be applied and developed according to on-site practices.

  10. Communication skills of medical students during the OSCE: Gender-specific differences in a longitudinal trend study.

    Science.gov (United States)

    Graf, Joachim; Smolka, Robert; Simoes, Elisabeth; Zipfel, Stephan; Junne, Florian; Holderried, Friederike; Wosnik, Annette; Doherty, Anne M; Menzel, Karina; Herrmann-Werner, Anne

    2017-05-02

    Communication skills are essential in a patient-centred health service and therefore in medical teaching. Although significant differences in communication behaviour of male and female students are known, gender differences in the performance of students are still under-reported. The aim of this study was to analyse gender differences in communication skills of medical students in the context of an OSCE exam (OSCE = Objective Structured Clinical Examination). In a longitudinal trend study based on seven semester-cohorts, it was analysed if there are gender differences in medical students' communication skills. The students (self-perception) and standardized patients (SP) (external perception) were asked to rate the communication skills using uniform questionnaires. Statistical analysis was performed by using frequency analyses and t-tests in SPSS 21. Across all ratings in the self- and the external perception, there was a significant gender difference in favour of female students performing better in the dimensions of empathy, structure, verbal expression and non-verbal expression. The results of male students deteriorated across all dimensions in the external perception between 2011 and 2014. It is important to consider if gender-specific teaching should be developed, considering the reported differences between female and male students.

  11. Patterns of nucleotide diversity and phenotypes of two domestication related genes (OsC1 and Wx) in indigenous rice varieties in Northeast India.

    Science.gov (United States)

    Choudhury, Baharul Islam; Khan, Mohammed Latif; Dayanandan, Selvadurai

    2014-06-16

    During the domestication of crops, individual plants with traits desirable for human needs have been selected from their wild progenitors. Consequently, genetic and nucleotide diversity of genes associated with these selected traits in crop plants are expected to be lower than their wild progenitors. In the present study, we surveyed the pattern of nucleotide diversity of two selected trait specific genes, Wx and OsC1, which regulate amylose content and apiculus coloration respectively in cultivated rice varieties. The analyzed samples were collected from a wide geographic area in Northeast (NE) India, and included contrasting phenotypes considered to be associated with selected genes, namely glutinous and nonglutinous grains and colored and colorless apiculus. No statistically significant selection signatures were detected in both Wx and OsC1gene sequences. However, low level of selection that varied across the length of each gene was evident. The glutinous type varieties showed higher levels of nucleotide diversity at the Wx locus (πtot = 0.0053) than nonglutinous type varieties (πtot = 0.0043). The OsC1 gene revealed low levels of selection among the colorless apiculus varieties with lower nucleotide diversity (πtot = 0.0010) than in the colored apiculus varieties (πtot = 0.0023). The results revealed that functional mutations at Wx and OsC1genes considered to be associated with specific phenotypes do not necessarily correspond to the phenotypes in indigenous rice varieties in NE India. This suggests that other than previously reported genomic regions may also be involved in determination of these phenotypes.

  12. Determination of Trace Amounts of Gold in Environmental Samples by Adsorptive Stripping Voltammetry of Its Complex with Rhodamine Using Osc-Pls

    Directory of Open Access Journals (Sweden)

    A. Akrami

    2012-11-01

    Full Text Available The multivariate calibration method was applied for the determination of trace amounts of gold based on a hanging mercury drop electrode (HMDE in the presence of rhodanine, followed by reduction of adsorbed gold by voltammetric scan using differential pulse modulation The optimum experimental conditions are: rhodanine concentration of 0.20 mg mL-1, pH 5.0, accumulation potential of -600 mV versus Ag/AgCl, accumulation time of 100 sec, scan rate of 30 mV s-1 and pulse height of 100 mV. The calibration matrix for partial least squares (PLS regression was designed with 9 samples. Orthogonal signal correction (OSC is a preprocessing technique used for removing the information unrelated to the target variables based on constrained principal component analysis. OSC is a suitable preprocessing method for PLS calibration without loss of prediction capacity using electrochemical method. The RMSEP for gold determination with PLS and OSC-PLS were 8.51 and 1.94, respectively. This procedure allows the determination of gold in synthetic and real samples with good reliability of the determination. 

  13. Chlorosomes: antenna organelles in photosynthetic green bacteria

    DEFF Research Database (Denmark)

    Frigaard, N.-U.; Bryant, D. A.

    2006-01-01

    The new series "Microbiology Monographs" begins with two volumes on intracellular components in prokaryotes. In this second volume, "Complex Intracellular Structures in Prokaryotes", the components, labelled complex intracellular structures, encompass a multitude of important cellular functions. ...

  14. A simple framework for assessing technical skills in a resident observed structured clinical examination (OSCE): vaginal laceration repair.

    Science.gov (United States)

    Winkel, Abigail Ford; Lerner, Veronica; Zabar, Sondra R; Szyld, Demian

    2013-01-01

    Educators of trainees in procedure-based specialties need focused assessment tools that are valid, objective, and assess technical skills in a realistic context. A framework for hybrid assessment using standardized patient scenarios and bench skills testing might facilitate evaluation of competency. Seven PGY-1 obstetrics and gynecology residents participated in a hybrid assessment that used observed structured clinical examination (OSCE) by a standardized patient who had sustained a vaginal laceration during vaginal delivery. The residents elicited a history and counseled the patient, and then completed a laceration repair on a pelvic model. The residents were rated on their performance in the scenario, which included issues of cultural competency, rapport-building, patient counseling. The technical skills were videotaped and rated using a modified global assessment form by 2 faculty members on a 3-point scale from "not done" to "partly done" to "well-done." Residents also completed a subjective assessment of the station. Mean technical performance of the residents on the technical skills was 55% "well-done," with a range of 20%-90%. The assessment identified 3 residents as below the mean, and 1 resident with areas of deficiency. Subjective assessment by the residents was that juggling the technical, cognitive, and affective components of the examination was challenging. Technical skills can be included in a case-based assessment using scenarios that address a range of cognitive and affective skills required of physicians. Results may help training programs assess individuals' abilities as well as identify program needs for curricular improvement. This framework might be useful in setting standards for competency and identifying poor performers. Copyright © 2012 Association of Program Directors in Surgery. Published by Elsevier Inc. All rights reserved.

  15. A near-peer teaching program designed, developed and delivered exclusively by recent medical graduates for final year medical students sitting the final objective structured clinical examination (OSCE

    Directory of Open Access Journals (Sweden)

    Sobowale Oluwaseun

    2011-03-01

    Full Text Available Abstract Background The General Medical Council states that teaching doctors and students is important for the care of patients. Our aim was to deliver a structured teaching program to final year medical students, evaluate the efficacy of teaching given by junior doctors and review the pertinent literature. Methods We developed a revision package for final year medical students sitting the Objective Structured Clinical Examination (OSCE. The package was created and delivered exclusively by recent medical graduates and consisted of lectures and small group seminars covering the core areas of medicine and surgery, with a focus on specific OSCE station examples. Students were asked to complete a feedback questionnaire during and immediately after the program. Results One hundred and eighteen completed feedback questionnaires were analysed. All participants stated that the content covered was relevant to their revision. 73.2% stated that junior doctors delivered teaching that is comparable to that of consultant - led teaching. 97.9% stated the revision course had a positive influence on their learning. Conclusions Our study showed that recent medical graduates are able to create and deliver a structured, formal revision program and provide a unique perspective to exam preparation that was very well received by our student cohort. The role of junior doctors teaching medical students in a formal structured environment is very valuable and should be encouraged.

  16. The iOSC3 System: Using Ontologies and SWRL Rules for Intelligent Supervision and Care of Patients with Acute Cardiac Disorders

    Directory of Open Access Journals (Sweden)

    Marcos Martínez-Romero

    2013-01-01

    Full Text Available Physicians in the Intensive Care Unit (ICU are specially trained to deal constantly with very large and complex quantities of clinical data and make quick decisions as they face complications. However, the amount of information generated and the way the data are presented may overload the cognitive skills of even experienced professionals and lead to inaccurate or erroneous actions that put patients’ lives at risk. In this paper, we present the design, development, and validation of iOSC3, an ontology-based system for intelligent supervision and treatment of critical patients with acute cardiac disorders. The system analyzes the patient’s condition and provides a recommendation about the treatment that should be administered to achieve the fastest possible recovery. If the recommendation is accepted by the doctor, the system automatically modifies the quantity of drugs that are being delivered to the patient. The knowledge base is constituted by an OWL ontology and a set of SWRL rules that represent the expert’s knowledge. iOSC3 has been developed in collaboration with experts from the Cardiac Intensive Care Unit (CICU of the Meixoeiro Hospital, one of the most significant hospitals in the northwest region of Spain.

  17. The on scene command and control system (OSC2) : an integrated incident command system (ICS) forms-database management system and oil spill trajectory and fates model

    International Nuclear Information System (INIS)

    Anderson, E.; Galagan, C.; Howlett, E.

    1998-01-01

    The On Scene Command and Control (OSC 2 ) system is an oil spill modeling tool which was developed to combine Incident Command System (ICS) forms, an underlying database, an integrated geographical information system (GIS) and an oil spill trajectory and fate model. The first use of the prototype OSC 2 system was at a PREP drill conducted at the U.S. Coast Guard Marine Safety Office, San Diego, in April 1998. The goal of the drill was to simulate a real-time response over a 36-hour period using the Unified Command System. The simulated spill was the result of a collision between two vessels inside San Diego Bay that caused the release of 2,000 barrels of fuel oil. The hardware component of the system which was tested included three notebook computers, two laser printers, and a poster printer. The field test was a success but it was not a rigorous test of the system's capabilities. The map display was useful in quickly setting up the ICS divisions and groups and in deploying resources. 6 refs., 1 tab., 5 figs

  18. The effect on reliability and sensitivity to level of training of combining analytic and holistic rating scales for assessing communication skills in an internal medicine resident OSCE.

    Science.gov (United States)

    Daniels, Vijay John; Harley, Dwight

    2017-07-01

    Although previous research has compared checklists to rating scales for assessing communication, the purpose of this study was to compare the effect on reliability and sensitivity to level of training of an analytic, a holistic, and a combined analytic-holistic rating scale in assessing communication skills. The University of Alberta Internal Medicine Residency runs OSCEs for postgraduate year (PGY) 1 and 2 residents and another for PGY-4 residents. Communication stations were scored with an analytic scale (empathy, non-verbal skills, verbal skills, and coherence subscales) and a holistic scale. Authors analyzed reliability of individual and combined scales using generalizability theory and evaluated each scale's sensitivity to level of training. For analytic, holistic, and combined scales, 12, 12, and 11 stations respectively yielded a Phi of 0.8 for the PGY-1,2 cohort, and 16, 16, and 14 stations yielded a Phi of 0.8 for the PGY-4 cohort. PGY-4 residents scored higher on the combined scale, the analytic rating scale, and the non-verbal and coherence subscales. A combined analytic-holistic rating scale increased score reliability and was sensitive to level of training. Given increased validity evidence, OSCE developers should consider combining analytic and holistic scales when assessing communication skills. Copyright © 2017 Elsevier B.V. All rights reserved.

  19. OSCE para Competências de Comunicação Clínica e Profissionalismo: Relato de Experiência e Meta-Avaliação

    Directory of Open Access Journals (Sweden)

    Camila Ament Giuliani dos Santos Franco

    Full Text Available RESUMO A comunicação clínica e o profissionalismo estão entre as principais competências médicas e, portanto, devem ter sua avaliação garantida. Nesse contexto, o exame clínico objetivo estruturado (OSCE tem papel fundamental. Objetivos Descrever as etapas de elaboração de um OSCE, bem como a avaliação da qualidade das estações e a percepção do estudante de Medicina sobre a sua realização. Método O estudo é composto pela realização de um OSCE com quatro estações por 16 estudantes de Medicina e pela análise da qualidade psicométrica e aplicação de um questionário de satisfação. Resultados Para os estudantes, o OSCE é o método que melhor avalia e ensina essas competências, ao passo que os testes de múltipla escolha estão no polo oposto quanto à avaliação. Em relação à qualidade múltipla das estações: duas se apresentaram com boa confiabilidade, uma se tornou satisfatória após adequação e uma se revelou inconsistente. Conclusão Mesmo bem avaliadas pelos estudantes, algumas estações apresentaram falhas. A análise do OSCE é fundamental para sua validade e mensurabilidade, em especial para o OSCE de alta aposta.

  20. Organizaciones de la sociedad civil (OSC y el fenómeno histórico de la migración en Jiquilpan, Michoacán

    Directory of Open Access Journals (Sweden)

    Rubén Ramirez Arellano

    2014-12-01

    Full Text Available En Jiquilpan, las organizaciones de la sociedad civil formadas por migrantes ayudan a mejorar las condiciones de su comunidad. Este objetivo en común recuperó la agenda social de la cual no se ocupaba el gobierno. Sin embargo, actualmente representan uno de los actores de transformación más importante en la región, por lo que el gobierno local promueve su articulación con las organizaciones a favor del desarrollo en sus comunidades de origen. La construcción de las relaciones políticas a partir de las estructuras jerárquicas se reproduce desde la familia hasta otras instituciones. De manera notable las organizaciones tienen una base familiar y barrial como un componente cultural sustantivo. La emergencia de las OSC como un actor político en el contexto migratorio, se relaciona con su capacidad de reivindicar la pertenencia a través de la participación en procesos sociales de su lugar de origen y arribo promoviendo relaciones menos jerárquicas entre gobierno y sociedad.

  1. Do primary health centres and hospitals contribute equally towards achievement of the transversal clinical competencies of medical students? Performance on the Objective Structured Clinical Examination (OSCE) in competency acquisition.

    Science.gov (United States)

    Soler-González, Jorge; Buti, Miquel; Boada, Jordi; Ayala, Victoria; Peñascal, Eduard; Rodriguez, Toni

    2016-01-01

    The adaptation of the educational programmes of European faculties of medicine to the European Higher Education Area guidelines has focused curricula design on competence acquisition. Competencies are defined as the achievements of a predetermined level of efficacy in real-world scenarios. Our objective was to assess whether performance on a common competence evaluation test, the Objective Structured Clinical Examination (OSCE), resulted in different scores for second-year students after a practical medical training course took place in a primary health centre (PHC) or in a hospital. A descriptive study was conducted during the 2010-2014 academic year of the OSCE test scores obtained by all second-year students. Faculty of Medicine at the University of Lleida (Catalonia, Spain). We performed a correlation analysis between students who completed their practical medical training at the PHC and hospitals utilising Student's t-test for comparison of means. 423 students who completed internships at the PHC and at hospitals obtained OSCE mean scores of 7.32 (SD; IC) (0.82; 7.18-7.47) points and 7.17 (0.83; 6.07-7.26) points, respectively (p=0.07). Second-year medical students acquired similar competency levels in the two analysed training scenarios. The two areas both serve their teaching purpose. Copyright © 2014 Elsevier España, S.L.U. All rights reserved.

  2. G-CLEAN OSC-1809

    Science.gov (United States)

    Technical product bulletin: aka OIL SPILL CLEANUP, this surface washing agent may be applied liberally to heavily weathered oil on rocks or beaches/sand, vegetation, or at full strength on tar balls. Best results if allowed to soak, agitated, or reapplied.

  3. Developments in the photonics program at OSC

    Science.gov (United States)

    Peyghambarian, N.

    2014-10-01

    The photonics program at the College of Optical Sciences started nearly 30 years ago. In 1984, the program was focused on development of femtosecond laser sources and their use in investigating semiconductor carrier dynamics. The program grew into polymer and organic optics in late 1989 and was strengthened by the winning of the CAMP MURI from ONR in 1995 that was focused on multifunctional polymers including photorefractive polymers, organic light emitting diodes and 3D direct laser writing. Also in 1995, the areas of glass waveguide and fiber optic materials and devices were added to the program. In 2008, the optical communication and future internet research was started through winning the CIAN NSF ERC. Expertise in thin films, optical storage and the fundamental aspects of light are elements of the overall research program. Holographic 3D display, autofocus lenses, bio-medical imaging and devices for vision have also been ongoing research areas.

  4. Democratization in Albania: The OSCE, NATO and the European Union

    Science.gov (United States)

    2010-06-01

    html? maca =en-rss-en-all-1573-rdf (accessed 4 March 2010). 263 Manuel Montobbio de Balanzo, Spanish Ambassador to Albania, http://www.dw- world.de/dw...article/0,,5259561,00.html? maca =en-rss-en-all-1573-rdf (accessed 4 March 2010). 264 Reinhard Priebe, The Western Balkan European Perspective, http...world.de/dw/article/0,,5259561,00.html? maca =en-rss-en-all-1573-rdf (accessed 4 March 2010). European Commission Enlargement, Albania – Questions

  5. Bacteriochlorophyll Aggregates Self-Assembled on Functionalized Gold Nanorod Cores as Mimics of Photosynthetic Chlorosomal Antennae: A Single Molecule Study

    Czech Academy of Sciences Publication Activity Database

    Furumaki, S.; Vácha, František; Hirata, S.; Vácha, M.

    2014-01-01

    Roč. 8, č. 3 (2014), s. 2176-2182 ISSN 1936-0851 Institutional support: RVO:60077344 Keywords : Single molecule spectroscopy * molecular aggregate * bacteriochlorophyll * chromosome Subject RIV: BO - Biophysics Impact factor: 12.881, year: 2014

  6. Anisotropic Organization and Microscopic Manipulation of Self-Assembling Synthetic Porphyrin Microrods That Mimic Chlorosomes: Bacterial Light-Harvesting Systems

    Czech Academy of Sciences Publication Activity Database

    Chappaz-Gillot, C.; Marek, P.L.; Blaive, B.J.; Canard, G.; Burck, J.; Hahn, H.; Jávor fi, T.; Kelemen, L.; Krupke, R.; Mossinger, D.; Ormos, P.; Reddy, C.M.; Roussel, C.; Steinbach, G.; Szabo, M.; Ulrich, A.S.; Vanthuyne, V.N.; Vijayaraghavan, A.; Župčanová, Anita; Balaban, T.S.

    2012-01-01

    Roč. 134, č. 2 (2012), s. 944-954 ISSN 0002-7863 Institutional support: RVO:60077344 Keywords : Green photosynthetic bacteria * Bacteriochlorophyll-C * Chlorobium-Tepidum Subject RIV: CE - Biochemistry Impact factor: 10.677, year: 2012

  7. Electronic energy transfer involving carotenoid pigments in chlorosomes of two green bacteria: Chlorobium tepidum and Chloroflexus aurantiacus

    DEFF Research Database (Denmark)

    Melø, T B; Frigaard, N-U; Matsuura, K

    2000-01-01

    S) spectra, recorded at ambient temperature and under non-reducing or reducing conditions, are reported. The carotenoid (Car) pigments in both species transfer their singlet excitation to bacteriochlorophyll c (BChlc) with an efficiency which is high (between 0.5 and 0.8) but smaller than unity; BChlc...

  8. Absorption Linear Dichroism Measured Directly on a Single Light-Harvesting System: The Role of Disorder in Chlorosomes of Green Photosynthetic Bacteria

    Czech Academy of Sciences Publication Activity Database

    Furumaki, S.; Vácha, František; Habuchi, S.; Tsukatani, Y.; Bryant, D.A.; Vácha, M.

    2011-01-01

    Roč. 133, č. 17 (2011), s. 6703-6710 ISSN 0002-7863 R&D Projects: GA ČR GA206/09/0375 Institutional research plan: CEZ:AV0Z50510513 Keywords : CHLOROBIUM-TEPIDUM * BACTERIOCHLOROPHYLL-C * SUPRAMOLECULAR ORGANIZATION Subject RIV: EF - Botanics Impact factor: 9.907, year: 2011

  9. Students’ performance in the different clinical skills assessed in OSCE: what does it reveal?

    Directory of Open Access Journals (Sweden)

    Joong Hiong Sim

    2015-02-01

    Full Text Available Introduction: The purpose of this study was to compare students’ performance in the different clinical skills (CSs assessed in the objective structured clinical examination. Methods: Data for this study were obtained from final year medical students’ exit examination (n=185. Retrospective analysis of data was conducted using SPSS. Means for the six CSs assessed across the 16 stations were computed and compared. Results: Means for history taking, physical examination, communication skills, clinical reasoning skills (CRSs, procedural skills (PSs, and professionalism were 6.25±1.29, 6.39±1.36, 6.34±0.98, 5.86±0.99, 6.59±1.08, and 6.28±1.02, respectively. Repeated measures ANOVA showed there was a significant difference in the means of the six CSs assessed [F(2.980, 548.332=20.253, p<0.001]. Pairwise multiple comparisons revealed significant differences between the means of the eight pairs of CSs assessed, at p<0.05. Conclusions: CRSs appeared to be the weakest while PSs were the strongest, among the six CSs assessed. Students’ unsatisfactory performance in CRS needs to be addressed as CRS is one of the core competencies in medical education and a critical skill to be acquired by medical students before entering the workplace. Despite its challenges, students must learn the skills of clinical reasoning, while clinical teachers should facilitate the clinical reasoning process and guide students’ clinical reasoning development.

  10. Evaluating Neonatal Resuscitation Skills of Nursing and Midwifery Students Using Objective Structured Clinical Examination (OSCE

    Directory of Open Access Journals (Sweden)

    Javad Malekzadeh

    2015-07-01

    Conclusion: The students’ skills in neonatal resuscitation were lower than expected. As competence in this area is of high significance for the improvement of neonatal outcomes, holding training workshops through applying novel training methods is recommended.

  11. Students' performance in the different clinical skills assessed in OSCE: what does it reveal?

    Science.gov (United States)

    Sim, Joong Hiong; Abdul Aziz, Yang Faridah; Mansor, Azura; Vijayananthan, Anushya; Foong, Chan Choong; Vadivelu, Jamuna

    2015-01-01

    The purpose of this study was to compare students' performance in the different clinical skills (CSs) assessed in the objective structured clinical examination. Data for this study were obtained from final year medical students' exit examination (n=185). Retrospective analysis of data was conducted using SPSS. Means for the six CSs assessed across the 16 stations were computed and compared. Means for history taking, physical examination, communication skills, clinical reasoning skills (CRSs), procedural skills (PSs), and professionalism were 6.25±1.29, 6.39±1.36, 6.34±0.98, 5.86±0.99, 6.59±1.08, and 6.28±1.02, respectively. Repeated measures ANOVA showed there was a significant difference in the means of the six CSs assessed [F(2.980, 548.332)=20.253, pskill to be acquired by medical students before entering the workplace. Despite its challenges, students must learn the skills of clinical reasoning, while clinical teachers should facilitate the clinical reasoning process and guide students' clinical reasoning development.

  12. The Influence of First Impressions on Subsequent Ratings within an OSCE Station

    Science.gov (United States)

    Wood, Timothy J.; Chan, James; Humphrey-Murto, Susan; Pugh, Debra; Touchie, Claire

    2017-01-01

    Competency-based assessment is placing increasing emphasis on the direct observation of learners. For this process to produce valid results, it is important that raters provide quality judgments that are accurate. Unfortunately, the quality of these judgments is variable and the roles of factors that influence the accuracy of those judgments are…

  13. 40 CFR 300.145 - Special teams and other assistance available to OSCs/RPMs.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) SUPERFUND, EMERGENCY PLANNING, AND COMMUNITY RIGHT-TO-KNOW PROGRAMS NATIONAL OIL AND HAZARDOUS... environmental chemistry, oil slick tracking, pollutant transport modeling, natural resources at risk.... Thus, responsible parties or other persons attempting to perform such operations without adequate...

  14. i-Assess: Evaluating the impact of electronic data capture for OSCE.

    Science.gov (United States)

    Monteiro, Sandra; Sibbald, Debra; Coetzee, Karen

    2018-04-01

    Tablet-based assessments offer benefits over scannable-paper assessments; however, there is little known about the impact to the variability of assessment scores. Two studies were conducted to evaluate changes in rating technology. Rating modality (paper vs tablets) was manipulated between candidates (Study 1) and within candidates (Study 2). Average scores were analyzed using repeated measures ANOVA, Cronbach's alpha and generalizability theory. Post-hoc analyses included a Rasch analysis and McDonald's omega. Study 1 revealed a main effect of modality (F (1,152) = 25.06, p 0.8) and inter-station reliability remained constant (0.3). Rasch analyses showed no relationship between station difficulty and rating modality. Analyses of average scores may be misleading without an understanding of internal consistency and overall reliability of scores. Although updating to tablet-based forms did not result in systematic variations in scores, routine analyses ensured accurate interpretation of the variability of assessment scores. This study demonstrates the importance of ongoing program evaluation and data analysis.

  15. Ni-CeO2/C Catalysts with Enhanced OSC for the WGS Reaction

    Directory of Open Access Journals (Sweden)

    Laura Pastor-Pérez

    2015-03-01

    Full Text Available In this work, the WGS performance of a conventional Ni/CeO2 bulk catalyst is compared to that of a carbon-supported Ni-CeO2 catalyst. The carbon-supported sample resulted to be much more active than the bulk one. The higher activity of the Ni-CeO2/C catalyst is associated to its oxygen storage capacity, a parameter that strongly influences the WGS behavior. The stability of the carbon-supported catalyst under realistic operation conditions is also a subject of this paper. In summary, our study represents an approach towards a new generation of Ni-ceria based catalyst for the pure hydrogen production via WGS. The dispersion of ceria nanoparticles on an activated carbon support drives to improved catalytic skills with a considerable reduction of the amount of ceria in the catalyst formulation.

  16. Feedback in formative OSCEs: comparison between direct observation and video-based formats

    Science.gov (United States)

    Junod Perron, Noëlle; Louis-Simonet, Martine; Cerutti, Bernard; Pfarrwaller, Eva; Sommer, Johanna; Nendaz, Mathieu

    2016-01-01

    Introduction Medical students at the Faculty of Medicine, University of Geneva, Switzerland, have the opportunity to practice clinical skills with simulated patients during formative sessions in preparation for clerkships. These sessions are given in two formats: 1) direct observation of an encounter followed by verbal feedback (direct feedback) and 2) subsequent review of the videotaped encounter by both student and supervisor (video-based feedback). The aim of the study was to evaluate whether content and process of feedback differed between both formats. Methods In 2013, all second- and third-year medical students and clinical supervisors involved in formative sessions were asked to take part in the study. A sample of audiotaped feedback sessions involving supervisors who gave feedback in both formats were analyzed (content and process of the feedback) using a 21-item feedback scale. Results Forty-eight audiotaped feedback sessions involving 12 supervisors were analyzed (2 direct and 2 video-based sessions per supervisor). When adjusted for the length of feedback, there were significant differences in terms of content and process between both formats; the number of communication skills and clinical reasoning items addressed were higher in the video-based format (11.29 vs. 7.71, p=0.002 and 3.71 vs. 2.04, p=0.010, respectively). Supervisors engaged students more actively during the video-based sessions than during direct feedback sessions (self-assessment: 4.00 vs. 3.17, p=0.007; active problem-solving: 3.92 vs. 3.42, p=0.009). Students made similar observations and tended to consider that the video feedback was more useful for improving some clinical skills. Conclusion Video-based feedback facilitates discussion of clinical reasoning, communication, and professionalism issues while at the same time actively engaging students. Different time and conceptual frameworks may explain observed differences. The choice of feedback format should depend on the educational goal. PMID:27834170

  17. Feedback in formative OSCEs: comparison between direct observation and video-based formats

    Directory of Open Access Journals (Sweden)

    Noëlle Junod Perron

    2016-11-01

    Full Text Available Introduction: Medical students at the Faculty of Medicine, University of Geneva, Switzerland, have the opportunity to practice clinical skills with simulated patients during formative sessions in preparation for clerkships. These sessions are given in two formats: 1 direct observation of an encounter followed by verbal feedback (direct feedback and 2 subsequent review of the videotaped encounter by both student and supervisor (video-based feedback. The aim of the study was to evaluate whether content and process of feedback differed between both formats. Methods: In 2013, all second- and third-year medical students and clinical supervisors involved in formative sessions were asked to take part in the study. A sample of audiotaped feedback sessions involving supervisors who gave feedback in both formats were analyzed (content and process of the feedback using a 21-item feedback scale. Results: Forty-eight audiotaped feedback sessions involving 12 supervisors were analyzed (2 direct and 2 video-based sessions per supervisor. When adjusted for the length of feedback, there were significant differences in terms of content and process between both formats; the number of communication skills and clinical reasoning items addressed were higher in the video-based format (11.29 vs. 7.71, p=0.002 and 3.71 vs. 2.04, p=0.010, respectively. Supervisors engaged students more actively during the video-based sessions than during direct feedback sessions (self-assessment: 4.00 vs. 3.17, p=0.007; active problem-solving: 3.92 vs. 3.42, p=0.009. Students made similar observations and tended to consider that the video feedback was more useful for improving some clinical skills. Conclusion: Video-based feedback facilitates discussion of clinical reasoning, communication, and professionalism issues while at the same time actively engaging students. Different time and conceptual frameworks may explain observed differences. The choice of feedback format should depend on the educational goal.

  18. Spectroscopic properties of a reconstituted light-harvesting complex from the green sulfur bacterium Chlorobium tepidum containing CsmA and bacteriochlorophyll a

    DEFF Research Database (Denmark)

    Pedersen, Marie Østergaard; Pham, Lan; Steensgaard, Dorte Bjerre

    2008-01-01

    chlorosomes were lyophilized and extracted with chloroform/methanol (1:1, v/v). The . Isolated chlorosomes were lyophilized and extracted with chloroform/methanol (1:1, v/v). The extract was further purified using gel filtration and reverse-phase HPLC and the purity of the preparation confirmed by SDS...

  19. Tarsal taste neuron activity and proboscis extension reflex in response to sugars and amino acids in Helicoverpa armigera (Hübner)

    NARCIS (Netherlands)

    Zhang, Y.F.; Loon, van J.J.A.; Wang, C.Z.

    2010-01-01

    In adult female Helicoverpa armigera (Hübner), the fifth tarsomere of the prothoracic legs bears 14 gustatory trichoid chemosensilla. These chemosensilla were characterized through electrophysiological experiments by stimulating with sucrose, glucose, fructose, maltose, myo-inositol and 20 common

  20. Book review of Cristian Nünlist and David Svarin (eds.) Overcoming the East-West Divide: Perspectives on the Role of the OSCE in the Ukraine Crisis

    NARCIS (Netherlands)

    Kraft van Ermel, Nicolaas

    2014-01-01

    In 2014 Europe’s security configuration had to deal with a severe crisis. Events in Ukraine led to a situation of civil war in Ukraine and a further development of the East-West Divide between (Western) Europe and Russia. During 2014 most attention was given to international actors like the North

  1. Eksamen påvirker alment velbefindende

    DEFF Research Database (Denmark)

    Louring-Andersen, Martin; Qazi, Saddiq; Schroeder, Torben V

    2010-01-01

    Objective structured clinical examination (OSCE) is a new and professionally acknowledged examination used in the evaluation of medical students. Students have criticized OSCE for being unnecessarily stressful. This study examines the effects of OSCE on students, examiners and examination...

  2. Isolation and Characterization of Carotenosomes from a Bacteriochlorophyll c-less Mutant of Chlorobium tepidum

    DEFF Research Database (Denmark)

    Frigaard, Niels-Ulrik; Li, Hui; Martinsson, Peter

    2005-01-01

    Chlorosomes are the light-harvesting organelles in photosynthetic green bacteria and typically contain large amounts of bacteriochlorophyll (BChl) c in addition to smaller amounts of BChl a, carotenoids, and several protein species. We have isolated vestigial chlorosomes, denoted carotenosomes......, from a BChl c-less, bchK mutant of the green sulfur bacterium Chlorobium tepidum. The physical shape of the carotenosomes (86 +/- 17 nm x 66 +/- 13 nm x 4.3 +/- 0.8 nm on average) was reminiscent of a flattened chlorosome. The carotenosomes contained carotenoids, BChl a, and the proteins CsmA and Csm...... that the carotenosomes have an intact baseplate made of remarkably stable oligomeric CsmA-BChl a complexes but are flattened in structure due to the absence of BChl c. Carotenosomes thus provide a valuable material for studying the biogenesis, structure, and function of the photosynthetic antennae in green bacteria....

  3. Ultrastructure of antennal sensillae of the samsum ant ...

    African Journals Online (AJOL)

    Jane

    2010-10-11

    Oct 11, 2010 ... subsequently may form the basis in producing its effective control measure in future. ... persons that may deteriorate into serious health condi- tions. ... with the behavioral ecology of ants (Faucheux et al.,. 2006) ... Basiconic type acts as food and CO2 receptor, trichoids ..... Sex pheromone perception in male.

  4. Ultra Morphological Structure of Sensory Sensillae on the Legs and External Genitalia of the Red Palm Weevil Rhynchophorus ferrugineus (Oliv.)

    International Nuclear Information System (INIS)

    Sharaby, Aziz M.; AlDosary, Mona M.

    2007-01-01

    The Red Palm Weevil (RPW) is a major pest infesting date trees in the Gulf region. Chemoreceptors play an important role for insects behaviour in detecting their defined host for feeding, egg laying or mating. The present study is aimed to study morphological structure of sensillae on different legs and external genitalia of both sexes. Three kinds of sensillae are found on the different parts of the three pairs of fore, mid and hind legs, these sensillae are identified as ( Trichoid in three types, coeloconic in two types and one type of Basiconic sensillae). Fore legs bear the highest number of different forms of sensillae, males contained realatively greater number than females. Mid femur only in female bears a dense hair of trichoid sensillae, while they are found on fore- mid and hind femur of males, this may be used for differentiating two sexes. Female ovipositor contained trichoid sensilla can be subdivided into three distinct type1,2, and 3 in addition placoid sensillae, it could be identified four types of trichoid sensilla on the male external genitalia and numerous of placoid sensillae.These may be for hygroreception. (author)

  5. AcEST: DK960831 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |P40798|STC_DROME Protein shuttle craft OS=Drosophila melanoga... 33 1.0 sp|O68988|CSMI_CHLTE Chlorosome pro...++ M LE Sbjct: 101 EAIEDFLCNFLIKMGMTRTLDCFQAEWYELIQKKGSDFKGLGNVPDVYSQVMLLE 155 >sp|P40798|STC_DROME Protein shuttle craft

  6. A reconstituted light-harvesting complex from the green sulfur bacterium Chlorobium tepidum containing CsmA and bacteriochlorophyll a

    DEFF Research Database (Denmark)

    Pedersen, Marie Ø; Pham, Lan; Steensgaard, Dorte B

    2008-01-01

    chlorosomes were lyophilized and extracted with chloroform/methanol (1:1, v/v). The extract was further purified using gel filtration and reverse-phase HPLC and the purity of the preparation confirmed by SDS-PAGE. Mass spectrometric analysis showed an m/z of 6154.8, in agreement with the calculated mass...

  7. Chlorobium Tepidum: Insights into the Structure, Physiology, and Metabolism of a Green Sulfur Bacterium Derived from the Complete Genome Sequence

    DEFF Research Database (Denmark)

    Frigaard, Niels-Ulrik; Chew, Aline Gomez Maqueo; Li, Hui

    2003-01-01

    Green sulfur bacteria are obligate, anaerobic photolithoautotrophs that synthesize unique bacteriochlorophylls (BChls) and a unique light-harvesting antenna structure, the chlorosome. One organism, Chlorobium tepidum, has emerged as a model for this group of bacteria primarily due to its relative...

  8. Computerized systems of NPP operators support. (Psychological problems)

    International Nuclear Information System (INIS)

    Mashin, V.A.

    1995-01-01

    Operator psychological problems arising in the work with NPP operators support computerized systems (OSCS) are considered. The conclusion is made that the OSCS intellectual application will bring the operator into dangerous dependence on his computerized assistant. To avoid this danger it is necessary by creation of the OSCS to divide specially the tasks areas of the operator and OSCS in order to assure the active role of the operator in the NPP control

  9. Linking bonding and bridging ownership social capital in private firms : Moderating effects of ownership-management overlap and family firm identity

    NARCIS (Netherlands)

    Uhlaner, L.M.; Matser, I.; Flören, R.H.; Berent-Braun, M.M.

    2015-01-01

    This study examines the relationship between bonding and bridging ownership social capital (OSC) for a random sample of 679 privately held small and medium-sized firms. Results confirm the positive effects of bonding OSC (quality of relationships and shared vision) on bridging OSC (network

  10. Linking bonding and bridging ownership social capital in private firms : moderating effects of ownership-management overlap and family firm identity

    NARCIS (Netherlands)

    Lorraine M. Uhlaner; Marta M. Berent-Braun; Ilse A. Matser; Roberto H. Flören

    2015-01-01

    This study examines the relationship between bonding and bridging ownership social capital (OSC) for a random sample of 679 privately held small and medium-sized firms. Results confirm the positive effects of bonding OSC (quality of relationships and shared vision) on bridging OSC (network

  11. Recent Advances in Insect Olfaction, Specifically Regarding the Morphology and Sensory Physiology of Antennal Sensilla of the Female Sphinx Moth Manduca sexta

    Science.gov (United States)

    SHIELDS, VONNIE D.C.; HILDEBRAND, JOHN G.

    2008-01-01

    The antennal flagellum of female Manduca sexta bears eight sensillum types: two trichoid, two basiconic, one auriculate, two coeloconic, and one styliform complex sensilla. The first type of trichoid sensillum averages 34 μm in length and is innervated by two sensory cells. The second type averages 26 μm in length and is innervated by either one or three sensory cells. The first type of basiconic sensillum averages 22 μm in length, while the second type averages 15 μm in length. Both types are innervated by three bipolar sensory cells. The auriculate sensillum averages 4 μm in length and is innervated by two bipolar sensory cells. The coeloconic type-A and type-B both average 2 μm in length. The former type is innervated by five bipolar sensory cells, while the latter type, by three bipolar sensory cells. The styliform complex sensillum occurs singly on each annulus and averages 38-40 μm in length. It is formed by several contiguous sensilla. Each unit is innervated by three bipolar sensory cells. A total of 2,216 sensilla were found on a single annulus (annulus 21) of the flagellum. Electrophysiological responses from type-A trichoid sensilla to a large panel of volatile odorants revealed three different subsets of olfactory receptor cells (ORCs). Two subsets responded strongly to only a narrow range of odorants, while the third responded strongly to a broad range of odorants. Anterograde labeling of ORCs from type-A trichoid sensilla revealed that their axons projected mainly to two large female glomeruli of the antennal lobe. PMID:11754510

  12. Erythrotrichopeltis, eine neue Gattung der Erythropeltidaceae (Bangiophyceae, Rhodophyta)

    Science.gov (United States)

    Kornmann, P.

    1984-06-01

    In culture experiments Erythropeltis discigera (Berth.) Schmitz and Erythrotrichia discigera Berth. proved to be heteromorphous stages in the life history of the same entity, incorporated into the new genus Erythrotrichopeltis. There is no obligate alternation of generations, the peltoid and the trichoid phase both propagate asexually by monospores. In addition, the trichoid phase releases spermatia in abundance, while carpogonia cannot be distinguished from vegetative cells. Thus far, the present statements are in full accordance with Berthold's observations, made at Naples more than 100 years ago, which have, however, recently been challenged. Moreover, the cultivation experiments made supplement Berthold's results as to the post fertilization process. A few days after the appearance of spermatia, peltoid plants are met with among the filamentous ones: they obviously originate from carpospores. The transition of the peltoid to the trichoid phase, at first observed accidentally in 3-month old moribund cultures, was reconstructed on more than one occasion by designed experiments. This study was started with discoid plants isolated from crude cultures of sublitoral algae from Helgoland (North Sea). Neither Erythrotrichia discigera Berth. nor Erythropeltis discigera (Berth.) Schmitz were ever found in the field around Helgoland. Recognized by Batters to be identical with Bangia ciliaris Carmichael, the name of the typical representative of the new genus is Erythrotrichopeltis ciliaris (Carm. ex Harv. in Hook.) nov. comb.

  13. Long-term effectiveness of patient-centered training in cultural competence: what is retained? What is lost?

    Science.gov (United States)

    Ho, Ming-Jung; Yao, Grace; Lee, Keng-Lin; Hwang, Tzung-Jeng; Beach, Mary Catherine

    2010-04-01

    To determine whether the effects of a patient-centered cultural competence curriculum could be sustained for one year. In 2006, 57 fifth-year medical students at National Taiwan University were randomly assigned either to a group that received training in patient-centered cross-cultural communication skills or one that received no training. Students' scores on objective structured clinical exams (OSCEs) were compared in the realms of exploring (1) patient perspectives and (2) social factors related to illness, immediately after training (OSCE1) and one year after training (OSCE2). Regarding students' exploration of patient perspectives, the intervention group scored significantly higher than the control group at OSCE1, but there was a significant decrease from OSCE1 to OSCE2 in the intervention group and no significant difference between the intervention and control group at OSCE2. Regarding students' exploration of social factors related to illness, the intervention group scored significantly higher than the control group at OSCE1, with a nonsignificant decrease from OSCE1 to OSCE2 in the two groups, such that the intervention group again scored higher than the control group in OSCE2. The effect of a patient-centered cultural competence training curriculum on students' exploration of social factors related to illness was sustained to a significant degree after one year, whereas the effects on students' exploration of patient perspectives were not. Further research is needed to determine the extent to which additional training can prevent the loss of student skills.

  14. Photosynthetic antennae systems: energy transport and optical absorption

    International Nuclear Information System (INIS)

    Reineker, P.; Supritz, Ch.; Warns, Ch.; Barvik, I.

    2004-01-01

    The energy transport and the optical line shape of molecular aggregates, modeling bacteria photosynthetic light-harvesting systems (chlorosomes in the case of Chlorobium tepidum or Chloroflexus aurantiacus and LH2 in the case of Rhodopseudomonas acidophila) is investigated theoretically. The molecular units are described by two-level systems with an average excitation energy ε and interacting with each other through nearest-neighbor interactions. For LH2 an elliptical deformation of the ring is also allowed. Furthermore, dynamic and in the case of LH2 also quasi-static fluctuations of the local excitation energies are taken into account, simulating fast molecular vibrations and slow motions of the protein backbone, respectively. The fluctuations are described by Gaussian Markov processes in the case of the chlorosomes and by colored dichotomic Markov processes, with exponentially decaying correlation functions, with small (λ s ) and large (λ) decay constants, in the case of LH2

  15. Computational study of short-range interactions in bacteriochlorophyll aggregates

    Czech Academy of Sciences Publication Activity Database

    Alster, J.; Kabeláč, Martin; Tůma, R.; Pšenčík, J.; Burda, J. V.

    2012-01-01

    Roč. 998, SI (2012), s. 87-97 ISSN 2210-271X R&D Projects: GA AV ČR IAA400550808 Grant - others:GA ČR(CZ) GA206/09/0375; GA MŠk(CZ) ME10149 Program:GA Institutional support: RVO:61388963 Keywords : chlorosome * bacteriochlorophyll * molecular simulations Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.139, year: 2012

  16. ITO with embedded silver grids as transparent conductive electrodes for large area organic solar cells

    DEFF Research Database (Denmark)

    Patil, Bhushan Ramesh; Mirsafaei, Mina; Cielecki, Pawel Piotr

    2017-01-01

    In this work, development of semi-transparent electrodes for efficient large area organic solar cells (OSCs) has been demonstrated. Electron beam evaporated silver grids were embedded in commercially available ITO coatings on glass, through a standard negative photolithography process, in order...... patterns. Solution processed bulk heterojunction OSCs based on PTB7:[70]PCBM were fabricated on top of these electrodes with cell areas of 4.38 cm2, and the performance of these OSCs was compared to reference cells fabricated on pure ITO electrodes. The Fill Factor of the large-scale OSCs fabricated on ITO...... with embedded Ag grids was enhanced by 18 % for the line grids pattern and 30 % for the square grids pattern compared to that of the reference OSCs. The increase in the Fill Factor was directly correlated to the decrease in the series resistance of the OSCs. The maximum power conversion efficiency (PCE...

  17. Sequential Objective Structured Clinical Examination based on item response theory in Iran

    Directory of Open Access Journals (Sweden)

    Sara Mortaz Hejri

    2017-09-01

    Full Text Available Purpose In a sequential objective structured clinical examination (OSCE, all students initially take a short screening OSCE. Examinees who pass are excused from further testing, but an additional OSCE is administered to the remaining examinees. Previous investigations of sequential OSCE were based on classical test theory. We aimed to design and evaluate screening OSCEs based on item response theory (IRT. Methods We carried out a retrospective observational study. At each station of a 10-station OSCE, the students’ performance was graded on a Likert-type scale. Since the data were polytomous, the difficulty parameters, discrimination parameters, and students’ ability were calculated using a graded response model. To design several screening OSCEs, we identified the 5 most difficult stations and the 5 most discriminative ones. For each test, 5, 4, or 3 stations were selected. Normal and stringent cut-scores were defined for each test. We compared the results of each of the 12 screening OSCEs to the main OSCE and calculated the positive and negative predictive values (PPV and NPV, as well as the exam cost. Results A total of 253 students (95.1% passed the main OSCE, while 72.6% to 94.4% of examinees passed the screening tests. The PPV values ranged from 0.98 to 1.00, and the NPV values ranged from 0.18 to 0.59. Two tests effectively predicted the results of the main exam, resulting in financial savings of 34% to 40%. Conclusion If stations with the highest IRT-based discrimination values and stringent cut-scores are utilized in the screening test, sequential OSCE can be an efficient and convenient way to conduct an OSCE.

  18. Sequential Objective Structured Clinical Examination based on item response theory in Iran.

    Science.gov (United States)

    Hejri, Sara Mortaz; Jalili, Mohammad

    2017-01-01

    In a sequential objective structured clinical examination (OSCE), all students initially take a short screening OSCE. Examinees who pass are excused from further testing, but an additional OSCE is administered to the remaining examinees. Previous investigations of sequential OSCE were based on classical test theory. We aimed to design and evaluate screening OSCEs based on item response theory (IRT). We carried out a retrospective observational study. At each station of a 10-station OSCE, the students' performance was graded on a Likert-type scale. Since the data were polytomous, the difficulty parameters, discrimination parameters, and students' ability were calculated using a graded response model. To design several screening OSCEs, we identified the 5 most difficult stations and the 5 most discriminative ones. For each test, 5, 4, or 3 stations were selected. Normal and stringent cut-scores were defined for each test. We compared the results of each of the 12 screening OSCEs to the main OSCE and calculated the positive and negative predictive values (PPV and NPV), as well as the exam cost. A total of 253 students (95.1%) passed the main OSCE, while 72.6% to 94.4% of examinees passed the screening tests. The PPV values ranged from 0.98 to 1.00, and the NPV values ranged from 0.18 to 0.59. Two tests effectively predicted the results of the main exam, resulting in financial savings of 34% to 40%. If stations with the highest IRT-based discrimination values and stringent cut-scores are utilized in the screening test, sequential OSCE can be an efficient and convenient way to conduct an OSCE.

  19. Flipping the Objective Structured Clinical Examination: A Teaching Innovation in Graduate Nursing Education.

    Science.gov (United States)

    Day, Cristi; Barker, Connie; Bell, Eva; Sefcik, Elizabeth; Flournoy, Deborah

    Objective evaluation of distance-based family nurse practitioner (FNP) students can be challenging. One FNP program piloted a teaching innovation, the video-enhanced objective structured clinical examination (VE-OSCE) or "flip" of the traditional face-to-face OSCE, to assess student clinical performance in a controlled online environment using a teleconferencing platform. This project sought to assess the VE-OSCE design, implementation, and ability to identify FNP student learning needs.

  20. UP-scaling of inverted small molecule based organic solar cells

    DEFF Research Database (Denmark)

    Patil, Bhushan Ramesh; Madsen, Morten

    Organic solar cells (OSC), in spite of being a promising technology, still face challenges regarding large-scale fabrication. Although efficiencies of up to 12 % has been reached for small molecule OSC, their performance, both in terms of device efficiency and stability, is significantly reduced...... during up-scaling processes. The work presented here is focused on an approach towards up-scaling of small molecule based OSC with inverted device configuration. Bilayer OSC from Tetraphenyldibenzoperiflanthene (DBP) and Fullerenes (C70), as electron donor and acceptor respectively, with cell area...

  1. Anvendelse af video som forberedelse til stationsbaseret eksamen i medicin og kirurgi

    DEFF Research Database (Denmark)

    Subhi, Yousif; Bitsch, Mikael

    2014-01-01

    The objective structured clinical examination (OSCE) is a tool for measuring the dimensions of clinical competences. OSCE differs from traditional oral or written examination and results should not be influenced by lack of knowledge of the testing type. We prepared a video describing the practical...... aspects. On a Likert scale from 1 to 7 our video was rated 4 (interquartile range (IQR): 4-6). An informatory lecture was rated 4 (IQR: 3-5) and a rehearsal OSCE was rated 6 (IQR: 5-7). Video use peaked in the days up to OSCE. Accessibility should be improved by reaching out using the appropriate tools...

  2. Conducting Integrated Objective Structured Clinical Examination: Experiences at KIST Medical College, Nepal

    Directory of Open Access Journals (Sweden)

    Rano Mal Piryani

    2013-01-01

    Full Text Available Background: Objective structured clinical examination (OSCE, an important tool for assessment of clinical skills, introduced more than 4 decades ago. KIST Medical College, a new medical school of Nepal, affiliated to Tribhuvan University Institute of Medicine, has made learning of physical examination skills structured and integrated with greater involvement of different clinical science departments. Students learn physical examination skills in second year MBBS as a part of early clinical exposure. Objective: To share the experiences regarding implementation of integrated OSCE. Materials and Methods: At the end of clinical posting of learning of physical examination skills, assessment was done with OSCE. Fifteen OSCE stations including each of 5 minutes were developed and arranged. Standardized patients and validated checklist were used. OSCE was conducted in novel way. Prior to the OSCE session: Suitable venue was selected, assessors were identified, standardized patients were selected, running order of the stations in circuit was developed, list of equipments/instruments required was prepared, and tasks, checklists, feedback questionnaires were printed. The day before the OSCE session: OSCE stations were inspected and clearly labeled, condition of required equipments/instruments was checked, a pack of the documents for each OSCE station were made available, and signs were displayed at proper places. On the day of the OSCE session: Reliable stop watch and loud manual bell were used, support staffs were placed to direct the candidates, examiners, and standardized patients (SPs, assessors explained SPs, students were briefed, supervisors observed the session, and feedback were taken from students, assessors, and SPs. At the end of the OSCE session: Checklists and feedback questionnaires were collected, token money was paid to SPs, and a contribution of everyone was appreciated. After the OSCE session: Score was compiled and result declared, and

  3. Qualitative content analysis experiences with objective structured clinical examination among Korean nursing students.

    Science.gov (United States)

    Jo, Kae-Hwa; An, Gyeong-Ju

    2014-04-01

    The aim of this study was to explore the experiences of Korean nursing students with an objective structured clinical examination (OSCE) assessment regarding the 12 cranial nerves using qualitative content analysis. Qualitative content analysis was used to explore the subjective experiences of nursing baccalaureate students after taking the OSCE. Convenience sampling was used to select 64 4th year nursing students who were interested in taking the OSCE. The participants learned content about the 12 cranial nerve assessment by lectures, demonstrations, and videos before the OSCE. The OSCE consisted of examinations in each of three stations for 2 days. The participants wrote information about their experiences on sheets of paper immediately after the OSCE anonymously in an adjacent room. The submitted materials were analyzed via qualitative content analysis. The collected materials were classified into two themes and seven categories. One theme was "awareness of inner capabilities", which included three categories: "inner motivation", "inner confidence", and "creativity". The other theme was "barriers to nursing performance", which included four categories: "deficiency of knowledge", "deficiency of communication skill", "deficiency of attitude toward comfort", and "deficiency of repetitive practice". This study revealed that the participants simultaneously experienced the potential and deficiency of their nursing competency after an OSCE session on cranial nerves. OSCE also provided the opportunity for nursing students to realize nursing care in a holistic manner unlike concern that OSCE undermines holism. © 2013 The Authors. Japan Journal of Nursing Science © 2013 Japan Academy of Nursing Science.

  4. One-Stop Clinic Utilization in Plastic Surgery: Our Local Experience and the Results of a UK-Wide National Survey

    Science.gov (United States)

    Gorman, Mark; Coelho, James; Gujral, Sameer; McKay, Alastair

    2015-01-01

    Introduction. “See and treat” one-stop clinics (OSCs) are an advocated NHS initiative to modernise care, reducing cancer treatment waiting times. Little studied in plastic surgery, the existing evidence suggests that though they improve care, they are rarely implemented. We present our experience setting up a plastic surgery OSC for minor skin surgery and survey their use across the UK. Methods. The OSC was evaluated by 18-week wait target compliance, measures of departmental capacity, and patient satisfaction. Data was obtained from 32 of the 47 UK plastic surgery departments to investigate the prevalence of OSCs for minor skin cancer surgery. Results. The OSC improved 18-week waiting times, from a noncompliant mean of 80% to a compliant 95% average. Department capacity increased 15%. 95% of patients were highly satisfied with and preferred the OSC to a conventional service. Only 25% of UK plastic surgery units run OSCs, offering varying reasons for not doing so, 42% having not considered their use. Conclusions. OSCs are underutilised within UK plastic surgery, where a significant proportion of units have not even considered their benefit. This is despite associated improvements in waiting times, department capacity, and levels of high patient satisfaction. We offer our considerations and local experience instituting an OSC service. PMID:26236502

  5. A faster ordered-subset convex algorithm for iterative reconstruction in a rotation-free micro-CT system

    International Nuclear Information System (INIS)

    Quan, E; Lalush, D S

    2009-01-01

    We present a faster iterative reconstruction algorithm based on the ordered-subset convex (OSC) algorithm for transmission CT. The OSC algorithm was modified such that it calculates the normalization term before the iterative process in order to save computational cost. The modified version requires only one backprojection per iteration as compared to two required for the original OSC. We applied the modified OSC (MOSC) algorithm to a rotation-free micro-CT system that we proposed previously, observed its performance, and compared with the OSC algorithm for 3D cone-beam reconstruction. Measurements on the reconstructed images as well as the point spread functions show that MOSC is quite similar to OSC; in noise-resolution trade-off, MOSC is comparable with OSC in a regular-noise situation and it is slightly worse than OSC in an extremely high-noise situation. The timing record shows that MOSC saves 25-30% CPU time, depending on the number of iterations used. We conclude that the MOSC algorithm is more efficient than OSC and provides comparable images.

  6. 5 CFR 1830.6 - Exemptions.

    Science.gov (United States)

    2010-01-01

    ... unfair competitive advantage or diminish the utility of established examination procedures. OSC also... prohibited personnel practice, unlawful political activity, whistleblower disclosure, Uniformed Services...

  7. Ultrastructure of an Olfactory Sensillum on the Leg of Thermal and Gamma Irradiated Cotton Leaf Worm Adult Male

    International Nuclear Information System (INIS)

    Hazaa, M.A.M.; EL DEGWI, M.S.; Alm EL Din, M.M.S.

    2012-01-01

    The Scanning Electron Microscopy (S.E.M.) was used to study the hind legs of Spodoptera littoralis males, and its sensillae. These investigations revealed the presence of seven types of sensillae distributed among the leg; these are trichoid, chaetica, coeloconica, basiconica, styloconica, auricillica and squamiformia. The distribution and structure of these sensillae were described. Thermal treatment with 33 degree C of full grown male pupae and then gamma irradiated with any of the three substerilizing doses (75, 100 and 150 Gy) showed different malformations in the leg sensilla of the first generation. These treatments effect were dose dependant, as it increased with the increase of the dose of irradiation applied.

  8. Measuring Professional Behaviour in Canadian Physical Therapy Students' Objective Structured Clinical Examinations: An Environmental Scan

    Science.gov (United States)

    Ellerton, Cindy; Evans, Cathy

    2015-01-01

    ABSTRACT Purpose: To identify professional behaviours measured in objective structured clinical examinations (OSCEs) by Canadian university physical therapy (PT) programs. Method: A cross-sectional telephone survey was conducted to review current practice and determine which OSCE items Canadian PT programs are using to measure PT students' professional behaviours. Telephone interviews using semi-structured questions were conducted with individual instructors responsible for courses that included an OSCE as part of the assessment component. Results: Nine PT programmes agreed to take part in the study, and all reported conducting at least one OSCE. The number and characteristics of OSCEs varied both within and across programs. Participants identified 31 professional behaviour items for use in an OSCE; these items clustered into four categories: communication (n=14), respect (n=10), patient safety (n=4), and physical therapists' characteristics (n=3). Conclusions: All Canadian entry-level PT programmes surveyed assess professional behaviours in OSCE-type examinations; however, the content and style of assessment is variable. The local environment should be considered when determining what professional behaviours are appropriate to assess in the OSCE context in individual programmes. PMID:25931656

  9. Partners in conflict prevention and peacebuilding

    DEFF Research Database (Denmark)

    Dijkstra, Hylke; Mahr, Ewa; Petrov, Petar

    This report analyses how the EU, UN and OSCE exchange civilian capabilities during crisis missions in Kosovo, Mali and Armenia.......This report analyses how the EU, UN and OSCE exchange civilian capabilities during crisis missions in Kosovo, Mali and Armenia....

  10. Assessment of first-year post-graduate residents: Usefulness of multiple tools

    Directory of Open Access Journals (Sweden)

    Ying-Ying Yang

    2011-12-01

    Conclusion: The strong correlations between 360-degree evaluation and small-scale OSCE+DOPS+IM-ITE®-composited scores suggested that both methods were measuring the same quality. Our results showed that the small-scale OSCE, when associated with both the DOPS and IM-ITE®, could be an important assessment method for PGY1 residents.

  11. Mechanical stability of roll-to-roll printed solar cells under cyclic bending and torsion

    DEFF Research Database (Denmark)

    Finn, Mickey; Martens, Christian James; Zaretski, Aliaksandr V.

    2018-01-01

    The ability of printed organic solar cells (OSCs) to survive repeated mechanical deformation is critical to large-scale implementation. This paper reports an investigation into the mechanical stability of OSCs through bending and torsion testing of whole printed modules. Two types of modules...

  12. Effect of Solvent-Assisted Nanoscaled Organo-Gels on Morphology and Performance of Organic Solar Cells

    DEFF Research Database (Denmark)

    Zuo, Li-Jian; Hu, Xiao-Lian; Ye, Tao

    2012-01-01

    with that of the organo-gels in solution. Through this knowledge, we eventually achieve controlled morphology and optimized organic solar cells (OSCs) performance. Our results present a significant step forward for understanding the self-assembly behavior of conjugated polymers, control of their morphology...... and optimization of OSC performance....

  13. 77 FR 7584 - Draft Guidance for Industry on Heparin for Drug and Medical Device Use; Monitoring Crude Heparin...

    Science.gov (United States)

    2012-02-13

    ... strategies to ensure that the heparin supply chain is not contaminated with OSCS or any non- porcine origin... device manufacturers of finished products, and others to the potential risk of crude heparin...) among patients injected with heparin sodium in 2008, FDA identified the contaminant OSCS in heparin API...

  14. 78 FR 38058 - Guidance for Industry on Heparin for Drug and Medical Device Use: Monitoring Crude Heparin for...

    Science.gov (United States)

    2013-06-25

    ... public health. FDA developed this guidance to alert manufacturers to the risks of crude heparin contaminants and to recommend strategies to ensure that the heparin supply chain is not contaminated with OSCS... heparin sodium in 2008, FDA identified the contaminant OSCS in crude heparin sourced from China. FDA is...

  15. Implementation of an Electronic Objective Structured Clinical Exam for Assessing Practical Skills in Pre-Professional Physiotherapy and Occupational Therapy Programs: Examiner and Course Coordinator Perspectives

    Science.gov (United States)

    Snodgrass, Suzanne J.; Ashby, Samantha E.; Rivett, Darren A.; Russell, Trevor

    2014-01-01

    Assessment of practical clinical skills is essential in the health fields. Objective Structured Clinical Exams (OSCEs), where examiners assess students performing clinical procedures on simulated patients (actors), are central to the evaluation of practical skills. However, traditional OSCEs require considerable time-investment to administer, and…

  16. Students' perceptions regarding the objective, structured, clinical ...

    African Journals Online (AJOL)

    2013-04-18

    Apr 18, 2013 ... of objective structured clinical evaluation (OSCE) for that purpose is ... This questionnaire focused on the perceptions of student nurses with ... to be assessed, the School of Nursing and Public Health at ... a scale ranging between 1 and 5 was used, with the ratings ..... should compile an OSCE guideline.

  17. Use of Video-Projected Structured Clinical Examination (ViPSCE) instead of the traditional oral (Viva) examination in the assessment of final year medical students.

    Science.gov (United States)

    El Shallaly, Gamal; Ali, Eltayeb

    2004-03-01

    Assessment of medical students using the traditional oral (viva) system has been marred by being highly subjective, non-structured, and biased. The use of the objective structured clinical examination (OSCE) would circumvent these disadvantages. The OSCE is, however, costly and time-consuming particularly if used for assessment of large numbers of students. The need for another form of examination that enjoys the advantages of the OSCE while avoiding its disadvantages in the face of limited resources has been the inspiration behind this innovative approach. (1) To identify the characteristics of the new Video-Projected Structured Clinical Examination (ViPSCE). (2) To compare the acceptability of ViPSCE and OSCE by students and tutors. (3) To compare the time-effectiveness of ViPSCE and OSCE. We used a slide video projection to assess the surgical knowledge, problem solving and management abilities of 112 final year medical students at Alazhari University, Khartoum, Sudan. Students completed evaluation forms at the end of the examination. The administration of the ViPSCE was smooth and straightforward. Feedback of the students showed that they preferred the ViPSCE to both traditional oral (viva) examination and OSCE. The examination time was 2 hours using video projection compared to the 6 hours that it used to take a class of 112 students to complete a classical OSCE. The ViPSCE is a better replacement for the traditional oral exam. It is much less time- consuming than traditional OSCE.

  18. Origin of organic sulphur compounds and sulphur-containing high molecular weight substances in sediments and immature crude oils

    NARCIS (Netherlands)

    Sinninghe Damsté, J.S.; Rijpstra, W.I.C.; Leeuw, J.W. de; Schenck, P.A.

    1988-01-01

    The distribution patterns of Organic Sulphur Compounds (OSC), occurring in certain sediments and immature crude oils, were compared with those of the corresponding hydrocarbons. Because of the complexity of the OSC mixtures, they were desulphurized to hydrocarbons (n-alkanes, isoprenoid alkanes,

  19. Ballistic Missile Defense Glossary Version 3.0.

    Science.gov (United States)

    1997-06-01

    of time. (Excludes time for off- system maintenance and repair of detached components.) Malaysia East Asia Satellite. The quantitative expression...Message Organic Ornate Impact ORNL ORTA ORU ORWG OS OSA OSC OSCE OSD OSE OSEIT OSF OSH OSHA OSI OSIA OSIM OSIP OSIWG OSJTF OSM

  20. ITO with embedded silver grids as transparent conductive electrodes for large area organic solar cells

    Science.gov (United States)

    Patil, Bhushan R.; Mirsafaei, Mina; Piotr Cielecki, Paweł; Fernandes Cauduro, André Luis; Fiutowski, Jacek; Rubahn, Horst-Günter; Madsen, Morten

    2017-10-01

    In this work, development of semi-transparent electrodes for efficient large area organic solar cells (OSCs) has been demonstrated. Electron beam evaporated silver grids were embedded in commercially available ITO coatings on glass, through a standard negative photolithography process, in order to improve the conductivity of planar ITO substrates. The fabricated electrodes with embedded line and square patterned Ag grids reduced the sheet resistance of ITO by 25% and 40%, respectively, showing optical transmittance drops of less than 6% within the complete visible light spectrum for both patterns. Solution processed bulk heterojunction OSCs based on PTB7:[70]PCBM were fabricated on top of these electrodes with cell areas of 4.38 cm2, and the performance of these OSCs was compared to reference cells fabricated on pure ITO electrodes. The Fill Factor (FF) of the large-scale OSCs fabricated on ITO with embedded Ag grids was enhanced by 18% for the line grids pattern and 30% for the square grids pattern compared to that of the reference OSCs. The increase in the FF was directly correlated to the decrease in the series resistance of the OSCs. The maximum power conversion efficiency (PCE) of the OSCs was measured to be 4.34%, which is 23% higher than the PCE of the reference OSCs. As the presented method does not involve high temperature processing, it could be considered a general approach for development of large area organic electronics on solvent resistant, flexible substrates.

  1. 32 CFR 516.71 - Duties.

    Science.gov (United States)

    2010-07-01

    ...-record, the Chief, DAJA-LE, will file necessary pleadings and make necessary appearances before the MSPB... appropriate DA personnel are fully apprised of their rights, duties and the nature and basis for an OSC... military members. (7) Ensure that personnel involved are advised of the nature and basis for an OSC...

  2. Vertical Phase Separation in Small Molecule:Polymer Blend Organic Thin Film Transistors Can Be Dynamically Controlled

    KAUST Repository

    Zhao, Kui

    2016-02-03

    © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim. Blending of small-molecule organic semiconductors (OSCs) with amorphous polymers is known to yield high performance organic thin film transistors (OTFTs). Vertical stratification of the OSC and polymer binder into well-defined layers is crucial in such systems and their vertical order determines whether the coating is compatible with a top and/or a bottom gate OTFT configuration. Here, we investigate the formation of blends prepared via spin-coating in conditions which yield bilayer and trilayer stratifications. We use a combination of in situ experimental and computational tools to study the competing effects of formulation thermodynamics and process kinetics in mediating the final vertical stratification. It is shown that trilayer stratification (OSC/polymer/OSC) is the thermodynamically favored configuration and that formation of the buried OSC layer can be kinetically inhibited in certain conditions of spin-coating, resulting in a bilayer stack instead. The analysis reveals here that preferential loss of the OSC, combined with early aggregation of the polymer phase due to rapid drying, inhibit the formation of the buried OSC layer. The fluid dynamics and drying kinetics are then moderated during spin-coating to promote trilayer stratification with a high quality buried OSC layer which yields unusually high mobility >2 cm2 V-1 s-1 in the bottom-gate top-contact configuration.

  3. Orwellian risks in European conflict prevention discourse

    NARCIS (Netherlands)

    de Wilde, J.H.

    2006-01-01

    Conflict prevention has been the nomenclature of a non-military type of security policy, but that is changing. During the Cold War, the OSCE was a forum for conflict prevention at an interstate level. After the Cold War, OSCE conflict prevention turned to domestic affairs, comparable to NGO

  4. Sensitive detection of oversulfated chondroitin sulfate in heparin sodium or crude heparin with a colorimetric microplate based assay.

    Science.gov (United States)

    Sommers, Cynthia D; Mans, Daniel J; Mecker, Laura C; Keire, David A

    2011-05-01

    In this work we describe a 96-well microplate assay for oversulfated chondroitin sulfate A (OSCS) in heparin, based on a water-soluble cationic polythiophene polymer (3-(2-(N-(N'-methylimidazole))ethoxy)-4-methylthiophene (LPTP)) and heparinase digestion of heparin. The assay takes advantage of several unique properties of heparin, OSCS, and LPTP, including OSCS inhibition of heparinase I and II activity, the molecular weight dependence of heparin-LPTP spectral shifts, and the distinct association of heparin fragments and OSCS to LPTP. These factors combine to enable detection of the presence of 0.003% w/w spiked OSCS in 10 μg of heparin sodium active pharmaceutical ingredient (API) using a plate reader and with visual detection to 0.1% levels. The same detection limit for OSCS was observed in the presence of 10% levels of dermatan sulfate (DS) or chondroitin sulfate A (CSA) impurities. In addition, we surveyed a selection of crude heparin samples received by the agency in 2008 and 2009 to determine average and extreme DS, CSA, and galactosamine weight percent levels. In the presence of these impurities and the variable heparin content in the crude heparin samples, spiked OSCS was reliably detected to the 0.1% w/w level using a plate reader. Finally, authentically OSCS contaminated heparin sodium API and crude samples were distinguished visually by color from control samples using the LPTP/heparinase test.

  5. Anvendelse af video som forberedelse til stationsbaseret eksamen i medicin og kirurgi

    DEFF Research Database (Denmark)

    Subhi, Yousif; Bitsch, Mikael

    2014-01-01

    aspects. On a Likert scale from 1 to 7 our video was rated 4 (interquartile range (IQR): 4-6). An informatory lecture was rated 4 (IQR: 3-5) and a rehearsal OSCE was rated 6 (IQR: 5-7). Video use peaked in the days up to OSCE. Accessibility should be improved by reaching out using the appropriate tools...

  6. Assessment of first-year post-graduate residents: usefulness of multiple tools.

    Science.gov (United States)

    Yang, Ying-Ying; Lee, Fa-Yauh; Hsu, Hui-Chi; Huang, Chin-Chou; Chen, Jaw-Wen; Cheng, Hao-Min; Lee, Wen-Shin; Chuang, Chiao-Lin; Chang, Ching-Chih; Huang, Chia-Chang

    2011-12-01

    Objective Structural Clinical Examination (OSCE) usually needs a large number of stations with long test time, which usually exceeds the resources available in a medical center. We aimed to determine the reliability of a combination of Direct Observation of Procedural Skills (DOPS), Internal Medicine in-Training Examination (IM-ITE(®)) and OSCE, and to verify the correlation between the small-scale OSCE+DOPS+IM-ITE(®)-composited scores and 360-degree evaluation scores of first year post-graduate (PGY(1)) residents. Between 2007 January to 2010 January, two hundred and nine internal medicine PGY1 residents completed DOPS, IM-ITE(®) and small-scale OSCE at our hospital. Faculty members completed 12-item 360-degree evaluation for each of the PGY(1) residents regularly. The small-scale OSCE scores correlated well with the 360-degree evaluation scores (r = 0.37, p ITE(®) score with small-scale OSCE+DOPS scores [small-scale OSCE+DOPS+IM-ITE(®)-composited scores] markedly enhanced their correlation with 360-degree evaluation scores (r = 0.85, p ITE(®)-composited scores suggested that both methods were measuring the same quality. Our results showed that the small-scale OSCE, when associated with both the DOPS and IM-ITE(®), could be an important assessment method for PGY(1) residents. Copyright © 2011. Published by Elsevier B.V.

  7. Relational Coordination and Organisational Social Capital Association with Characteristics of General Practice

    DEFF Research Database (Denmark)

    Lundstrøm, Sanne Lykke; Edwards, Kasper; Bøllingtoft Knudsen, Thomas

    2014-01-01

    Background. Relational coordination (RC) and organisational social capital (OSC) aremeasures of novel aspects of an organisation’s performance, which have not previously been analysed together, in general practice. Objectives.The aim of this studywas to analyse the associations between RC and OSC......, and characteristics of general practice. Methods. Questionnaire survey study comprising 2074 practices in Denmark. Results. General practitioners (GPs) rated both RC and OSC in their general practice higher than their secretaries and nurses. The practice form was statistically significantly associated with high RC...... and OSC. RC was positively associated with the number of patients listed with a practice per staff, where staff is defined as all members of a practice including both owners and employees. Conclusion. The study showed that RC and OSC were significantly associated with type of profession and practice type...

  8. Process evaluation of the parental component in the Boost study - a school-randomized trial targeting fruit and vegetable intake among Danish adolescents

    DEFF Research Database (Denmark)

    Jørgensen, Sanne Ellegaard; Jørgensen, Thea Suldrup; Aarestrup, Anne Kristine

    . Dose received: if parents had seen and read the newsletters. Appreciation: perceived usefulness of newsletters. Reach: dose received stratified by gender and parental occupational social class (OSC). Results: Questionnaires were completed by parents of 58.7% of the students (N=658) and by teachers...... at 18 out of 20 intervention schools. Dose delivered: 11 teachers (61.1%) uploaded all newsletters. Dose received: 65.5% of the parents had seen the newsletters; 49.2% had read at least one. Appreciation: 39.2% found the newsletters useful. Reach by OSC and gender: Among parents, 56.1% of high OSC, 46.......8% of medium OSC, and 40.0% of low OSC had read at least one newsletter; 30.6% of mothers and 18.0% of fathers had read at least one newsletter. Conclusions: Parental involvement was challenged by the fact that all newsletters were not uploaded. Newsletters were read by only half of the parents, especially...

  9. Roll-coating fabrication of flexible organic solar cells: comparison of fullerene and fullerene-free systems

    DEFF Research Database (Denmark)

    Liu, Kuan; Larsen-Olsen, Thue Trofod; Lin, Yuze

    2016-01-01

    Flexible organic solar cells (OSCs) based on a blend of low-bandgap polymer donor PTB7-TH and nonfullerene small molecule acceptor IEIC were fabricated via a roll-coating process under ambient atmosphere. Both an indium tin oxide (ITO)-free substrate and a flexible ITO substrate were employed...... in these inverted OSCs. OSCs with flexible ITO and ITO-free substrates exhibited power conversion efficiencies (PCEs) up to 2.26% and 1.79%, respectively, which were comparable to those of the reference devices based on fullerene acceptors under the same conditions. This is the first example for all roll......-coating fabrication procedures for flexible OSCs based on non-fullerene acceptors with the PCE exceeding 2%. The fullerene-free OSCs exhibited better dark storage stability than the fullerene-based control devices....

  10. Student assessment by objective structured examination in a neurology clerkship

    Science.gov (United States)

    Adesoye, Taiwo; Smith, Sandy; Blood, Angela; Brorson, James R.

    2012-01-01

    Objectives: We evaluated the reliability and predictive ability of an objective structured clinical examination (OSCE) in the assessment of medical students at the completion of a neurology clerkship. Methods: We analyzed data from 195 third-year medical students who took the OSCE. For each student, the OSCE consisted of 2 standardized patient encounters. The scores obtained from each encounter were compared. Faculty clinical evaluations of each student for 2 clinical inpatient rotations were also compared. Hierarchical regression analysis was applied to test the ability of the averaged OSCE scores to predict standardized written examination scores and composite clinical scores. Results: Students' OSCE scores from the 2 standardized patient encounters were significantly correlated with each other (r = 0.347, p neurology clerkship. PMID:22855865

  11. Triplet Tellurophene-Based Acceptors for Organic Solar Cells.

    Science.gov (United States)

    Yang, Lei; Gu, Wenxing; Lv, Lei; Chen, Yusheng; Yang, Yufei; Ye, Pan; Wu, Jianfei; Hong, Ling; Peng, Aidong; Huang, Hui

    2018-01-22

    Triplet materials have been employed to achieve high-performing organic solar cells (OSCs) by extending the exciton lifetime and diffusion distances, while the triplet non-fullerene acceptor materials have never been reported for bulk heterojunction OSCs. Herein, for the first time, three triplet molecular acceptors based on tellurophene with different degrees of ring fusing were designed and synthesized for OSCs. Significantly, these molecules have long exciton lifetime and diffusion lengths, leading to efficient power conversion efficiency (7.52 %), which is the highest value for tellurophene-based OSCs. The influence of the extent of ring fusing on molecular geometry and OSCs performance was investigated to show the power conversion efficiencies (PCEs) continuously increased along with increasing the extent of ring fusing. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  12. Influences of semiconductor morphology on the mechanical fatigue behavior of flexible organic electronics

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Young-Joo; Yeon, Han-Wool; Shin, Hae-A-Seul; Joo, Young-Chang, E-mail: ycjoo@snu.ac.kr [Department of Materials Science and Engineering, Seoul National University, 151-744 Seoul (Korea, Republic of); Uk Lee, Yong; Evans, Louise A. [Center for Process Innovation Limited, Thomas Wright Way, NETPark, Sedgefield, TS21 3FG County Durham (United Kingdom)

    2013-12-09

    The influence of crystalline morphology on the mechanical fatigue of organic semiconductors (OSCs) was investigated using 6,13-bis(triisopropylsilylethynyl)pentacene (TIPS-pentacene) as a crystalline OSC and poly(triarylamine) (PTAA) as an amorphous OSC. During cyclic bending, resistances of the OSCs were monitored using the transmission-line method on a metal-semiconductor-metal structure. The resistance of the TIPS-pentacene increased under fatigue damage in tensile-stress mode, but no such degradation was observed in the PTAA. Both OSCs were stable under compressive bending fatigue. The formation of intergranular cracks at the domain boundaries of the TIPS-pentacene was responsible for the degradation of its electrical properties under tensile bending fatigue.

  13. Computer assisted Objective structured clinical examination versus Objective structured clinical examination in assessment of Dermatology undergraduate students.

    Science.gov (United States)

    Chaudhary, Richa; Grover, Chander; Bhattacharya, S N; Sharma, Arun

    2017-01-01

    The assessment of dermatology undergraduates is being done through computer assisted objective structured clinical examination at our institution for the last 4 years. We attempted to compare objective structured clinical examination (OSCE) and computer assisted objective structured clinical examination (CA-OSCE) as assessment tools. To assess the relative effectiveness of CA-OSCE and OSCE as assessment tools for undergraduate dermatology trainees. Students underwent CA-OSCE as well as OSCE-based evaluation of equal weightage as an end of posting assessment. The attendance as well as the marks in both the examination formats were meticulously recorded and statistically analyzed using SPSS version 20.0. Intercooled Stata V9.0 was used to assess the reliability and internal consistency of the examinations conducted. Feedback from both students and examiners was also recorded. The mean attendance for the study group was 77% ± 12.0%. The average score on CA- OSCE and OSCE was 47.4% ± 19.8% and 53.5% ± 18%, respectively. These scores showed a mutually positive correlation, with Spearman's coefficient being 0.593. Spearman's rank correlation coefficient between attendance scores and assessment score was 0.485 for OSCE and 0.451 for CA-OSCE. The Cronbach's alpha coefficient for all the tests ranged from 0.76 to 0.87 indicating high reliability. The comparison was based on a single batch of 139 students. Such an evaluation on more students in larger number of batches over successive years could help throw more light on the subject. Computer assisted objective structured clinical examination was found to be a valid, reliable and effective format for dermatology assessment, being rated as the preferred format by examiners.

  14. Use of online clinical videos for clinical skills training for medical students: benefits and challenges.

    Science.gov (United States)

    Jang, Hye Won; Kim, Kyong-Jee

    2014-03-21

    Multimedia learning has been shown effective in clinical skills training. Yet, use of technology presents both opportunities and challenges to learners. The present study investigated student use and perceptions of online clinical videos for learning clinical skills and in preparing for OSCE (Objective Structured Clinical Examination). This study aims to inform us how to make more effective us of these resources. A mixed-methods study was conducted for this study. A 30-items questionnaire was administered to investigate student use and perceptions of OSCE videos. Year 3 and 4 students from 34 Korean medical schools who had access to OSCE videos participated in the online survey. Additionally, a semi-structured interview of a group of Year 3 medical students was conducted for an in-depth understanding of student experience with OSCE videos. 411 students from 31 medical schools returned the questionnaires; a majority of them found OSCE videos effective for their learning of clinical skills and in preparing for OSCE. The number of OSCE videos that the students viewed was moderately associated with their self-efficacy and preparedness for OSCE (p mobile devices; they agreed more with the statement that it was convenient to access the video clips than their peers who accessed the videos using computers (p students reported lack of integration into the curriculum and lack of interaction as barriers to more effective use of OSCE videos. The present study confirms the overall positive impact of OSCE videos on student learning of clinical skills. Having faculty integrate these learning resources into their teaching, integrating interactive tools into this e-learning environment to foster interactions, and using mobile devices for convenient access are recommended to help students make more effective use of these resources.

  15. Size variability of the unit building block of peripheral light-harvesting antennas as a strategy for effective functioning of antennas of variable size that is controlled in vivo by light intensity.

    Science.gov (United States)

    Taisova, A S; Yakovlev, A G; Fetisova, Z G

    2014-03-01

    This work continuous a series of studies devoted to discovering principles of organization of natural antennas in photosynthetic microorganisms that generate in vivo large and highly effective light-harvesting structures. The largest antenna is observed in green photosynthesizing bacteria, which are able to grow over a wide range of light intensities and adapt to low intensities by increasing of size of peripheral BChl c/d/e antenna. However, increasing antenna size must inevitably cause structural changes needed to maintain high efficiency of its functioning. Our model calculations have demonstrated that aggregation of the light-harvesting antenna pigments represents one of the universal structural factors that optimize functioning of any antenna and manage antenna efficiency. If the degree of aggregation of antenna pigments is a variable parameter, then efficiency of the antenna increases with increasing size of a single aggregate of the antenna. This means that change in degree of pigment aggregation controlled by light-harvesting antenna size is biologically expedient. We showed in our previous work on the oligomeric chlorosomal BChl c superantenna of green bacteria of the Chloroflexaceae family that this principle of optimization of variable antenna structure, whose size is controlled by light intensity during growth of bacteria, is actually realized in vivo. Studies of this phenomenon are continued in the present work, expanding the number of studied biological materials and investigating optical linear and nonlinear spectra of chlorosomes having different structures. We show for oligomeric chlorosomal superantennas of green bacteria (from two different families, Chloroflexaceae and Oscillochloridaceae) that a single BChl c aggregate is of small size, and the degree of BChl c aggregation is a variable parameter, which is controlled by the size of the entire BChl c superantenna, and the latter, in turn, is controlled by light intensity in the course of cell

  16. A candidate pheromone receptor and two odorant receptors of the hawkmoth Manduca sexta.

    Science.gov (United States)

    Patch, Harland M; Velarde, Rodrigo A; Walden, Kimberly K O; Robertson, Hugh M

    2009-05-01

    In this study, we cloned and characterized three Manduca sexta odorant receptors (ORs). One receptor is a putative pheromone receptor expressed exclusively in a cell associated with male-specific type-I trichoid sensilla. We describe the results of real-time PCR (RT-PCR) and quantitative real-time PCR (qRT-PCR) experiments that show MsextaOR1 is expressed only in male antennae. In situ hybridization labels a single cell associated with type-1 trichoid sensilla, which houses two neurons that have been previously determined to respond to the major components of the pheromone blend. The second receptor, MsextaOR2, was discovered using degenerate primers designed to conserved motifs of a unique group ORs that share as much as 88% identity. Comparison of RT-PCR, qRT-PCR, and in situ hybridization results with those of ORs in the Drosophila melanogaster Or83b subfamily shows a strong sequence and expression pattern similarity. The third receptor, MsextaOR3, was found by 5'-end sequencing of a normalized and subtracted cDNA library from male M. sexta antennae. RT-PCR and qRT-PCR show that this receptor is expressed only in male and female antennae. These are the first ORs, including a putative pheromone receptor, to be described from M. sexta.

  17. Male antenna morphology and its effect on scramble competition in false garden mantids

    Science.gov (United States)

    Jayaweera, Anuradhi; Barry, Katherine L.

    2017-10-01

    Well-developed antennae are crucial for many insects, but especially for scramble competitors, who race to find their mates using female sex cues. In these systems, the ability of males to locate females quickly is thought to be under strong selection. A rarely tested assumption is that males with more sensory structures are able to locate females faster. In the present study, we used the false garden mantid Pseudomantis albofimbriata to investigate male antennal morphology and its effect on male efficiency in finding a mate. We used scanning electron microscopy to describe the major sensilla types and their arrangement along the length of male antennae. We also conducted field enclosure trials relating male antennal morphology to scramble competition in this system. We identified six different types of antennal sensilla (cheatic, trichoid, basiconic, grooved peg, ceolocapitular and campaniform) on male P. albofimbriata antennae. As expected, males who had more trichoid sensilla located females quicker than did males with fewer sensilla. Results of the current study suggest that antenna morphology plays a significant role in mate location and hence scramble competition in the P. albofimbriata mating system.

  18. Chlorobium tepidum mutant lacking bacteriochlorophyll c made by inactivation of the bchK gene, encoding bacteriochlorophyll c synthase

    DEFF Research Database (Denmark)

    Frigaard, Niels-Ulrik; Voigt, Ginny D; Bryant, Donald A

    2002-01-01

    of the BChl c antenna, the mutant grew about seven times slower than the wild type at light intensities that were limiting to the wild type (... found in the wild type, the bchK mutant should prove valuable for future analyses of the photosynthetic reaction center and of the roles of BChl a in photosynthesis in green bacteria. An evolutionary implication of our findings is that the photosynthetic ancestor of green sulfur bacteria could have...... evolved without chlorosomes and BChl c and instead used only BChl a-containing proteins as the major light-harvesting antennae....

  19. Computation studies into architecture and energy transfer properties of photosynthetic units from filamentous anoxygenic phototrophs

    Energy Technology Data Exchange (ETDEWEB)

    Linnanto, Juha Matti [Institute of Physics, University of Tartu, Riia 142, 51014 Tartu (Estonia); Freiberg, Arvi [Institute of Physics, University of Tartu, Riia 142, 51014 Tartu, Estonia and Institute of Molecular and Cell Biology, University of Tartu, Riia 23, 51010 Tartu (Estonia)

    2014-10-06

    We have used different computational methods to study structural architecture, and light-harvesting and energy transfer properties of the photosynthetic unit of filamentous anoxygenic phototrophs. Due to the huge number of atoms in the photosynthetic unit, a combination of atomistic and coarse methods was used for electronic structure calculations. The calculations reveal that the light energy absorbed by the peripheral chlorosome antenna complex transfers efficiently via the baseplate and the core B808–866 antenna complexes to the reaction center complex, in general agreement with the present understanding of this complex system.

  20. Saudi Internal Medicine Residents׳ Perceptions of the Objective Structured Clinical Examination as a Formative Assessment Tool

    Directory of Open Access Journals (Sweden)

    Salwa Alaidarous

    2016-12-01

    Full Text Available The Saudi Commission for Health Specialties first implemented the Objective Structured Clinical Examinations (OSCE as part of the final year Internal Medicine clerkship exam during the 2007–2008 academic year. This study evaluated Internal Medicine residents׳ overall perceptions of the OSCE as a formative assessment tool. It focused on residents׳ perceptions of the OSCE stations׳ attributes, determined the acceptability of the process, and provided feedback to enhance further development of the assessment tool. The main objective was to assess Internal Medicine resident test-takers׳ perceptions and acceptance of the OSCE, and to identify its strengths and weaknesses through their feedback. Sixty six residents were involved in the studied administered on November 8th 2012 at King Abdulaziz University Hospital in Jeddah, Kingdom of Saudi Arabia. Overall, resident׳s evaluation of the OSCE was favorable and encouraging. To this end, we recommend that formative assessment opportunities using the OSCE for providing feedback to students should be included in the curriculum, and continuing refinement and localized adaptation of OSCEs in use should be pursued by course directors and assessment personnel.

  1. Reliability and Validity of Objective Structured Clinical Examination for Residents of Obstetrics and Gynecology at Kermanshah University of Medical Sciences

    Directory of Open Access Journals (Sweden)

    Nasrin Jalilian

    2012-11-01

    Full Text Available Introduction: Objective structured clinical examination (OSCE is used for the evaluation of the clinical competence in medicine for which it is essential to measure validity and reliability. This study aimed to investigate the validity and reliability of OSCE for residents of obstetrics and gynecology at Kermanshah University of Medical Sciences in 2011.Methods: A descriptive-correlation study was designed and the data of OSCE for obstetrics and gynecology were collected via learning behavior checklists in method stations and multiple choice questions in question stations. The data were analyzed through Pearson correlation coefficient and Cronbach's alpha, using SPSS software (version 16. To determine the criterion validity, correlation of OSCE scores with scores of resident promotion test, direct observation of procedural skills, and theoretical knowledge was determined; for reliability, however, Cronbach's alpha was used. Total sample consisted of 25 participants taking part in 14 stations. P value of less than 0.05 was considered as significant.Results: The mean OSCE scores was 22.66 (±6.85. Criterion validity of the stations with resident promotion theoretical test, first theoretical knowledge test, second theoretical knowledge, and direct observation of procedural skills (DOPS was 0.97, 0.74, 0.49, and 0.79, respectively. In question stations, criterion validity was 0.15, and total validity of OSCE was 0.77.Conclusion: Findings of the present study indicated acceptable validity and reliability of OSCE for residents of obstetrics and gynecology.

  2. Assessment of current undergraduate anesthesia course in a Saudi University.

    Science.gov (United States)

    Shams, Tarek; El-Masry, Ragaa; Al Wadani, Hamed; Amr, Mostafa

    2013-04-01

    The assessment of the anesthesia course in our university comprises Objective Structured Clinical Examinations (OSCEs), in conjunction with portfolio and multiple-choice questions (MCQ). The objective of this study was to evaluate the outcome of different forms of anesthesia course assessment among 5(th) year medical students in our university, as well as study the influence of gender on student performance in anesthesia. We examined the performance of 154, 5(th) year medical students through OSCE, portfolios, and MCQ. The score ranges in the portfolio, OSCE, and MCQs were 16-24, 4.2-28.9, and 15.5-44.5, respectively. There was highly significant difference in scores in relation to gender in all assessments other than the written one (P=0.000 for Portfolio, OSCE, and Total exam, whereas P=0.164 for written exam). In the generated linear regression model, OSCE alone could predict 86.4% of the total mark if used alone. In addition, if the score of the written examination is added, OSCE will drop to 57.2% and the written exam will be 56.8% of the total mark. This study demonstrates that different clinical methods used to assess medical students during their anesthesia course were consistent and integrated. The performance of female was superior to male in OSCE and portfolio. This information is the basis for improving educational and assessment standards in anesthesiology and for introducing a platform for developing modern learning media in countries with dearth of anesthesia personnel.

  3. Hot kinetic model as a guide to improve organic photovoltaic materials.

    Science.gov (United States)

    Sosorev, Andrey Yu; Godovsky, Dmitry Yu; Paraschuk, Dmitry Yu

    2018-01-31

    The modeling of organic solar cells (OSCs) can provide a roadmap for their further improvement. Many OSC models have been proposed in recent years; however, the impact of the key intermediates from photons to electricity-hot charge-transfer (CT) states-on the OSC efficiency is highly ambiguous. In this study, we suggest an analytical kinetic model for OSC that considers a two-step charge generation via hot CT states. This hot kinetic model allowed us to evaluate the impact of different material parameters on the OSC performance: the driving force for charge separation, optical bandgap, charge mobility, geminate recombination rate, thermalization rate, average electron-hole separation distance in the CT state, dielectric permittivity, reorganization energy and charge delocalization. In contrast to a widespread trend of lowering the material bandgap, the model predicts that this approach is only efficient along with improvement of the other material properties. The most promising ways to increase the OSC performance are decreasing the reorganization energy, i.e., an energy change accompanying CT from the donor molecule to the acceptor, increasing the dielectric permittivity and charge delocalization. The model suggests that there are no fundamental limitations that can prevent achieving the OSC efficiency above 20%.

  4. Bioinformatics analysis of the oxidosqualene cyclase gene and the amino acid sequence in mangrove plants

    Science.gov (United States)

    Basyuni, M.; Wati, R.

    2017-01-01

    This study described the bioinformatics methods to analyze seven oxidosqualene cyclase (OSC) genes from mangrove plants on DDBJ/EMBL/GenBank as well as predicted the structure, composition, similarity, subcellular localization and phylogenetic. The physical and chemical properties of seven mangrove OSC showed variation among the genes. The percentage of the secondary structure of seven mangrove OSC genes followed the order of a helix > random coil > extended chain structure. The values of chloroplast or signal peptide were too low, indicated that no chloroplast transit peptide or signal peptide of secretion pathway in mangrove OSC genes. The target peptide value of mitochondria varied from 0.163 to 0.430, indicated it was possible to exist. These results suggested the importance of understanding the diversity and functional of properties of the different amino acids in mangrove OSC genes. To clarify the relationship among the mangrove OSC gene, a phylogenetic tree was constructed. The phylogenetic tree shows that there are three clusters, Kandelia KcMS join with Bruguiera BgLUS, Rhizophora RsM1 was close to Bruguiera BgbAS, and Rhizophora RcCAS join with Kandelia KcCAS. The present study, therefore, supported the previous results that plant OSC genes form distinct clusters in the tree.

  5. Evaluation of Clinical and Communication Skills of Pharmacy Students and Pharmacists with an Objective Structured Clinical Examination.

    Science.gov (United States)

    Urteaga, Elizabeth M; Attridge, Rebecca L; Tovar, John M; Witte, Amy P

    2015-10-25

    Objective. To evaluate how effectively pharmacy students and practicing pharmacists communicate and apply knowledge to simulations of commonly encountered patient scenarios using an objective structured clinical examination (OSCE). Design. Second-, third-, and fourth-year pharmacy students completed an OSCE as part of their required courses in 2012 and 2013. All students in both years completed identical OSCE cases. Licensed pharmacists were recruited to complete the OSCE and serve as controls in 2012. A survey assessed student perception and acceptance of the OSCE as well as student confidence in performance. Assessment. Licensed pharmacists had significantly higher clinical and communication skills scores than did pharmacy students. Student progression in communication and clinical skills improved significantly over time. Survey results indicated that students felt the OSCE was well-structured and assessed clinical skills taught in pharmacy school; 86% of students felt confident they could provide these skills. Conclusion. Objective structured clinical examinations can evaluate clinical competence and communication skills among professional students. Implementation of OSCEs may be an effective tool for assessment of the Center for the Advancement of Pharmacy Education domains.

  6. La capacidad de las Organizaciones de la Sociedad Civil para mejorar la calidad de vida de los adultos mayores: un estudio cualitativo en zonas urbanas empobrecidas de México

    Directory of Open Access Journals (Sweden)

    Tonatiuh T. González Vázquez

    2010-01-01

    Full Text Available Recientemente en México se ha incrementado la proporción de adultos mayores (AM y de Organizaciones de la Sociedad Civil (OSC que ayudan a los pobres. Nuestro objetivo fue analizar la capacidad que tienen las OSC de implementar acciones para mejorar la calidad de vida de los AM pobres de zonas urbanas. En 2005 se realizaron 14 entrevistas al personal de diez OSC que trabajaban en colonias pobres de cuatro ciudades de México. La guía de entrevista y el análisis se basaron en la estructura interna y el contexto externo que afecta la capacidad de las OSC. Entre los principales logros se destacan una mayor participación y autogestión de la gente y el número de acciones realizadas para mejorar la calidad de vida de las personas. Los principales obstáculos identificados son una demanda poblacional que supera la capacidad de respuesta de las OSC, una población objetivo que generalmente no son los AM y un financiamiento insuficiente. La atención proporcionada por las OSC a los AM, aunque trascendental, es escasa, por tanto es necesario promover una cultura de prevención e interés en los AM y de apoyo a las OSC.

  7. Simultaneous determination of penicillin G salts by infrared spectroscopy: Evaluation of combining orthogonal signal correction with radial basis function-partial least squares regression

    Science.gov (United States)

    Talebpour, Zahra; Tavallaie, Roya; Ahmadi, Seyyed Hamid; Abdollahpour, Assem

    2010-09-01

    In this study, a new method for the simultaneous determination of penicillin G salts in pharmaceutical mixture via FT-IR spectroscopy combined with chemometrics was investigated. The mixture of penicillin G salts is a complex system due to similar analytical characteristics of components. Partial least squares (PLS) and radial basis function-partial least squares (RBF-PLS) were used to develop the linear and nonlinear relation between spectra and components, respectively. The orthogonal signal correction (OSC) preprocessing method was used to correct unexpected information, such as spectral overlapping and scattering effects. In order to compare the influence of OSC on PLS and RBF-PLS models, the optimal linear (PLS) and nonlinear (RBF-PLS) models based on conventional and OSC preprocessed spectra were established and compared. The obtained results demonstrated that OSC clearly enhanced the performance of both RBF-PLS and PLS calibration models. Also in the case of some nonlinear relation between spectra and component, OSC-RBF-PLS gave satisfactory results than OSC-PLS model which indicated that the OSC was helpful to remove extrinsic deviations from linearity without elimination of nonlinear information related to component. The chemometric models were tested on an external dataset and finally applied to the analysis commercialized injection product of penicillin G salts.

  8. Objective structured clinical examination for undergraduates: Is it a feasible approach to standardized assessment in India?

    Directory of Open Access Journals (Sweden)

    Kavita R Bhatnagar

    2011-01-01

    Full Text Available Background: There has been a growing concern among medical educators about the quality of medical graduates trained in various medical colleges in our country. Data based on the faculty and student perceptions of undergraduate curriculum indicate a need for laying more stress on practical skills during their training and assessment. The Objective Structured Clinical Examination (OSCE is a reliable and an established and effective multistation test for the assessment of practical skills in an objective and a transparent manner. The aim of this article is to sensitize universities, examiners, organizers, faculty, and students across India to OSCE. Materials and Methods: We designed an assessment based on 22-station OSCE and administered it to 67 students during their final year, integrating all the domains of learning, that is higher order cognitive domain, psychomotor domain, and affective domain. Data analysis was done using SPSS version 15. Results: The OSCE was feasible to conduct and had high perceived construct validity. There was a significant correlation between the station score and total examination score for 19 stations. The reliability of this OSCE was 0.778. Both students and faculty members expressed a high degree of satisfaction with the format. Conclusion: Integrating a range of modalities into an OSCE in ophthalmology appears to represent a valid and reliable method of examination. The biggest limitation with this format was the direct expenditure of time and energy of those organizing an OSCE; therefore, sustaining the motivation of faculty might pose a challenge.

  9. Bulk-Heterojunction Organic Solar Cells: Five Core Technologies for Their Commercialization.

    Science.gov (United States)

    Kang, Hongkyu; Kim, Geunjin; Kim, Junghwan; Kwon, Sooncheol; Kim, Heejoo; Lee, Kwanghee

    2016-09-01

    The past two decades of vigorous interdisciplinary approaches has seen tremendous breakthroughs in both scientific and technological developments of bulk-heterojunction organic solar cells (OSCs) based on nanocomposites of π-conjugated organic semiconductors. Because of their unique functionalities, the OSC field is expected to enable innovative photovoltaic applications that can be difficult to achieve using traditional inorganic solar cells: OSCs are printable, portable, wearable, disposable, biocompatible, and attachable to curved surfaces. The ultimate objective of this field is to develop cost-effective, stable, and high-performance photovoltaic modules fabricated on large-area flexible plastic substrates via high-volume/throughput roll-to-roll printing processing and thus achieve the practical implementation of OSCs. Recently, intensive research efforts into the development of organic materials, processing techniques, interface engineering, and device architectures have led to a remarkable improvement in power conversion efficiencies, exceeding 11%, which has finally brought OSCs close to commercialization. Current research interests are expanding from academic to industrial viewpoints to improve device stability and compatibility with large-scale printing processes, which must be addressed to realize viable applications. Here, both academic and industrial issues are reviewed by highlighting historically monumental research results and recent state-of-the-art progress in OSCs. Moreover, perspectives on five core technologies that affect the realization of the practical use of OSCs are presented, including device efficiency, device stability, flexible and transparent electrodes, module designs, and printing techniques. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  10. Characterization of the apoptotic response of human leukemia cells to organosulfur compounds

    International Nuclear Information System (INIS)

    Wong, W Wei-Lynn; Langler, Richard F; Penn, Linda Z; Boutros, Paul C; Wasylishen, Amanda R; Guckert, Kristal D; O'Brien, Erin M; Griffiths, Rebecca; Martirosyan, Anna R; Bros, Christina; Jurisica, Igor

    2010-01-01

    Novel therapeutic agents that selectively induce tumor cell death are urgently needed in the clinical management of cancers. Such agents would constitute effective adjuvant approaches to traditional chemotherapy regimens. Organosulfur compounds (OSCs), such as diallyl disulfide, have demonstrated anti-proliferative effects on cancer cells. We have previously shown that synthesized relatives of dysoxysulfone, a natural OSC derived from the Fijian medicinal plant, Dysoxylum richi, possess tumor-specific antiproliferative effects and are thus promising lead candidates. Because our structure-activity analyses showed that regions flanking the disulfide bond mediated specificity, we synthesized 18 novel OSCs by structural modification of the most promising dysoxysulfone derivatives. These compounds were tested for anti-proliferative and apoptotic activity in both normal and leukemic cells. Six OSCs exhibited tumor-specific killing, having no effect on normal bone marrow, and are thus candidates for future toxicity studies. We then employed mRNA expression profiling to characterize the mechanisms by which different OSCs induce apoptosis. Using Gene Ontology analysis we show that each OSC altered a unique set of pathways, and that these differences could be partially rationalized from a transcription factor binding site analysis. For example, five compounds altered genes with a large enrichment of p53 binding sites in their promoter regions (p < 0.0001). Taken together, these data establish OSCs derivatized from dysoxysulfone as a novel group of compounds for development as anti-cancer agents

  11. ITO-Free Semitransparent Organic Solar Cells Based on Silver Thin Film Electrodes

    Directory of Open Access Journals (Sweden)

    Zhizhe Wang

    2014-01-01

    Full Text Available ITO-free semitransparent organic solar cells (OSCs based on MoO3/Ag anodes with poly(3-hexylthiophene and [6,6]-phenyl-C61-butyric acid methyl ester films as the active layer are investigated in this work. To obtain the optimal transparent (MoO3/Ag anode, ITO-free reference OSCs are firstly fabricated. The power conversion efficiency (PCE of 2.71% is obtained for OSCs based on the optimal MoO3 (2 nm/Ag (9 nm anode, comparable to that of ITO-based reference OSCs (PCE of 2.85%. Then based on MoO3 (2 nm/Ag (9 nm anode, ITO-free semitransparent OSCs with different thickness combination of Ca and Ag as the cathodes are investigated. It is observed from our results that OSCs with Ca (15 nm/Ag (15 nm cathode have the optimal transparency. Meanwhile, the PCE of 1.79% and 0.67% is obtained for illumination from the anode and cathode side, respectively, comparable to that of similar ITO-based semitransparent OSCs (PCE of 1.59% and 0.75% for illumination from the anode and cathode side, resp. (Sol. Energy Mater. Sol. Cells, 95, pp. 877–880, 2011. The transparency and PCE of ITO-free semitransparent OSCs can be further improved by introducing a light couple layer. The developed method is compatible with various substrates, which is instructive for further research of ITO-free semitransparent OSCs.

  12. Neuroprotective effects of oxysophocarpine on neonatal rat primary cultured hippocampal neurons injured by oxygen-glucose deprivation and reperfusion.

    Science.gov (United States)

    Zhu, Qing-Luan; Li, Yu-Xiang; Zhou, Ru; Ma, Ning-Tian; Chang, Ren-Yuan; Wang, Teng-Fei; Zhang, Yi; Chen, Xiao-Ping; Hao, Yin-Ju; Jin, Shao-Ju; Ma, Lin; Du, Juan; Sun, Tao; Yu, Jian-Qiang

    2014-08-01

    Oxysophocarpine (OSC), a quinolizidine alkaloid extracted from leguminous plants of the genus Robinia, is traditionally used for various diseases including neuronal disorders. This study investigated the protective effects of OSC on neonatal rat primary-cultured hippocampal neurons were injured by oxygen-glucose deprivation and reperfusion (OGD/RP). Cultured hippocampal neurons were exposed to OGD for 2 h followed by a 24 h RP. OSC (1, 2, and 5 μmol/L) and nimodipine (Nim) (12 μmol/L) were added to the culture after OGD but before RP. The cultures of the control group were not exposed to OGD/RP. MTT and LDH assay were used to evaluate the protective effects of OSC. The concentration of intracellular-free calcium [Ca(2+)]i and mitochondrial membrane potential (MMP) were determined to evaluate the degree of neuronal damage. Morphologic changes of neurons following OGD/RP were observed with a microscope. The expression of caspase-3 and caspase-12 mRNA was examined by real-time quantitative PCR. The IC50 of OSC was found to be 100 μmol/L. Treatment with OSC (1, 2, and 5 μmol/L) attenuated neuronal damage (p < 0.001), with evidence of increased cell viability (p < 0.001) and decreased cell morphologic impairment. Furthermore, OSC increased MMP (p < 0.001), but it inhibited [Ca(2+)]i (p < 0.001) elevation in a dose-dependent manner at OGD/RP. OSC (5 μmol/L) also decreased the expression of caspase-3 (p < 0.05) and caspase-12 (p < 0.05). The results suggested that OSC has significant neuroprotective effects that can be attributed to inhibiting endoplasmic reticulum (ER) stress-induced apoptosis.

  13. Does self-efficacy mediate the association between socioeconomic background and emotional symptoms among schoolchildren?

    DEFF Research Database (Denmark)

    Meilstrup, Charlotte; Thygesen, Lau Caspar; Nielsen, Line

    2016-01-01

    in the association between occupational social class (OSC) and emotional symptoms. METHODS: Data stem from the cross-sectional Health Behavior in School-aged Children-Methodology Development Survey 2012 (HBSC-MDS) conducted among 11-15-year old schoolchildren in two Danish municipalities. Participation rate was 76.......8 % of 5165 enrolled schoolchildren, n = 3969. RESULTS: Low OSC is associated with higher odds of daily emotional symptoms and low selfefficacy. Schoolchildren with low self-efficacy have higher odds for daily emotional symptoms. We find a strong and statistically significant direct effect between low OSC...

  14. The effect of molecular geometry on the photovoltaic property of diketopyrrolopyrrole based non-fullerene acceptors

    DEFF Research Database (Denmark)

    Zhang, Fei; Brandt, Rasmus Guldbæk; Gu, Zhuowei

    2015-01-01

    The non-fullerene acceptors with different geometric structures have great impact on light absorption, exciton dissociation, and charge transportation in the active layer of organic solar cells (OSCs). In this paper, we designed and synthesized two diketopyrrolopyrrole based non-fullerene acceptors......) while compared to Ph(DPP)2. Therefore, the resulting P3HT:PhDMe(DPP)2 based OSCs shows a better power conversion efficiency (PCE) of 0.65%, higher than that from P3HT:Ph(DPP)2 based OSCs (0.48%), which can be ascribed to more efficient exciton dissociation and electron transportation in the active layer...

  15. Enhanced photoresponsivity in organic field effect transistors by silver nanoparticles

    DEFF Research Database (Denmark)

    Linnet, Jes; Runge Walther, Anders; Albrektsen, Ole

    2017-01-01

    Organic semiconductors (OSC) such as thiophene-based oligomers exhibit useful electronic and optical properties making them applicable in photo-sensing devices. Generally, thiophene-based photodetectors exhibit a decent responsivity with a spectral sensitivity determined by the OSC's absorption...... and shape of the fabricated silver NPs, a spectrally broad enhancement is predicted, which is in agreement with the experimental results. The results show that the photoresponsivity is dominantly enhanced in a spectral region of low OSC absorption coinciding with the localized surface plasmon resonances...

  16. Determination of Oversulphated Chondroitin Sulphate and Dermatan Sulphate in unfractionated heparin by (1)H-NMR - Collaborative study for quantification and analytical determination of LoD.

    Science.gov (United States)

    McEwen, I; Mulloy, B; Hellwig, E; Kozerski, L; Beyer, T; Holzgrabe, U; Wanko, R; Spieser, J-M; Rodomonte, A

    2008-12-01

    Oversulphated Chondroitin Sulphate (OSCS) and Dermatan Sulphate (DS) in unfractionated heparins can be identified by nuclear magnetic resonance spectrometry (NMR). The limit of detection (LoD) of OSCS is 0.1% relative to the heparin content. This LoD is obtained at a signal-to-noise ratio (S/N) of 2000:1 of the heparin methyl signal. Quantification is best obtained by comparing peak heights of the OSCS and heparin methyl signals. Reproducibility of less than 10% relative standard deviation (RSD) has been obtained. The accuracy of quantification was good.

  17. Medical students' perception of objective structured clinical examination: a feedback for process improvement.

    Science.gov (United States)

    Nasir, Abdulrasheed A; Yusuf, Ayodeji S; Abdur-Rahman, Lukman O; Babalola, Olasunkanmi M; Adeyeye, Ademola A; Popoola, Ademola A; Adeniran, James O

    2014-01-01

    Medical educators have always been desirous of the best methods for formative and summative evaluation of trainees. The Objective Structured Clinical Examination (OSCE) is an approach for student assessment in which aspects of clinical competence are evaluated in a comprehensive, consistent, and structured manner with close attention to the objectivity of the process. Though popular in most medical schools globally, its use in Nigeria medical schools appears limited. This study was conceived to explore students' perception about the acceptability of OSCE process and to provide feedback to be used to improve the assessment technique. A cross-sectional survey was conducted on final-year medical students, who participated in the final MBBS surgery examination in June 2011. A 19-item self-administered structured questionnaire was employed to obtain relevant data on demographics of respondents and questions evaluating the OSCE stations in terms of the quality of instructions and organization, learning opportunities, authenticity and transparency of the process, and usefulness of the OSCE as an assessment instrument compared with other formats. Students' responses were based on a 5-point Likert scales ranging from strongly disagree to strongly agree. The data were analyzed using SPSS, version 15 (SPSS, Inc, Chicago, IL). The study took place at the University of Ilorin, College of Health Science. A total of 187 final-year medical students were enrolled in to the survey. Of 187 eligible students, 151 completed the self-administered questionnaire representing 80.7% response rate. A total of 61 (40.4%) students felt that it was easy to understand written instructions at the OSCE stations. In total, 106 (70.2%) students felt that the time allocated to each station was adequate. A total of 89 (58.9%) students agreed that the OSCE accurately measured their knowledge and skill, and 85 (56.3%) reported that OSCE enhanced their communication skill. Of the respondents, 80 (53

  18. Manganese-Loaded Activated Carbon for the Removal of Organosulfur Compounds from High-Sulfur Diesel Fuels

    OpenAIRE

    Al-Ghouti, M.A.; Al-Degs, Y.S.

    2014-01-01

    The adsorptive capacity of activated carbon (AC) is significantly enhanced toward weakly interacting organosulfur compounds (OSC) from sulfur-rich diesel fuel. Sulfur compounds are selectively removed from diesel after surface modification by manganese dioxide (MnO2). A selective surface for OSC removal was created by loading MnO2 on the surface; π-complexation between the partially filled d-orbitals of Mn4+ and the S atom is the controlling mechanism for OSC removal. Principal component anal...

  19. CSIR Annual report 2005-06

    CSIR Research Space (South Africa)

    CSIR

    2006-01-01

    Full Text Available Occupational Safety Association NPA National Ports Authority NRDS National R&D Strategy NRF National Research Foundation NSI National System for Innovation ORSSA Operations Research Society of South Africa OSC Open Source Centre OSS Open Source Software...

  20. European Security Organizations in the Post-Cold-War Security Environment. The New Frame of European Security

    National Research Council Canada - National Science Library

    Bugai, Veaceslav

    2006-01-01

    .... In particular, it gives an over view of the transformations that occurred within NATO and OSCE in the post-Cold War period, which have created and developed new security mechanisms and policies for dealing with crises...

  1. Occurrence and biogenesis of seco-triterpenoids

    DEFF Research Database (Denmark)

    Almeida Robles, Aldo Ricardo

    Triterpenoids are secondary metabolites synthesized by oxidosqualene cyclases (OSCs), a class of enzyme that converts the linear squalene-2,3-oxide to single or multi-ring products in a dynamic process called cyclization. The cyclization cascade is powered by a migrating carbocation that through...... process of an OSC or from post cyclization modification steps. The bioactivity and biosynthesis of the seco-triterpenoids is intriguing, and yet underexplored. In this thesis a review of structure-activity relationships of seco-triterpenoids is presented. Seco-cycloartanes report the highest cytotoxicity...... OSCs in O. spinosa (OsONS1 and OsONS2) which both are able to produce α-onocerin. Contrary to the α-onocerin pathway in L. clavatum in which two different cyclases are needed for α-onocerin synthesis. Moreover, an OSC phylogenetic analysis indicated the onocerin synthases of O. spinosa arose from...

  2. Central Asia: Regional Developments and Implications for U.S. Interests

    National Research Council Canada - National Science Library

    Nichol, Jim

    2004-01-01

    After the collapse of the Soviet Union in 1991, the United States recognized the independence of the former Central Asian republics, supported their admission into the Organization on Security and Cooperation in Europe (OSCE...

  3. An Efficient Solution-Processed Intermediate Layer for Facilitating Fabrication of Organic Multi-Junction Solar Cells

    DEFF Research Database (Denmark)

    Ning Li; Baran, Derya; Forberich, Karen

    2013-01-01

    ):poly(styrenesulfonate) (PEDOT:PSS) is demonstrated for series-connected multi-junction organic solar cells (OSCs). Drying at 80 °C in air is sufficient for this solution-processed IML to obtain excellent functionality and reliability, which allow the use of most of high performance donor materials in the tandem structure....... An open circuit voltage (Voc) of 0.56 V is obtained for single-junction OSCs based on a low band-gap polymer, while multi-junction OSCs based on the same absorber material deliver promising fill factor values along with fully additive Voc as the number of junctions increase. Optical and electrical...... simulations, which are reliable and promising guidelines for the design and investigation of multi-junction OSCs, are discussed. The outcome of optical and electrical simulations is in excellent agreement with the experimental data, indicating the outstanding efficiency and functionality of this solution...

  4. Cooperative Security: New Horizons for International Order

    National Research Council Canada - National Science Library

    Cohen, Richard; Mihalka, Michael

    2001-01-01

    .... Both are controversial. Richard Cohen presents a compelling and highly original model of Cooperative Security -- a term that once was applied almost exclusively to the Organization for Security and Co-operation in Europe (OSCE...

  5. Twenty-First Century Europe: Emergence of Baltic States into European Alliances

    National Research Council Canada - National Science Library

    Brasier, Patricia

    2003-01-01

    ...), the European Union (EU) and the Organization for Security and Cooperation in Europe (OSCE), upon completing their membership obligations will enhance stability and security within the European continent. The U.S...

  6. Aggregation of Organic Semiconductors and Its Influence on Carrier Transport and Solar Cell Performance

    KAUST Repository

    Hu, Hanlin

    2017-01-01

    Photovoltaic technology based on solution-processable organic solar cells (OSCs) provides a promising route towards a low-cost strategy to address the sharply increasing energy demands worldwide. However, up to date, the vast majority of solar cell

  7. Rikkumissüüdistusega Kasahhi valimised võitis ülekaalukalt Nazarbajev / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2005-01-01

    Presidendivalimistest Kasahstanis. President Nursultan Nazarbajev nimetas valimisi ausateks ja õiglasteks, OSCE vaatlejate hinnangul möödusid valimised küll rahulikult, kuid opositsioon oli alla surutud ning esines ka mitmekordset hääletamist

  8. A digital peer-to-peer learning platform for clinical skills development.

    Directory of Open Access Journals (Sweden)

    Jesse Paul Basnak

    2017-02-01

    Conclusion: Students found the practice OSCEs and digital platform effective for learning clinical skills. Thus, peer-to-peer learning and computer automation can be useful adjuncts to traditional medical curricula.

  9. Towards Self-Healing Organic Electronics

    NARCIS (Netherlands)

    Oostra, Antoon

    2016-01-01

    Om broeikasgassen te verminderen moet de energieconsumptie van onder andere verlichting verminderd worden en moet de duurzame energieopbrengst verhoogd worden. Organische lichtgevende diodes (OLEDs) en organische zonnecellen (OSCs) zijn twee technologische toevoegingen aan de huidige op kristallijne

  10. Multivariate Regression Model of Impedance of Normal and Chemically Irritated Skin Shows Predictive Ability

    National Research Council Canada - National Science Library

    Aberg, P

    2001-01-01

    ... before and after application of chemicals on volar forearms of volunteers, Tegobetaine and sodium lauryl sulphate were used to induce the irritations, The spectra were filtered using orthogonal signal correction (OSC...

  11. Applicability and fairness of the oral examination in undergraduate ...

    African Journals Online (AJOL)

    situations or problems that learners will encounter in actual medical practice. ... Keywords: Oral; Medical; Student; Gender; Examiner; Performance; OSCE. Received: 02-03-2011 ..... critical to success in the workplace. One should also be.

  12. What to Expect During a Colonoscopy

    Medline Plus

    Full Text Available ... and Meetings Endorsed Courses Online Education ACG Education Universe Journal CME ACG Self-Assessment Test ACG SAP- ... Training Curriculum GI Training Pathway on the Education Universe NYU OSCE Toolkit GI Fellowship Programs Find a ...

  13. Frustrated Lewis Pairs

    Indian Academy of Sciences (India)

    IAS Admin

    related chemical industries (such as production of methanol, acetic acid, etc.). ... materials for energy storage. ... organic solar cells (OSCs), and last but not the least, organocatalysis. .... model suggests that hydrogen acti- vation is ...

  14. Bosnia paraneb sõjahaavadest visalt / Väino Linde

    Index Scriptorium Estoniae

    Linde, Väino, 1959-

    2006-01-01

    Ilmunud ka: Vooremaa, Valgamaalane, Nädaline 7. okt. lk. 2, Hiiu Leht 10. okt. lk. 4, Järva Teataja 12. okt. lk. 2. Autor osales OSCE rahvusvahelise vaatlejana Bosnia ja Hertsegoviina üldvalimistel

  15. Organization for security and co-operation in Europe mission to Georgia / Joe McDonagh

    Index Scriptorium Estoniae

    McDonagh, Joe

    2003-01-01

    22.-23. septembrini 2003 Vilniuses toimunud seminaril "South Caucasus: making the best use of external assistance for stability building and for co-operation with NATO" esitatud ettekanne OSCE missiooni tegevusest Gruusias

  16. Disease: H00444 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available sclerosis (OSCS) is a bone dysplasia characterized by longitudinal striations in the metaphyseal region of the long bones... and sclerosis of the craniofacial bones. The condition is X-linked dominant. Germline mutatio

  17. Jazõk do demokratii ne dovedjot / Max van der Stoel

    Index Scriptorium Estoniae

    Stoel, Max van der, 1924-2011

    1999-01-01

    OSCE rahvusvähemuste komissari M. Stoel'i pöördumine president L. Meri poole seoses keeleseaduse muudatustega. Ilmunud ka: Molodjozh Estonii, 6. jaan. 1999, lk. 2; Russkii Telegraf, 11. jaan. 1999, lk. 14

  18. Jazõk do demokrati ne dovedjot / Max van der Stoel

    Index Scriptorium Estoniae

    Stoel, Max van der, 1924-2011

    1999-01-01

    OSCE vähemusrahvuste ülemkomissari Max van der Stoeli pöördumine Lennart Meri poole seoses riigikeele oskuse nõude sisseviimisega Riigikogu valimise ja kohaliku omavalitsuse volikogu valimise seadusesse

  19. Realism tagab rahu paremini kui ideoloogia / Jarmo Virmavirta

    Index Scriptorium Estoniae

    Virmavirta, Jarmo

    2008-01-01

    Gruusia-Venemaa sõjalisest konfliktist, väikeriikide poliitikast, Soome kui OSCE eesistujamaa rahvusvahelisest positsioonist ning suhetest Venemaaga. Gruusia näitab, et rahvusvahelised suhted vajavad rohkem realismi, kirjutab autor

  20. Solana : Eesti-Vene piirilepe võib tulla 10. mail Moskvas / Javier Solana ; interv. Krister Paris

    Index Scriptorium Estoniae

    Solana, Javier

    2005-01-01

    Euroopa Liidu välis- ja julgeolekupoliitika koordinaator Javier Solana Venemaa piirileppest Eestiga, OSCE rollist, Venemaa-Euroopa Liidu suhetest, euroliidu sõltumatust välispoliitikast. Lisa: Ajalooanalüüsi kaudu lepituseni

  1. Rational design of organic semiconductors for texture control and self-patterning on halogenated surfaces

    KAUST Repository

    Ward, Jeremy W.; Li, Ruipeng; Obaid, Abdulmalik; Payne, Marcia M.; Smilgies, Detlef Matthias; Anthony, John Edward; Amassian, Aram; Jurchescu, Oana D.

    2014-01-01

    new materials. Here, the influence of the interactions at the interface between a halogenated organic semiconductor (OSC) thin film and a halogenated self-assembled monolayer on the formation of the crystalline texture directly affecting

  2. 32 CFR 145.2 - Applicability and scope.

    Science.gov (United States)

    2010-07-01

    ... of this part that relate to prohibited personnel practices do not apply to the Defense Intelligence...) This part does not restrict the IG, DoD, in coordinating investigative efforts on individual cases with the OSC where concurrent jurisdiction exists. ...

  3. Large-area formation of self-aligned crystalline domains of organic semiconductors on transistor channels using CONNECT

    Science.gov (United States)

    Park, Steve; Giri, Gaurav; Shaw, Leo; Pitner, Gregory; Ha, Jewook; Koo, Ja Hoon; Gu, Xiaodan; Park, Joonsuk; Lee, Tae Hoon; Nam, Ji Hyun; Hong, Yongtaek; Bao, Zhenan

    2015-01-01

    The electronic properties of solution-processable small-molecule organic semiconductors (OSCs) have rapidly improved in recent years, rendering them highly promising for various low-cost large-area electronic applications. However, practical applications of organic electronics require patterned and precisely registered OSC films within the transistor channel region with uniform electrical properties over a large area, a task that remains a significant challenge. Here, we present a technique termed “controlled OSC nucleation and extension for circuits” (CONNECT), which uses differential surface energy and solution shearing to simultaneously generate patterned and precisely registered OSC thin films within the channel region and with aligned crystalline domains, resulting in low device-to-device variability. We have fabricated transistor density as high as 840 dpi, with a yield of 99%. We have successfully built various logic gates and a 2-bit half-adder circuit, demonstrating the practical applicability of our technique for large-scale circuit fabrication. PMID:25902502

  4. Advancements in the Micromirror Array Projector Technology II

    National Research Council Canada - National Science Library

    Beasley, D. B; Bender, Matt; Crosby, Jay; McCall, Sean; Messer, Tim; Saylor, Daniel A

    2005-01-01

    ...) for Hardware-In-the-Loop (HWIL) simulation and sensor test applications. Since the introduction of the first MAPS in 2001, OSC has continued to improve the technology and develop systems for new projection and test applications...

  5. Aserbaidžaan lõhenes valimiste järel kahte leeri / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2005-01-01

    Aserbaidzhaanis kuulutas president Ilham Alijevi partei end parlamendivalimiste võitjaks, opositsiooniparteide blokk nõuab uusi valimisi. OSCE vaatlejate hinnangul ei vastanud valimised demokraatlikele standarditele. Lisa: Herkel: valimissüsteem aitab võimu

  6. NASA Laser Communications with Adaptive Optics and Linear Mode Photon Counting, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — In this effort, the Optical Sciences Company (tOSC) and Raytheon Vision Systems (RVS) will team to provide NASA with a long range laser communications system for...

  7. What to Expect During a Colonoscopy

    Medline Plus

    Full Text Available ... Search / Career Center Links Program Director Resources Entrustable Professional Activities (EPAs) for GI Fellowship Training GI Training Curriculum GI Training Pathway on the Education Universe NYU OSCE Toolkit GI Fellowship Programs Find ...

  8. Understanding meaning and bridging divides: the use of an African metaphor for the South African Open Source Centre

    CSIR Research Space (South Africa)

    Byrne, E

    2006-07-01

    Full Text Available , University of South Africa (UNISA), Tshwane, South Africa 3. Open Source Centre (OSC), Meraka Institute, Centre for Scientific and Industrial Research (CSIR), Tshwane, South Africa * corresponding author: jollirm@unisa.ac.za Abstract This paper... illustrates how metaphors can be used in organizational change and how the use of a particular metaphor (meraka2) was used strategically to effect such a change in the Open Source Centre (OSC) at the Centre for Scientific and Industrial Research (CSIR...

  9. Et nyt lederskab

    DEFF Research Database (Denmark)

    Fledelius, Karsten

    2016-01-01

    Den danske befolkning er ikke tilstrækkelig opmærksom på vigtigheden af OSCE for hele Europas fremtid. Men organisationen rummer vigtige instrumenter for sikring af fred, stabilitet og ytringsfrihed.......Den danske befolkning er ikke tilstrækkelig opmærksom på vigtigheden af OSCE for hele Europas fremtid. Men organisationen rummer vigtige instrumenter for sikring af fred, stabilitet og ytringsfrihed....

  10. European Security

    DEFF Research Database (Denmark)

    Møller, Bjørn

    Theoretical chapters on "Security", "Organisations" and "Regions," Historical Chapters on "Europe and Its Distinguishing Features" and on "The United Nations," "NATO," "The CSCE/OSCE and the Council of Europe" and "The European Union"......Theoretical chapters on "Security", "Organisations" and "Regions," Historical Chapters on "Europe and Its Distinguishing Features" and on "The United Nations," "NATO," "The CSCE/OSCE and the Council of Europe" and "The European Union"...

  11. Development of high-power and high-energy 2 µm bulk solid-state lasers and amplifiers

    CSIR Research Space (South Africa)

    Koen, W

    2016-04-01

    Full Text Available 250 300 350 Pulse Repetition Frequency [Hz] P u l s e E n e r g y [ m J ] 0 1 2 3 4 5 6 7 8 9 10 A v e r a g e P o w e r [ W ] Osc Energy Amp Energy Osc average P Amp average P Figure 8: Output energy of the ring laser and amplifier...

  12. Order effects in high stakes undergraduate examinations: an analysis of 5 years of administrative data in one UK medical school.

    Science.gov (United States)

    Burt, Jenni; Abel, Gary; Barclay, Matt; Evans, Robert; Benson, John; Gurnell, Mark

    2016-10-11

    To investigate the association between student performance in undergraduate objective structured clinical examinations (OSCEs) and the examination schedule to which they were assigned to undertake these examinations. Analysis of routinely collected data. One UK medical school. 2331 OSCEs of 3 different types (obstetrics OSCE, paediatrics OSCE and simulated clinical encounter examination OSCE) between 2009 and 2013. Students were not quarantined between examinations. (1) Pass rates by day examination started, (2) pass rates by day station undertaken and (3) mean scores by day examination started. We found no evidence that pass rates differed according to the day on which the examination was started by a candidate in any of the examinations considered (p>0.1 for all). There was evidence (p=0.013) that students were more likely to pass individual stations on the second day of the paediatrics OSCE (OR 1.27, 95% CI 1.05 to 1.54). In the cases of the simulated clinical encounter examination and the obstetrics and gynaecology OSCEs, there was no (p=0.42) or very weak evidence (p=0.099), respectively, of any such variation in the probability of passing individual stations according to the day they were attempted. There was no evidence that mean scores varied by day apart from the paediatric OSCE, where slightly higher scores were achieved on the second day of the examination. There is little evidence that different examination schedules have a consistent effect on pass rates or mean scores: students starting the examinations later were not consistently more or less likely to pass or score more highly than those starting earlier. The practice of quarantining students to prevent communication with (and subsequent unfair advantage for) subsequent examination cohorts is unlikely to be required. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  13. Relationships of organizational social capital with the presence of "gossip and slander," "quarrels and conflicts," sick leave, and poor work ability in nursing homes.

    Science.gov (United States)

    Kiss, Philippe; De Meester, Marc; Kristensen, Tage S; Braeckman, Lutgart

    2014-11-01

    This study aimed to explore the associations of organizational social capital (OSC) with the presence of "gossip and slander," the presence of "conflicts and quarrels," sick leave prevalence, and prevalence of poor work ability in frontline working personnel of nursing homes. A total of 239 subjects (81 % participation), working in 11 different nursing homes, took part in a cross-sectional questionnaire study. Following end points were considered, they are as follows: prevalence of "gossip and slander," "conflicts and quarrels," sick leave, and poor work ability. Associations with OSC were explored at individual level (binomial log-linear regression analysis) and on group level (Kendall's tau correlation coefficients). Significant associations were found between OSC and "gossip and slander," sick leave, and poor work ability, both in the individual- and group-level analyses. The associations showed a higher significance level in the group-level analyses, with the strongest association found between mean OSC of the workplace and the prevalence of poor work ability at the workplace (τ = -0.722; p = 0.002). This study demonstrated significant associations of OSC with three end points that are relevant within the framework of well-being at work in nursing homes. The results are suggestive that OSC should be treated as a characteristic of the entire workplace, rather than as an individually experienced characteristic. The strikingly strong association between OSC and prevalence of poor work ability is suggestive for an important role of OSC within the context of maintaining work ability.

  14. Purification of Oogonial Stem Cells From Adult Mouse and Human Ovaries: An Assessment of the Literature and a View Toward the Future

    OpenAIRE

    Woods, Dori C.; White, Yvonne A. R.; Tilly, Jonathan L.

    2013-01-01

    Contemporary claims that mitotically active female germ line or oogonial stem cells (OSCs) exist and support oogenesis during postnatal life in mammals have been debated in the field of reproductive biology since March 2004, when a mouse study posed the first serious challenge to the dogma of a fixed pool of oocytes being endowed at birth in more than 50 years. Other studies have since been put forth that further question the validity of this dogma, including the isolation of OSCs from neonat...

  15. Augmented reality (AR) and virtual reality (VR) applied in dentistry

    OpenAIRE

    Ta-Ko Huang; Chi-Hsun Yang; Yu-Hsin Hsieh; Jen-Chyan Wang; Chun-Cheng Hung

    2018-01-01

    The OSCE is a reliable evaluation method to estimate the preclinical examination of dental students. The most ideal assessment for OSCE is used the augmented reality simulator to evaluate. This literature review investigated a recently developed in virtual reality (VR) and augmented reality (AR) starting of the dental history to the progress of the dental skill. As result of the lacking of technology, it needs to depend on other device increasing the success rate and decreasing the risk of th...

  16. A nanoscale study of charge extraction in organic solar cells: the impact of interfacial molecular configurations.

    Science.gov (United States)

    Tang, Fu-Ching; Wu, Fu-Chiao; Yen, Chia-Te; Chang, Jay; Chou, Wei-Yang; Gilbert Chang, Shih-Hui; Cheng, Horng-Long

    2015-01-07

    In the optimization of organic solar cells (OSCs), a key problem lies in the maximization of charge carriers from the active layer to the electrodes. Hence, this study focused on the interfacial molecular configurations in efficient OSC charge extraction by theoretical investigations and experiments, including small molecule-based bilayer-heterojunction (sm-BLHJ) and polymer-based bulk-heterojunction (p-BHJ) OSCs. We first examined a well-defined sm-BLHJ model system of OSC composed of p-type pentacene, an n-type perylene derivative, and a nanogroove-structured poly(3,4-ethylenedioxythiophene) (NS-PEDOT) hole extraction layer. The OSC with NS-PEDOT shows a 230% increment in the short circuit current density compared with that of the conventional planar PEDOT layer. Our theoretical calculations indicated that small variations in the microscopic intermolecular interaction among these interfacial configurations could induce significant differences in charge extraction efficiency. Experimentally, different interfacial configurations were generated between the photo-active layer and the nanostructured charge extraction layer with periodic nanogroove structures. In addition to pentacene, poly(3-hexylthiophene), the most commonly used electron-donor material system in p-BHJ OSCs was also explored in terms of its possible use as a photo-active layer. Local conductive atomic force microscopy was used to measure the nanoscale charge extraction efficiency at different locations within the nanogroove, thus highlighting the importance of interfacial molecular configurations in efficient charge extraction. This study enriches understanding regarding the optimization of the photovoltaic properties of several types of OSCs by conducting appropriate interfacial engineering based on organic/polymer molecular orientations. The ultimate power conversion efficiency beyond at least 15% is highly expected when the best state-of-the-art p-BHJ OSCs are combined with present arguments.

  17. Gallic acid as an oxygen scavenger in bio-based multilayer packaging films

    OpenAIRE

    Pant, Astrid; Sängerlaub, Sven; Müller, Kajetan

    2017-01-01

    Oxygen scavengers are used in food packaging to protect oxygen-sensitive food products. A mixture of gallic acid (GA) and sodium carbonate was used as an oxygen scavenger (OSc) in bio-based multilayer packaging films produced in a three-step process: compounding, flat film extrusion, and lamination. We investigated the film surface color as well as oxygen absorption at different relative humidities (RHs) and temperatures, and compared the oxygen absorption of OSc powder, monolayer films, and ...

  18. Evaluation of perceived and actual competency in a family medicine objective structured clinical examination.

    Science.gov (United States)

    Graves, Lisa; Lalla, Leonora; Young, Meredith

    2017-04-01

    To examine the relationship between objective assessment of performance and self-rated competence immediately before and after participation in a required summative family medicine clerkship objective structured clinical examination (OSCE). Learners rated their competence (on a 7-point Likert scale) before and after an OSCE along 3 dimensions: general, specific, and professional competencies relevant to family medicine. McGill University in Montreal, Que. All 168 third-year clinical clerks completing their mandatory family medicine rotation in 2010 to 2011 were invited to participate. Self-ratings of competence and objective performance scores were compared, and were examined to determine if OSCEs could be a "corrective" tool for self-rating perceived competence (ie, if the experience of undergoing an assessment might assist learners in recalibrating their understanding of their own performance). A total of 140 (83%) of the third-year clinical clerks participated. Participating in an OSCE decreased learners' ratings of perceived competence (pre-OSCE score = 4.9, post-OSCE score = 4.7; F 1,3192 = 4.2; P  competence for all categories of behaviour (before and after) showed no relationship to OSCE performance ( r .08 for all), nor did ratings of station-relevant competence (before and after) ( r .09 for all). Ratings of competence before and after the OSCE were correlated for individual students ( r > 0.40 and P perceived competence had decreased, and these ratings had little relationship to actual performance, regardless of the specificity of the rated competency. Discordance between perceived and actual competence is neither novel nor unique to family medicine. However, this discordance is an important consideration for the development of competency-based curricula. Copyright© the College of Family Physicians of Canada.

  19. Considerations for NATO Satellite Communications in the Post 2000 Era (Elements de Reflexion pour les Communications par Satellite dans les Pays Membres de l’OTAN apres l’An 2000),

    Science.gov (United States)

    1991-06-01

    International Packet switching which allocates bandwith on a dynamic basis, Standards Organisation’s ( ISO ) Open System Interconnection has become the...SUPERBIRD (JAPAN) 1682E . ACSAT (AUSTRALIA) 164 6 F. ~ --- -- GALS (USSR) 170OW GOMS (USSR) 1868 f OSCSI11 DSCS III (LJS) 175W OSCS II. OSCS III (us) ISO W...or six catellites in highly elliptical 16-hour orbits 27003 km , titudei nave been considered, with a view to avoiding double-heading by arranging

  20. "Recruitment to the organsization for security and co-operation in Europe`s mission to Bosnia- Herzegovina" : applying organizational theory to effective peacebuilding

    OpenAIRE

    Nørgaard, Benedicte

    2005-01-01

    Research on international peacebuilding has paid very little attention to the possible influence of internal organizational structures within the organizations carrying out the work. This thesis seeks to add to this knowledge, by providing insights into the recruitment and selection process of the Organization for Security and Co-operation in Europe (OSCE) in Bosnia-Herzegovina (BiH). The purpose of this study is to build knowledge about how the OSCE recruit, and use that knowledge to better ...

  1. High-performance ternary blend polymer solar cells involving both energy transfer and hole relay processes

    OpenAIRE

    Lu, Luyao; Chen, Wei; Xu, Tao; Yu, Luping

    2015-01-01

    The integration of multiple materials with complementary absorptions into a single junction device is regarded as an efficient way to enhance the power conversion efficiency (PCE) of organic solar cells (OSCs). However, because of increased complexity with one more component, only limited high-performance ternary systems have been demonstrated previously. Here we report an efficient ternary blend OSC with a PCE of 9.2%. We show that the third component can reduce surface trap densities in the...

  2. Multifunctional oxidosqualene cyclases and cytochrome P450 involved in the biosynthesis of apple fruit triterpenic acids.

    Science.gov (United States)

    Andre, Christelle M; Legay, Sylvain; Deleruelle, Amélie; Nieuwenhuizen, Niels; Punter, Matthew; Brendolise, Cyril; Cooney, Janine M; Lateur, Marc; Hausman, Jean-François; Larondelle, Yvan; Laing, William A

    2016-09-01

    Apple (Malus × domestica) accumulates bioactive ursane-, oleanane-, and lupane-type triterpenes in its fruit cuticle, but their biosynthetic pathway is still poorly understood. We used a homology-based approach to identify and functionally characterize two new oxidosqualene cyclases (MdOSC4 and MdOSC5) and one cytochrome P450 (CYP716A175). The gene expression patterns of these enzymes and of previously described oxidosqualene cyclases were further studied in 20 apple cultivars with contrasting triterpene profiles. MdOSC4 encodes a multifunctional oxidosqualene cyclase producing an oleanane-type triterpene, putatively identified as germanicol, as well as β-amyrin and lupeol, in the proportion 82 : 14 : 4. MdOSC5 cyclizes 2,3-oxidosqualene into lupeol and β-amyrin at a ratio of 95 : 5. CYP716A175 catalyses the C-28 oxidation of α-amyrin, β-amyrin, lupeol and germanicol, producing ursolic acid, oleanolic acid, betulinic acid, and putatively morolic acid. The gene expression of MdOSC1 was linked to the concentrations of ursolic and oleanolic acid, whereas the expression of MdOSC5 was correlated with the concentrations of betulinic acid and its caffeate derivatives. Two new multifuntional triterpene synthases as well as a multifunctional triterpene C-28 oxidase were identified in Malus × domestica. This study also suggests that MdOSC1 and MdOSC5 are key genes in apple fruit triterpene biosynthesis. © 2016 The Authors. New Phytologist © 2016 New Phytologist Trust.

  3. Regulation of Injury-Induced Ovarian Regeneration by Activation of Oogonial Stem Cells.

    Science.gov (United States)

    Erler, Piril; Sweeney, Alexandra; Monaghan, James R

    2017-01-01

    Some animals have the ability to generate large numbers of oocytes throughout life. This raises the question whether persistent adult germline stem cell populations drive continuous oogenesis and whether they are capable of mounting a regenerative response after injury. Here we demonstrate the presence of adult oogonial stem cells (OSCs) in the adult axolotl salamander ovary and show that ovarian injury induces OSC activation and functional regeneration of the ovaries to reproductive capability. Cells that have morphological similarities to germ cells were identified in the developing and adult ovaries via histological analysis. Genes involved in germ cell maintenance including Vasa, Oct4, Sox2, Nanog, Bmp15, Piwil1, Piwil2, Dazl, and Lhx8 were expressed in the presumptive OSCs. Colocalization of Vasa protein with H3 mitotic marker showed that both oogonial and spermatogonial adult stem cells were mitotically active. Providing evidence of stemness and viability of adult OSCs, enhanced green fluorescent protein (EGFP) adult OSCs grafted into white juvenile host gonads gave rise to EGFP OSCs, and oocytes. Last, the axolotl ovaries completely regenerated after partial ovariectomy injury. During regeneration, OSC activation resulted in rapid differentiation into new oocytes, which was demonstrated by Vasa + /BrdU + coexpression. Furthermore, follicle cell proliferation promoted follicle maturation during ovarian regeneration. Overall, these results show that adult oogenesis occurs via proliferation of endogenous OSCs in a tetrapod and mediates ovarian regeneration. This study lays the foundations to elucidate mechanisms of ovarian regeneration that will assist regenerative medicine in treating premature ovarian failure and reduced fertility. Stem Cells 2017;35:236-247. © 2016 AlphaMed Press.

  4. Enhancement of medical student performance through narrative reflective practice: a pilot project

    Directory of Open Access Journals (Sweden)

    Alan Thomson

    2013-03-01

    Full Text Available Background: Narrative Reflective Practice (NRP is a process that helps medical students become better listeners and physicians. We hypothesized that NRP would enhance students’ performance on multiple choice question exams (MCQs, on objective structured clinical examinations (OSCEs, and on subjective clinical evaluations (SCEs. Methods: The MCQs, OSCEs and SCEs test scores from 139 third year University of Alberta medical students from the same class doing their Internal Medicine rotation were collected over a 12 month period. All preceptors followed the same one-hour clinical teaching format, except for the single preceptor who incorporated 2 weeks of NRP in the usual clinical teaching of 16 students. The testing was done at the end of each 8-week rotation, and all students within each cohort received the same MCQs, OSCE and SCEs Results: Independent t-tests were used to assess group differences in the mean MCQ, OSCE and SCE scores. The group receiving NRP training scored 4.7 % higher on the MCQ component than those who did not. The mean differences for OSCE and SCE scores were non-significant. Conclusions: Two weeks NRP exposure produced an absolute increase in students’ MCQ score. Longer periods of NRP exposure may also increase the OSCE and SCE scores. This promising pilot project needs to be confirmed using several trained preceptors and trainees at different levels of their clinical experience.

  5. Assessing the reliability of the borderline regression method as a standard setting procedure for objective structured clinical examination

    Directory of Open Access Journals (Sweden)

    Sara Mortaz Hejri

    2013-01-01

    Full Text Available Background: One of the methods used for standard setting is the borderline regression method (BRM. This study aims to assess the reliability of BRM when the pass-fail standard in an objective structured clinical examination (OSCE was calculated by averaging the BRM standards obtained for each station separately. Materials and Methods: In nine stations of the OSCE with direct observation the examiners gave each student a checklist score and a global score. Using a linear regression model for each station, we calculated the checklist score cut-off on the regression equation for the global scale cut-off set at 2. The OSCE pass-fail standard was defined as the average of all station′s standard. To determine the reliability, the root mean square error (RMSE was calculated. The R2 coefficient and the inter-grade discrimination were calculated to assess the quality of OSCE. Results: The mean total test score was 60.78. The OSCE pass-fail standard and its RMSE were 47.37 and 0.55, respectively. The R2 coefficients ranged from 0.44 to 0.79. The inter-grade discrimination score varied greatly among stations. Conclusion: The RMSE of the standard was very small indicating that BRM is a reliable method of setting standard for OSCE, which has the advantage of providing data for quality assurance.

  6. Education research: case logs in the assessment of medical students in the neurology outpatient clinic.

    Science.gov (United States)

    Albert, Dara V; Brorson, James R; Amidei, Christina; Lukas, Rimas V

    2014-04-22

    Using outpatient neurology clinic case logs completed by medical students on neurology clerkships, we examined the impact of outpatient clinical encounter volume per student on outcomes of knowledge assessed by the National Board of Medical Examiners (NBME) Clinical Neurology Subject Examination and clinical skills assessed by the Objective Structured Clinical Examination (OSCE). Data from 394 medical students from July 2008 to June 2012, representing 9,791 patient encounters, were analyzed retrospectively. Pearson correlations were calculated examining the relationship between numbers of cases logged per student and performance on the NBME examination. Similarly, correlations between cases logged and performance on the OSCE, as well as on components of the OSCE (history, physical examination, clinical formulation), were evaluated. There was a correlation between the total number of cases logged per student and NBME examination scores (r = 0.142; p = 0.005) and OSCE scores (r = 0.136; p = 0.007). Total number of cases correlated with the clinical formulation component of the OSCE (r = 0.172; p = 0.001) but not the performance on history or physical examination components. The volume of cases logged by individual students in the outpatient clinic correlates with performance on measures of knowledge and clinical skill. In measurement of clinical skill, seeing a greater volume of patients in the outpatient clinic is related to improved clinical formulation on the OSCE. These findings may affect methods employed in assessment of medical students, residents, and fellows.

  7. Neurology objective structured clinical examination reliability using generalizability theory.

    Science.gov (United States)

    Blood, Angela D; Park, Yoon Soo; Lukas, Rimas V; Brorson, James R

    2015-11-03

    This study examines factors affecting reliability, or consistency of assessment scores, from an objective structured clinical examination (OSCE) in neurology through generalizability theory (G theory). Data include assessments from a multistation OSCE taken by 194 medical students at the completion of a neurology clerkship. Facets evaluated in this study include cases, domains, and items. Domains refer to areas of skill (or constructs) that the OSCE measures. G theory is used to estimate variance components associated with each facet, derive reliability, and project the number of cases required to obtain a reliable (consistent, precise) score. Reliability using G theory is moderate (Φ coefficient = 0.61, G coefficient = 0.64). Performance is similar across cases but differs by the particular domain, such that the majority of variance is attributed to the domain. Projections in reliability estimates reveal that students need to participate in 3 OSCE cases in order to increase reliability beyond the 0.70 threshold. This novel use of G theory in evaluating an OSCE in neurology provides meaningful measurement characteristics of the assessment. Differing from prior work in other medical specialties, the cases students were randomly assigned did not influence their OSCE score; rather, scores varied in expected fashion by domain assessed. © 2015 American Academy of Neurology.

  8. Potential of Nonfullerene Small Molecules with High Photovoltaic Performance.

    Science.gov (United States)

    Li, Wanning; Yao, Huifeng; Zhang, Hao; Li, Sunsun; Hou, Jianhui

    2017-09-05

    Over the past decades, fullerene derivatives have become the most successful electron acceptors in organic solar cells (OSCs) and have achieved great progress, with power conversion efficiencies (PCEs) of over 11 %. However, fullerenes have some drawbacks, such as weak absorption, limited energy-level tunability, and morphological instability. In addition, fullerene-based OSCs usually suffer from large energy losses of over 0.7 eV, which limits further improvements in the PCE. Recently, nonfullerene small molecules have emerged as promising electron acceptors in OSCs. Their highly tunable absorption spectra and molecular energy levels have enabled fine optimization of the resulting devices, and the highest PCE has surpassed 12 %. Furthermore, several studies have shown that OSCs based on small-molecule acceptors (SMA) have very efficient charge generation and transport efficiency at relatively low energy losses of below 0.6 eV, which suggests great potential for the further improvement of OSCs. In this focus review, we analyze the challenges and potential of SMA-based OSCs and discuss molecular design strategies for highly efficient SMAs. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  9. Improved interface control for high-performance graphene-based organic solar cells

    Science.gov (United States)

    Jung, Seungon; Lee, Junghyun; Choi, Yunseong; Myeon Lee, Sang; Yang, Changduk; Park, Hyesung

    2017-12-01

    The demand for high-efficiency flexible optoelectronic devices is ever-increasing because next-generation electronic devices that comprise portable or wearable electronic systems are set to play an important role. Graphene has received extensive attention as it is considered to be a promising candidate material for transparent flexible electrode platforms owing to its outstanding electrical, optical, and physical properties. Despite these properties, the inert and hydrophobic nature of graphene surfaces renders it difficult to use in optoelectronic devices. In particular, commonly used charge transporting layer (CTL) materials for organic solar cells (OSCs) cannot uniformly coat a graphene surface, which leads to such devices failing. Herein, this paper proposes an approach that will enable CTL materials to completely cover a graphene electrode; this is done with the assistance of commonly accessible polar solvents. These are successfully applied to various configurations of OSCs, with power conversion efficiencies of 8.17% for graphene electrode-based c-OSCs (OSCs with conventional structures), 8.38% for i-OSCs (OSCs with inverted structures), and 7.53% for flexible solar cells. The proposed approach is expected to bring about significant advances for efficiency enhancements in graphene-based optoelectronic devices, and it is expected that it will open up new possibilities for flexible optoelectronic systems.

  10. Associations of medical student empathy with clinical competence.

    Science.gov (United States)

    Casas, Rachel S; Xuan, Ziming; Jackson, Angela H; Stanfield, Lorraine E; Harvey, Nanette C; Chen, Daniel C

    2017-04-01

    Empathy is a crucial skill for medical students that can be difficult to evaluate. We examined if self-reported empathy in medical students was associated with clinical competence. This study combined cross-sectional data from four consecutive years of medical students (N=590) from the Boston University School of Medicine. We used regression analysis to evaluate if self-reported empathy (Jefferson Scale of Physician Empathy (JSPE)) predicted scores in clinical clerkships, United States Medical Licensing Examinations, and OBJECTIVE: Structured Clinical Examinations (OSCEs). We separately analyzed overall and OSCE communication scores based on interpersonal skills reported by standardized patients. We controlled for age, gender, debt, and specialty affinity. JSPE scores of medical students were positively associated with OSCE communication scores, and remained significant when controlling for demographics. We found that JSPE score was also predictive of overall OSCE scores, but this relationship was confounded by gender and age. JSPE scores were associated with performance in the Pediatrics clerkship, but not other clerkships or standardized tests. JSPE scores were positively associated with OSCE communication scores in medical students. This study supports that self-reported empathy may predict OSCE performance, but further research is needed to examine differences by gender and age. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  11. Mapping Direct Observations From Objective Structured Clinical Examinations to the Milestones Across Specialties.

    Science.gov (United States)

    Baker-Genaw, Kimberly; Kokas, Maria S; Ahsan, Syed F; Darnley-Fisch, Deborah; Drake, Sean; Goyal, Nikhil; Inamdar, Kedar; Moutzouros, Vasilios; Prabhakar, Deepak; Rolland, Laurie; Sangha, Roopina; Shreve, Maria; Woodward, Ann

    2016-07-01

    Little is known about residents' performance on the milestones at the institutional level. Our institution formed a work group to explore this using an institutional-level curriculum and residents' evaluation of the milestones. We assessed whether beginner-level milestones for interpersonal and communication skills (ICS) related to observable behaviors in ICS-focused objective structured clinical examinations (OSCEs) for postgraduate year (PGY) 1 residents across specialties. The work group compared ICS subcompetencies across 12 programs to identify common beginner-level physician-patient communication milestones. The selected ICS milestone sets were compared for common language with the ICS-OSCE assessment tool-the Kalamazoo Essential Elements of Communication Checklist-Adapted (KEECC-A). To assess whether OSCE scores related to ICS milestone scores, all PGY-1 residents from programs that were part of Next Accreditation System Phase 1 were identified; their OSCE scores from July 2013 to June 2014 and ICS subcompetency scores from December 2014 were compared. The milestones for 10 specialties and the transitional year had at least 1 ICS subcompetency that related to physician-patient communication. The language of the ICS beginner-level milestones appears similar to behaviors outlined in the KEECC-A. All 60 residents with complete data received at least a beginner-level ICS subcompetency score and at least a satisfactory score on all 3 OSCEs. The ICS-OSCE scores for PGY-1 residents appear to relate to beginner-level milestones for physician-patient communication across multiple specialties.

  12. Enhancing output power of a piezoelectric cantilever energy harvester using an oscillator

    International Nuclear Information System (INIS)

    Liu, Haili; Huang, Zhenyu; Xu, Tianzhu; Chen, Dayue

    2012-01-01

    The piezoelectric cantilever with a tip mass (Mass-PC), as a conventional vibration energy harvester, usually works at its fundamental frequency matching ambient excitation. By attaching an oscillator to a piezoelectric cantilever (Osc-PC), a double-mode energy harvester is developed to harvest more power from two matched ambient driving frequencies. Meanwhile, it allows the first operating frequency of the Osc-PC to be adjusted to be very low with only a limited mass attached. A distributed-parameter model of this harvester and the explicit expressions of its operating frequencies are derived to analyze and design the Osc-PC. Numerical investigations reveal that a heaver oscillator placed near the clamped end of the piezoelectric cantilever has better performance at the given exciting frequencies. Following the specified design criteria, an Osc-PC whose operating frequencies match two given exciting frequencies was constructed for the purpose of experimental testing. The results show that, compared to that of a corresponding Mass-PC whose operating frequency matches the lower exciting frequency, the energy harvesting efficiency of the Osc-PC increases by almost four times at the first operating frequency, while the output power at the second operating frequency of the Osc-PC accounts for 68% of that of the Mass-PC. (paper)

  13. The sights and insights of examiners in objective structured clinical examinations

    Directory of Open Access Journals (Sweden)

    Lauren Chong

    2017-12-01

    Full Text Available Purpose The objective structured clinical examination (OSCE is considered to be one of the most robust methods of clinical assessment. One of its strengths lies in its ability to minimise the effects of examiner bias due to the standardisation of items and tasks for each candidate. However, OSCE examiners’ assessment scores are influenced by several factors that may jeopardise the assumed objectivity of OSCEs. To better understand this phenomenon, the current review aims to determine and describe important sources of examiner bias and the factors affecting examiners’ assessments. Methods We performed a narrative review of the medical literature using Medline. All articles meeting the selection criteria were reviewed, with salient points extracted and synthesised into a clear and comprehensive summary of the knowledge in this area. Results OSCE examiners’ assessment scores are influenced by factors belonging to 4 different domains: examination context, examinee characteristics, examinee-examiner interactions, and examiner characteristics. These domains are composed of several factors including halo, hawk/dove and OSCE contrast effects; the examiner’s gender and ethnicity; training; lifetime experience in assessing; leadership and familiarity with students; station type; and site effects. Conclusion Several factors may influence the presumed objectivity of examiners’ assessments, and these factors need to be addressed to ensure the objectivity of OSCEs. We offer insights into directions for future research to better understand and address the phenomenon of examiner bias.

  14. A new electrode design for ambipolar injection in organic semiconductors.

    Science.gov (United States)

    Kanagasekaran, Thangavel; Shimotani, Hidekazu; Shimizu, Ryota; Hitosugi, Taro; Tanigaki, Katsumi

    2017-10-17

    Organic semiconductors have attracted much attention for low-cost, flexible and human-friendly optoelectronics. However, achieving high electron-injection efficiency is difficult from air-stable electrodes and cannot be equivalent to that of holes. Here, we present a novel concept of electrode composed of a bilayer of tetratetracontane (TTC) and polycrystalline organic semiconductors (pc-OSC) covered by a metal layer. Field-effect transistors of single-crystal organic semiconductors with the new electrodes of M/pc-OSC/TTC (M: Ca or Au) show both highly efficient electron and hole injection. Contact resistance for electron injection from Au/pc-OSC/TTC and hole injection from Ca/pc-OSC/TTC are comparable to those for electron injection from Ca and hole injection from Au, respectively. Furthermore, the highest field-effect mobilities of holes (22 cm 2  V -1  s -1 ) and electrons (5.0 cm 2  V -1  s -1 ) are observed in rubrene among field-effect transistors with electrodes so far proposed by employing Ca/pc-OSC/TTC and Au/pc-OSC/TTC electrodes for electron and hole injection, respectively.One of technological challenges building organic electronics is efficient injection of electrons at metal-semiconductor interfaces compared to that of holes. The authors show an air-stable electrode design with induced gap states, which support Fermi level pinning and thus ambipolar carrier injection.

  15. Non-fullerene acceptors for organic solar cells

    Science.gov (United States)

    Yan, Cenqi; Barlow, Stephen; Wang, Zhaohui; Yan, He; Jen, Alex K.-Y.; Marder, Seth R.; Zhan, Xiaowei

    2018-03-01

    Non-fullerene acceptors (NFAs) are currently a major focus of research in the development of bulk-heterojunction organic solar cells (OSCs). In contrast to the widely used fullerene acceptors (FAs), the optical properties and electronic energy levels of NFAs can be readily tuned. NFA-based OSCs can also achieve greater thermal stability and photochemical stability, as well as longer device lifetimes, than their FA-based counterparts. Historically, the performance of NFA OSCs has lagged behind that of fullerene devices. However, recent developments have led to a rapid increase in power conversion efficiencies for NFA OSCs, with values now exceeding 13%, demonstrating the viability of using NFAs to replace FAs in next-generation high-performance OSCs. This Review discusses the important work that has led to this remarkable progress, focusing on the two most promising NFA classes to date: rylene diimide-based materials and materials based on fused aromatic cores with strong electron-accepting end groups. The key structure-property relationships, donor-acceptor matching criteria and aspects of device physics are discussed. Finally, we consider the remaining challenges and promising future directions for the NFA OSCs field.

  16. Optical absorption enhancement by inserting ZnO optical spacer in plasmonic organic solar cells

    Science.gov (United States)

    N'Konou, Kekeli; Torchio, Philippe

    2018-01-01

    Optical absorption enhancement (AE) using coupled optical spacer and plasmonic effects in standard and inverted organic solar cells (OSCs) are demonstrated using the finite-difference time-domain numerical method. The influence of an added zinc oxide (ZnO) optical spacer layer inserted below the active layer in standard architecture is first theoretically investigated while the influence of varying the ZnO cathodic buffer layer thickness in inverted design is studied on AE. Then, the embedding of a square periodic array of core-shell silver-silica nanospheres (Ag@SiO2 NSs) at different positions in standard and inverted OSCs is performed while AE and short-circuit current density (Jsc) are calculated. As a result of previous combined effects, the optimized standard plasmonic OSCs present 15% and 79.45% enhancement in J over the reference with and without ZnO optical spacer layer, respectively, and a 16% increase of AE when Ag@SiO2 NSs are placed on top of the PEDOT:PSS layer. Compared to the inverted OSC reference, the plasmonic OSCs present 26% and 27% enhancement in J and AE, respectively, when the Ag@SiO2 NSs are located on top of the ZnO layer. Furthermore, the spatial position of these NSs in such OSCs is a key parameter for increasing light absorption via enhanced electromagnetic field distribution.

  17. A new genus and species of Lasiopteridi (Diptera, Cecidomyiidae on Haplopappus foliosus (Asteraceae from Chile

    Directory of Open Access Journals (Sweden)

    Valéria Cid Maia

    2017-04-01

    Full Text Available A new genus and species of gall midge, Haplopappusmyia gregaria, is described and illustrated (larva, pupa, male, and female. This species induces apical galls on Haplopappus foliosus (Asteraceae, an endemic shrub from central Chile. The specimens were collected at La Ligua Municipality, Petorca Province, Valparaiso region, Chile, during spring of 2011–2014. This area corresponds to one of the fifth Mediterranean Matorral biome, considered among Earth's biodiversity hotspots. The new genus is characterized by presenting lateral margin of antennal scape with a mesal reentrance; four-segmented palpus, one-toothed tarsal claws, R5 straight, reaching C anterior to wing apex; male seventh and eighth tergites lacking sclerotization mesally, beyond proximal margin; presence of trichoid sensilla on the abdominal terga and sterna of both sexes, protrusible ovipositor with elongate fused cerci, and larva with 4 pairs of setose terminal papillae. Keywords: Gall midge, Morphology, Neotropical, Taxonomy

  18. A new genus and species of Lasiopteridi (Diptera, Cecidomyiidae on Haplopappus foliosus (Asteraceae from Chile

    Directory of Open Access Journals (Sweden)

    Valéria Cid Maia

    Full Text Available ABSTRACT A new genus and species of gall midge, Haplopappusmyia gregaria, is described and illustrated (larva, pupa, male, and female. This species induces apical galls on Haplopappus foliosus (Asteraceae, an endemic shrub from central Chile. The specimens were collected at La Ligua Municipality, Petorca Province, Valparaiso region, Chile, during spring of 2011-2014. This area corresponds to one of the fifth Mediterranean Matorral biome, considered among Earth's biodiversity hotspots. The new genus is characterized by presenting lateral margin of antennal scape with a mesal reentrance; four-segmented palpus, one-toothed tarsal claws, R5 straight, reaching C anterior to wing apex; male seventh and eighth tergites lacking sclerotization mesally, beyond proximal margin; presence of trichoid sensilla on the abdominal terga and sterna of both sexes, protrusible ovipositor with elongate fused cerci, and larva with 4 pairs of setose terminal papillae.

  19. Analysis of antenal sensilla patterns of Rhodnius prolixus from Colombia and Venezuela

    Directory of Open Access Journals (Sweden)

    Lyda Esteban

    2005-12-01

    Full Text Available Antennal sensilla patterns were used to analyze population variation of domestic Rhodnius prolixus from six departments and states representing three biogeographical regions of Colombia and Venezuela. Discriminant analysis of the patterns of mechanoreceptors and of three types of chemoreceptors on the pedicel and flagellar segments showed clear differentiation between R. prolixus populations east and west of the Andean Cordillera. The distribution of thick and thin-walled trichoids on the second flagellar segment also showed correlation with latitude, but this was not seen in the patterns of other sensilla. The results of the sensilla patterns appear to be reflecting biogeographic features or population isolation rather than characters associated with different habitats and lend support to the idea that domestic R. prolixus originated in the eastern region of the Andes.

  20. Effect of Gamma Irradiation on Morphology of Antennal Sensilla of the Honeybee Workers

    International Nuclear Information System (INIS)

    Meray, F.A.; Elbassiouny, A.M.; Sawires, S.G.; Gharieb, O.H.

    2012-01-01

    External morphology of antenna sensilla of irradiated and non-irradiated honey bee workers were studied with scanning electron microscopy and distribution of antenall sensilla were determined. Six types of sensilla could be distinguished on the flagella : trichoid semsilla, campaniformia sensilla, placodea sensilla and ampulacea sensilla. The sensilla acampaniformia are probable tactile mechano sensill. Function for basiconica , placodea and ampulacae sensilla include hygro/ thermo reception and chemo reception. The type of sensilla aplacodea was located at the apical part of 3 rd to 10 th segments of the flagellum. General distribution in irradiated specimens was affected. This effects was induced by doses 100,150 and 200 rad and was found to be the dose dependent.

  1. Scanning electron microscopy (Sem) of wings and mouth parts of the Mediterranean Fruit Fly, Ceratitis Capitata (Wield.), as influenced by the sterilizing dose of the gamma radiation

    International Nuclear Information System (INIS)

    El-akhader, E.A.H.

    2005-01-01

    In view of the fact that, any undesirable effects of gamma irradiation with the sterilizing dose (90 Gy) on wings and mouth parts of the Mediterranean fruit fly, Ceratitis Capitata (Wied.), and their associated sensilla will lead indirectly to failure of irradiated males to disperse strongly, to seek out appropriate niches or to behave synchrony with wild males or to success in the courtship with females and/or to mate. Moreover, the fly may fail to suck the plant juice. Using the scanning electron microscopy, this study was investigated. The changes which occurred to the wings and mouth parts of the med fly may be due to the sterilizing dose. One pair of wings was found to have similar typical structures in both sexes differing non-significantly in their measurements. Three different types of located sensilla were observed on each wing namely; trichoid (type sharp and blunt tipped), chaetica (type 1, 2 and 3) and basiconica (type non-socket, socket and papillae). The distribution and measurements of these sensilla were described in the text. The study of the mouth parts of both sexes recorded that there was similar pattern except significant increase between the length of the proboscis of male and female. Four different types of located sensilla were found on the mouth parts of the med fly and their measurements were given in the text. Namely trichoid (type sharp), squameformia (type 1 and socket), chaetica (type 1) and basiconica (type non-socket) were observed. The distal region of the labium was very smooth and did not bear any kind of sensilla. Pupal irradiation with the sterilizing dose resulted in different malformations in both irradiated male and female adult wings and mouth parts and their associated sensilla. Some malformations were observed in the intraveins of the irradiated male wing and in the pseudo tracheae of irradiated female labella

  2. Scanning electron microscopic studies on antenna of Hemipyrellia ligurriens (Wiedemann, 1830) (Diptera: Calliphoridae)-A blow fly species of forensic importance.

    Science.gov (United States)

    Hore, Garima; Maity, Aniruddha; Naskar, Atanu; Ansar, Waliza; Ghosh, Shyamasree; Saha, Goutam Kumar; Banerjee, Dhriti

    2017-08-01

    Blow flies (Diptera: Calliphoridae) are one of the foremost organisms amongst forensic insects to colonize corpses shortly after death, thus are of immense importance in the domain of forensic entomology. The blow fly Hemipyrellia ligurriens (Wiedemann, 1830) (Diptera: Calliphoridae) is considered as a forensically important fly species globally and is also known for its medical and veterinary importance. In the present study, we report for the first time scanning electron microscopic studies on the morphology of sensilla of antenna of adult male and female of H. ligurriens is with profound importance in better understanding of the insect morphology from forensic entomological perspective, and also could aid in proper identification of the species from other calliphorid flies. The structural peculiarities observed in the (i) antenna of H. ligurriens with three segments- scape, pedicel and flagellum with dorso-laterally placed arista (ii) densely covered microtrichia and most abundant trichoid sensilla identified on the antenna (iii) observation of only one type of sensilla, chaetic sensilla (ChI) on the scape (iv) two types of chaetic sensilla (ChI and ChII) and styloconic sensilla on the pedicel (v) the flagellum with three types of sensilla- trichoid, basiconic and coeloconic sensilla (vi) Basiconic sensilla with multiporous surfaces with characteristic olfactory function. Moderate sexual dimorphism in the width of the flagellum, the females with wider flagella than the males, bear significance to the fact that they bear more multi-porous sensilla than the males, thus suffice their need to detect oviposition sites. Significant difference was observed in the length and width of coeloconic sensilla between the two sexes, the females showed bigger coeloconic sensilla, suggesting their function in oviposition site detection and successful colonization in corpses. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. A Comparison of Assessment Tools: Is Direct Observation an Improvement Over Objective Structured Clinical Examinations for Communications Skills Evaluation?

    Science.gov (United States)

    Goch, Abraham M; Karia, Raj; Taormina, David; Kalet, Adina; Zuckerman, Joseph; Egol, Kenneth A; Phillips, Donna

    2018-04-01

    Evaluation of resident physicians' communications skills is a challenging task and is increasingly accomplished with standardized examinations. There exists a need to identify the effective, efficient methods for assessment of communications skills. We compared objective structured clinical examination (OSCE) and direct observation as approaches for assessing resident communications skills. We conducted a retrospective cohort analysis of orthopaedic surgery resident physicians at a single tertiary care academic institution, using the Institute for Healthcare Communication "4 Es" model for effective communication. Data were collected between 2011 and 2015. A total of 28 residents, each with OSCE and complete direct observation assessment checklists, were included in the analysis. Residents were included if they had 1 OSCE assessment and 2 or more complete direct observation assessments. There were 28 of a possible 59 residents (47%) included. A total of 89% (25 of 28) of residents passed the communications skills OSCE; only 54% (15 of 28) of residents passed the direct observation communications assessment. There was a positive, moderate correlation between OSCE and direct observation scores overall ( r  = 0.415, P  = .028). There was no agreement between OSCE and direct observation in categorizing residents into passing and failing scores (κ = 0.205, P  = .16), after adjusting for chance agreement. Our results suggest that OSCE and direct observation tools provide different insights into resident communications skills (simulation of rare and challenging situations versus real-life daily encounters), and may provide useful perspectives on resident communications skills in different contexts.

  4. Significance of Objective Structured Clinical Examinations to Plastic Surgery Residency Training.

    Science.gov (United States)

    Simmons, Brian J; Zoghbi, Yasmina; Askari, Morad; Birnbach, David J; Shekhter, Ilya; Thaller, Seth R

    2017-09-01

    Objective structured clinical examinations (OSCEs) have proven to be a powerful tool. They possess more than a 30-year track record in assessing the competency of medical students, residents, and fellows. Objective structured clinical examinations have been used successfully in a variety of medical specialties, including surgery. They have recently found their way into the subspecialty of plastic surgery. This article uses a systematic review of the available literature on OSCEs and their recent use in plastic surgery. It incorporates survey results assessing program directors' views on the use of OSCEs. Approximately 40% of programs surveyed use OSCEs to assess the Accreditation Council for Graduate Medical Education core competencies. We found that 40% use OSCEs to evaluate specific plastic surgery milestones. Objective structured clinical examinations are usually performed annually. They cost anywhere between $100 and more than $1000 per resident. Four milestones giving residents the most difficulties on OSCEs were congenital anomalies, noncancer breast surgery, breast reconstruction, and practice-based learning and improvement. It was determined that challenges with milestones were due to lack of adequate general knowledge and surgical ward patient care, as well as deficits in professionalism and system-based problems. Programs were able to remediate weakness found by OSCEs using a variety of methods. Objective structured clinical examinations offer a unique tool to objectively assess the proficiency of residents in key areas of the Accreditation Council for Graduate Medical Education core competencies. In addition, they can be used to assess the specific milestones that plastic surgery residents must meet. This allows programs to identify and improve identified areas of weakness.

  5. Identification of organic sulfur compounds in coal bitumen obtained by different extraction techniques using comprehensive two-dimensional gas chromatography coupled to time-of-flight mass spectrometric detection

    Energy Technology Data Exchange (ETDEWEB)

    Machado, Maria Elisabete; Cappelli Fontanive, Fernando; Bastos Caramao, Elina; Alcaraz Zini, Claudia [Universidade Federal do Rio Grande do Sul, Instituto de Quimica, Porto Alegre, RS (Brazil); Oliveira, Jose Vladimir de [URI, Universidade Regional Integrada do Alto Uruguai e das Missoes, Erechim, RS (Brazil)

    2011-11-15

    The determination of organic sulfur compounds (OSC) in coal is of great interest. Technically and operationally these compounds are not easily removed and promote corrosion of equipment. Environmentally, the burning of sulfur compounds leads to the emission of SO{sub x} gases, which are major contributors to acid rain. Health-wise, it is well known that these compounds have mutagenic and carcinogenic properties. Bitumen can be extracted from coal by different techniques, and use of gas chromatography coupled to mass spectrometric detection enables identification of compounds present in coal extracts. The OSC from three different bitumens were tentatively identified by use of three different extraction techniques: accelerated solvent extraction (ASE), ultrasonic extraction (UE), and supercritical-fluid extraction (SFE). Results obtained from one-dimensional gas chromatography (1D GC) coupled to quadrupole mass spectrometric detection (GC-qMS) and from two-dimensional gas chromatography with time-of-flight mass spectrometric detection (GC x GC-TOFMS) were compared. By use of 2D GC, a greater number of OSC were found in ASE bitumen than in SFE and UE bitumens. No OSC were identified with 1D GC-qMS, although some benzothiophenes and dibenzothiophenes were detected by use of EIM and SIM modes. GC x GC-TOFMS applied to investigation of OSC in bitumens resulted in analytical improvement, as more OSC classes and compounds were identified (thiols, sulfides, thiophenes, naphthothiophenes, benzothiophenes, and benzonaphthothiophenes). The roof-tile effect was observed for OSC and PAH in all bitumens. Several co-elutions among analytes and with matrix interferents were solved by use of GC x GC. (orig.)

  6. Seeing green bacteria in a new light: genomics-enabled studies of the photosynthetic apparatus in green sulfur bacteria and filamentous anoxygenic phototrophic bacteria

    DEFF Research Database (Denmark)

    Frigaard, Niels-Ulrik; Bryant, Donald A

    2004-01-01

    Based upon their photosynthetic nature and the presence of a unique light-harvesting antenna structure, the chlorosome, the photosynthetic green bacteria are defined as a distinctive group in the Bacteria. However, members of the two taxa that comprise this group, the green sulfur bacteria...... (Chlorobi) and the filamentous anoxygenic phototrophic bacteria ("Chloroflexales"), are otherwise quite different, both physiologically and phylogenetically. This review summarizes how genome sequence information facilitated studies of the biosynthesis and function of the photosynthetic apparatus...... a and carotenoid biosynthesis enzymes, gene cluster analysis in Cfx. aurantiacus, and gene inactivation studies in Chl. tepidum. Based on these results, BChl a and BChl c biosynthesis is similar in the two organisms, whereas carotenoid biosynthesis differs significantly. In agreement with its facultative anaerobic...

  7. How nature designs light-harvesting antenna systems: design principles and functional realization in chlorophototrophic prokaryotes

    Science.gov (United States)

    Bryant, Donald A.; Canniffe, Daniel P.

    2018-02-01

    Chlorophyll-based phototrophs, or chlorophototrophs, convert light energy into stored chemical potential energy using two types of photochemical reaction center (RC), denoted type-1 and type-2. After excitation with light, a so-called special pair of chlorophylls in the RC is oxidized, and an acceptor is reduced. To ensure that RCs function at maximal rates in diffuse and variable light conditions, chlorophototrophs have independently evolved diverse light-harvesting antenna systems to rapidly and efficiently transfer that energy to the RCs. Energy transfer between weakly coupled chromophores is generally believed to proceed by resonance energy transfer, a dipole-induced-dipole process that was initially described theoretically by Förster. Nature principally optimizes three parameters in antenna systems: the distance separating the donor and acceptor chromophores, the relative orientations of those chromophores, and the spectral overlap between the donor and the acceptor chromophores. However, there are other important biological parameters that nature has optimized, and some common themes emerge from comparisons of different antenna systems. This tutorial considers structural and functional characteristics of three fundamentally different light-harvesting antenna systems of chlorophotrophic bacteria: phycobilisomes of cyanobacteria, the light-harvesting complexes (LH1 and LH2) of purple bacteria, and chlorosomes of green bacteria. Phycobilisomes are generally considered to represent an antenna system in which the chromophores are weakly coupled, while the strongly coupled bacteriochlorophyll molecules in LH1 and LH2 are strongly coupled and are better described by exciton theory. Chlorosomes can contain up to 250 000 bacteriochlorophyll molecules, which are very strongly coupled and form supramolecular, nanotubular arrays. The general and specific principles that have been optimized by natural selection during the evolution of these diverse light

  8. [The Use of the Objective Structured Clinical Examination for Paediatric residents in the City of Buenos Aires].

    Science.gov (United States)

    Hamui, Magalí; Ferreira, Juan Pablo; Paganini, Agustina; Torres, Fernando; Ossorio, María Fabiana; Yulitta, Horacio; Eiguchi, Kumiko; Ferrero, Fernando

    2016-01-01

    The Objective Structured Clinical Examination (OSCE) is considered the reference standard for competence evaluation, but its use in Latin America is limited. The City of Buenos Aires Government (CBAG) administers a Paediatric residency system that includes 400 residents distributed in 13 hospitals, sharing an admission system and education program. We aim to describe the experience of administering an OSCE for evaluating all the Paediatric residents of the CBAG. Descriptive study, including all paediatric residents of the CBAG, belonging to 13 hospitals (2 paediatric and 11 general), ending their first year of training. The OSCE included 10 stations. Eighty-five residents participated in the OSCE, and 88.2% (95% CI 79.7-93.5) passed the examination. There were no significant differences in the pass rate between residents from paediatric hospitals and from general hospitals (89.5 vs. 85.7%; OR=1.4; 95% CI 0.4-5.5; P=.8). In 2015, the OSCE was administered to all paediatric residents of the CBAG for the first time. This experience allowed identifying weaknesses in the education system, in order to develop strategies to overcome them. Copyright © 2016 Sociedad Chilena de Pediatría. Publicado por Elsevier España, S.L.U. All rights reserved.

  9. Overexpression of functional human oxidosqualene cyclase in Escherichia coli

    DEFF Research Database (Denmark)

    Kürten, Charlotte; Uhlén, Mathias; Syrén, Per-Olof

    2015-01-01

    The generation of multicyclic scaffolds from linear oxidosqualene by enzymatic polycyclization catalysis constitutes a cornerstone in biology for the generation of bioactive compounds. Human oxidosqualene cyclase (hOSC) is a membrane-bound triterpene cyclase that catalyzes the formation of the te......The generation of multicyclic scaffolds from linear oxidosqualene by enzymatic polycyclization catalysis constitutes a cornerstone in biology for the generation of bioactive compounds. Human oxidosqualene cyclase (hOSC) is a membrane-bound triterpene cyclase that catalyzes the formation...... of the tetracyclic steroidal backbone, a key step in cholesterol biosynthesis. Protein expression of hOSC and other eukaryotic oxidosqualene cyclases has traditionally been performed in yeast and insect cells, which has resulted in protein yields of 2.7mg protein/g cells (hOSC in Pichia pastoris) after 48h...... of expression. Herein we present, to the best of our knowledge, the first functional expression of hOSC in the model organism Escherichia coli. Using a codon-optimized gene and a membrane extraction procedure for which detergent is immediately added after cell lysis, a protein yield of 2.9mg/g bacterial cells...

  10. Social inequality in psychological distress among young people in five countries with little economic disparity

    DEFF Research Database (Denmark)

    Nielsen, Line; Damsgaard, Mogens Trab; Meilstrup, Charlotte

    in the family (high, medium, low) and 2) parents’ occupational social class (OSC) measured by father’s and mother’s occupation (highest ranking parent: high, medium, low, unclassifiable). We performed age-adjusted multilevel logistic regression analyses stratified by sex and country. Results The overall country......) for psychological distress was 1.36 (95% CI 1.25-1.48) in the medium FAS-group and 2.07 (95% CI 1.78-2.40) in the low FAS-group. The association appeared in all countries although only significant in Iceland and Sweden (girls only). OSC: The Odds Ratio (OR) for psychological distress was 1.01 (95% CI 0.......89-1.15) in the medium OSC-group, 1.37 (1.24-1.52) in the low OSC-group and 1.66 (95% CI 1.49-1.85) in the unclassifiable OSC-group. For girls this finding was robust and significant across all countries except Sweden. For boys the association was graded but not significant. Implications A socioeconomic gradient...

  11. Surpassing 10% Efficiency Benchmark for Nonfullerene Organic Solar Cells by Scalable Coating in Air from Single Nonhalogenated Solvent

    Energy Technology Data Exchange (ETDEWEB)

    Ye, Long [Department of Physics, Organic and Carbon Electronics Lab (ORaCEL), North Carolina State University, Raleigh NC 27695 USA; Xiong, Yuan [Department of Physics, Organic and Carbon Electronics Lab (ORaCEL), North Carolina State University, Raleigh NC 27695 USA; Zhang, Qianqian [Department of Chemistry, University of North Carolina at Chapel Hill, Chapel Hill NC 27599 USA; Li, Sunsun [Beijing National Laboratory for Molecular Sciences, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100190 P. R. China; Wang, Cheng [Advanced Light Source, Lawrence Berkeley National Laboratory, Berkeley CA 94720 USA; Jiang, Zhang [Advanced Photon Source, Argonne National Laboratory, Argonne IL 60439 USA; Hou, Jianhui [Beijing National Laboratory for Molecular Sciences, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100190 P. R. China; You, Wei [Department of Chemistry, University of North Carolina at Chapel Hill, Chapel Hill NC 27599 USA; Ade, Harald [Department of Physics, Organic and Carbon Electronics Lab (ORaCEL), North Carolina State University, Raleigh NC 27695 USA

    2018-01-10

    The commercialization of nonfullerene organic solar cells (OSCs) relies critically on the response under typical operating conditions (for instance, temperature, humidity) and the ability of scale-up. Despite the rapid increase in power conversion efficiency (PCE) of spin-coated devices fabricated in a protective atmosphere, the device efficiencies of printed nonfullerene OSC devices by blade-coating are still lower than 6%. This slow progress significantly limits the practical printing of high-performance nonfullerene OSCs. Here, a new and stable nonfullerene combination was introduced by pairing a commercially available nonfluorinated acceptor IT-M with the polymeric donor FTAZ. Over 12%-efficiency can be achieved in spincoated FTAZ:IT-M devices using a single halogen-free solvent. More importantly, chlorinefree, in air blade-coating of FTAZ:IT-M is able to yield a PCE of nearly 11%, despite a humidity of ~50%. X-ray scattering results reveal that large π-π coherence lengths, high degree of faceon orientation with respect to the substrate, and small domain spacings of ~20 nm are closely correlated with such high device performance. Our material system and approach yields the highest reported performance for nonfullerene OSC devices by a coating technique approximating scalable fabrication methods and holds great promise for the development of low-cost, low-toxicity, and high-efficiency OSCs by high-throughput production.

  12. Purification of oogonial stem cells from adult mouse and human ovaries: an assessment of the literature and a view toward the future.

    Science.gov (United States)

    Woods, Dori C; White, Yvonne A R; Tilly, Jonathan L

    2013-01-01

    Contemporary claims that mitotically active female germ line or oogonial stem cells (OSCs) exist and support oogenesis during postnatal life in mammals have been debated in the field of reproductive biology since March 2004, when a mouse study posed the first serious challenge to the dogma of a fixed pool of oocytes being endowed at birth in more than 50 years. Other studies have since been put forth that further question the validity of this dogma, including the isolation of OSCs from neonatal and adult mouse ovaries by 4 independent groups using multiple strategies. Two of these groups also reported that isolated mouse OSCs, once transplanted back into ovaries of adult female mice, differentiate into fully functional eggs that ovulate, fertilize, and produce healthy embryos and offspring. Arguably, one of the most significant advances in this emerging field was provided by a new research study published this year, which reported the successful isolation and functional characterization of OSCs from ovaries of reproductive age women. Two commentaries on this latest work, one cautiously supportive and one highly skeptical, were published soon afterward. This article evaluates the current literature regarding postnatal oogenesis in mammals and discusses important next steps for future work on OSC biology and function.

  13. Differentiation of Mouse Ovarian Stem Cells Toward Oocyte-Like Structure by Coculture with Granulosa Cells.

    Science.gov (United States)

    Parvari, Soraya; Yazdekhasti, Hossein; Rajabi, Zahra; Gerayeli Malek, Valliollah; Rastegar, Tayebeh; Abbasi, Mehdi

    2016-11-01

    An increasing body of evidence has confirmed existence and function of ovarian stem cells (OSCs). In this study, a novel approach on differentiation of OSCs into oocyte-like cells (OLCs) has been addressed. Recently, different methods have been recruited to isolate and describe aspects of OSCs, but newer and more convenient strategies in isolation are still growing. Herein, a morphology-based method was used to isolate OSCs. Cell suspension of mouse neonatal ovaries was cultured and formed colonies were harvested mechanically and cultivated on mouse embryonic fibroblasts. For differentiation induction, colonies transferred on inactive granulosa cells. Results showed that cells in colonies were positive for alkaline phosphatase activity and reverse transcription-polymerase chain reaction (RT-PCR) confirmed the pluripotency characteristics of cells. Immunofluorescence revealed a positive signal for OCT4, DAZL, MVH, and SSEA1 in colonies as well. Results of RT-PCR and immunofluorescence confirmed that some OLCs were generated within the germ stem cell (GSCs) colonies. The applicability of morphological selection for isolation of GSCs was verified. This method is easier and more economic than other techniques. Our results demonstrate that granulosa cells were effective in inducing the differentiation of OSCs into OLCs through direct cell-to-cell contacts.

  14. Low-Temperature Preparation of Tungsten Oxide Anode Buffer Layer via Ultrasonic Spray Pyrolysis Method for Large-Area Organic Solar Cells

    Directory of Open Access Journals (Sweden)

    Ran Ji

    2017-07-01

    Full Text Available Tungsten oxide (WO3 is prepared by a low-temperature ultrasonic spray pyrolysis method in air atmosphere, and it is used as an anode buffer layer (ABL for organic solar cells (OSCs. The properties of the WO3 transition metal oxide material as well as the mechanism of ultrasonic spray pyrolysis processes are investigated. The results show that the ultrasonic spray pyrolysized WO3 ABL exhibits low roughness, matched energy level, and high conductivity, which results in high charge transport efficiency and suppressive recombination in OSCs. As a result, compared to the OSCs based on vacuum thermal evaporated WO3, a higher power conversion efficiency of 3.63% is reached with low-temperature ultrasonic spray pyrolysized WO3 ABL. Furthermore, the mostly spray-coated OSCs with large area was fabricated, which has a power conversion efficiency of ~1%. This work significantly enhances our understanding of the preparation and application of low temperature-processed WO3, and highlights the potential of large area, all spray coated OSCs for sustainable commercial fabrication.

  15. Development of a tool to support holistic generic assessment of clinical procedure skills.

    Science.gov (United States)

    McKinley, Robert K; Strand, Janice; Gray, Tracey; Schuwirth, Lambert; Alun-Jones, Tom; Miller, Helen

    2008-06-01

    The challenges of maintaining comprehensive banks of valid checklists make context-specific checklists for assessment of clinical procedural skills problematic. This paper reports the development of a tool which supports generic holistic assessment of clinical procedural skills. We carried out a literature review, focus groups and non-participant observation of assessments with interview of participants, participant evaluation of a pilot objective structured clinical examination (OSCE), a national modified Delphi study with prior definitions of consensus and an OSCE. Participants were volunteers from a large acute teaching trust, a teaching primary care trust and a national sample of National Health Service staff. Results In total, 86 students, trainees and staff took part in the focus groups, observation of assessments and pilot OSCE, 252 in the Delphi study and 46 candidates and 50 assessors in the final OSCE. We developed a prototype tool with 5 broad categories amongst which were distributed 38 component competencies. There was > 70% agreement (our prior definition of consensus) at the first round of the Delphi study for inclusion of all categories and themes and no consensus for inclusion of additional categories or themes. Generalisability was 0.76. An OSCE based on the instrument has a predicted reliability of 0.79 with 12 stations and 1 assessor per station or 10 stations and 2 assessors per station. This clinical procedural skills assessment tool enables reliable assessment and has content and face validity for the assessment of clinical procedural skills. We have designated it the Leicester Clinical Procedure Assessment Tool (LCAT).

  16. [The morphological and immunohistochemical characteristics of changes in the fallopian tube mucosa in ovarian epithelial tumors].

    Science.gov (United States)

    Asaturova, A V; Ezhova, L S; Faizullina, N M; Sannikova, M V; Khabas, G N

    2016-01-01

    to study the incidence of fallopian tube lesions (secretory cell proliferations (SCP), p53 signature, serous tubal intraepithelial lesions (STIL), and serous tubal intraepithelial carcinomas (STIC) in ovarian epithelial tumors and to propose their pathogenetic association with a certain histotype of the ovarian tumor. The investigation enrolled 136 patients with ovarian epithelial tumors, whose fallopian tubes were morphologically and immunohistochemically (IHC) examined using p53, Ki-67, and PAX2. Statistical analysis was carried out applying the Mann-Whitney test and χ(2) test. Lesions meeting the STIC criteria were found in 14.7% of cases (only in ovarian serous carcinoma (OSC)), those suspecting STICs were in 25.7%, and those without signs of STICs were in 59.6%. IFC examination diagnosed STIC in 10% of cases (only in OSC), STIL in 13.3%, p53 signature in 11.7% (only in serous tumors), and the normal/reactively changed tubal epithelium in 65%. The incidence of STILs correlated with the malignant potential of serous tumors significantly (pSTIC and high-grade OSC and revealed significant differences in the incidence of other fallopian tubal intraepithelial lesions in serous cystadenomas, borderline tumors, and OSC, in different ovarian carcinomas. The findings may suggest that the earliest stage in the pathogenesis of OSC is the development of SCP, followed by the formation of p53 signatures that may further give rise to STIL, and finally STC (due to the acquisition of additional mutations).

  17. An Unfused-Core-Based Nonfullerene Acceptor Enables High-Efficiency Organic Solar Cells with Excellent Morphological Stability at High Temperatures.

    Science.gov (United States)

    Li, Shuixing; Zhan, Lingling; Liu, Feng; Ren, Jie; Shi, Minmin; Li, Chang-Zhi; Russell, Thomas P; Chen, Hongzheng

    2018-02-01

    Most nonfullerene acceptors developed so far for high-performance organic solar cells (OSCs) are designed in planar molecular geometry containing a fused-ring core. In this work, a new nonfullerene acceptor of DF-PCIC is synthesized with an unfused-ring core containing two cyclopentadithiophene (CPDT) moieties and one 2,5-difluorobenzene (DFB) group. A nearly planar geometry is realized through the F···H noncovalent interaction between CPDT and DFB for DF-PCIC. After proper optimizations, the OSCs with DF-PCIC as the acceptor and the polymer PBDB-T as the donor yield the best power conversion efficiency (PCE) of 10.14% with a high fill factor of 0.72. To the best of our knowledge, this efficiency is among the highest values for the OSCs with nonfullerene acceptors owning unfused-ring cores. Furthermore, no obvious morphological changes are observed for the thermally treated PBDB-T:DF-PCIC blended films, and the relevant devices can keep ≈70% of the original PCEs upon thermal treatment at 180 °C for 12 h. This tolerance of such a high temperature for so long time is rarely reported for fullerene-free OSCs, which might be due to the unique unfused-ring core of DF-PCIC. Therefore, the work provides new idea for the design of new nonfullerene acceptors applicable in commercial OSCs in the future. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Fully coupled opto-electronic modelling of organic solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Reinke, Nils A.; Haeusermann, Roger; Huber, Evelyne; Moos, Michael [ZHAW, Institute of Comp. Physics (Germany); Flatz, Thomas [Fluxim AG (Switzerland); Ruhstaller, Beat [ZHAW, Institute of Comp. Physics (Germany); Fluxim AG (Switzerland)

    2009-07-01

    Record solar power conversion efficiencies of up to 5.5 % for single junction organic solar cells (OSC) are encouraging but still inferior to values of inorganic solar cells. For further progress, a detailed analysis of the mechanisms that limit the external quantum efficiency is crucial. It is widely believed that the device physics of OSCs can be reduced to the processes, which take place at the donor/acceptor-interface. Neglecting transport, trapping and ejection of charge carriers at the electrodes raises the question of the universality of such a simplification. In this study we present a fully coupled opto-electronic simulator, which calculates the spatial and spectral photon flux density inside the OSC, the formation of the charge transfer state and its dissociation into free charge carriers. Our simulator solves the drift- diffusion equations for the generated charge carriers as well as their ejection at the electrodes. Our results are in good agreement with both steady-state and transient OSC characteristics. We address the influence of physical quantities such as the optical properties, film-thicknesses, the recombination rate and charge carrier mobilities on performance figures. For instance the short circuit current can be enhanced by 15% to 25% when using a silver instead of an aluminium cathode. Our simulations lead to rules of thumb, which help to optimise a given OSC structure.

  19. Interplay between efficiency and device architecture for small molecule organic solar cells.

    Science.gov (United States)

    Williams, Graeme; Sutty, Sibi; Aziz, Hany

    2014-06-21

    Small molecule organic solar cells (OSCs) have experienced a resurgence of interest over their polymer solar cell counterparts, owing to their improved batch-to-batch (thus, cell-to-cell) reliability. In this systematic study on OSC device architecture, we investigate five different small molecule OSC structures, including the simple planar heterojunction (PHJ) and bulk heterojunction (BHJ), as well as several planar-mixed structures. The different OSC structures are studied over a wide range of donor:acceptor mixing concentrations to gain a comprehensive understanding of their charge transport behavior. Transient photocurrent decay measurements provide crucial information regarding the interplay between charge sweep-out and charge recombination, and ultimately hint toward space charge effects in planar-mixed structures. Results show that the BHJ/acceptor architecture, comprising a BHJ layer with high C60 acceptor content, generates OSCs with the highest performance by balancing charge generation with charge collection. The performance of other device architectures is largely limited by hole transport, with associated hole accumulation and space charge effects.

  20. Low-Temperature Preparation of Tungsten Oxide Anode Buffer Layer via Ultrasonic Spray Pyrolysis Method for Large-Area Organic Solar Cells.

    Science.gov (United States)

    Ji, Ran; Zheng, Ding; Zhou, Chang; Cheng, Jiang; Yu, Junsheng; Li, Lu

    2017-07-18

    Tungsten oxide (WO₃) is prepared by a low-temperature ultrasonic spray pyrolysis method in air atmosphere, and it is used as an anode buffer layer (ABL) for organic solar cells (OSCs). The properties of the WO₃ transition metal oxide material as well as the mechanism of ultrasonic spray pyrolysis processes are investigated. The results show that the ultrasonic spray pyrolysized WO₃ ABL exhibits low roughness, matched energy level, and high conductivity, which results in high charge transport efficiency and suppressive recombination in OSCs. As a result, compared to the OSCs based on vacuum thermal evaporated WO₃, a higher power conversion efficiency of 3.63% is reached with low-temperature ultrasonic spray pyrolysized WO₃ ABL. Furthermore, the mostly spray-coated OSCs with large area was fabricated, which has a power conversion efficiency of ~1%. This work significantly enhances our understanding of the preparation and application of low temperature-processed WO₃, and highlights the potential of large area, all spray coated OSCs for sustainable commercial fabrication.

  1. Undergraduate psychiatry students' attitudes towards teaching methods at an Irish university.

    Science.gov (United States)

    Jabbar, F; Casey, P; Kelly, B D

    2016-11-01

    At University College Dublin, teaching in psychiatry includes clinical electives, lectures, small-group and problem-based teaching, consistent with international trends. To determine final-year psychiatry students' attitudes towards teaching methods. We distributed questionnaires to all final-year medical students in two classes (2008 and 2009), after final psychiatry examination (before results) and all of them participated (n = 111). Students' interest in psychiatry as a career increased during psychiatry teaching. Students rated objective structured clinical examination (OSCE) as the most useful element of teaching and examination. The most common learning style was "reflector"; the least common was "pragmatist". Two thirds believed teaching could be improved (increased patient contact) and 89 % reported that experience of psychiatry changed attitudes towards mental illness (increased understanding). Students' preference for OSCEs may reflect the closeness of OSCE as a form of learning to OSCE as a form of assessment: OSCEs both focus on specific clinical skills and help prepare for examinations. Future research could usefully examine the extent to which these findings are university-specific or instructor-dependent. Information on the consistency of various teaching, examination and modularisation methods would also be useful.

  2. The objective structured clinical examination revisited for postgraduate trainees in general practice.

    Science.gov (United States)

    Schoenmakers, Birgitte; Wens, Johan

    2014-03-04

    To investigate if the psychometric qualities of an OSCE consisting of more complex simulated patient encounters remain valid and reliable in the assessment of postgraduate trainees in general practice. In this intervention study without control group, the traditional OSCE was formally replaced by the new, complex version. The study population was composed by all postgraduate trainees (second and third phase) in general practice during the ongoing academic year. Data were handled and collected as part of the formal assessment program. Univariate analyses, the variance of scores and multivariate analyses were performed to assess the test qualities. A total of 340 students participated. Average final scores were slightly higher for third-phase students (t-test, p =0.05). Overall test scores were equally distributed on station level, circuit level and phase level. A multiple regression analysis revealed that test scores were dependent on the stations and circuits, but not on the master phase. In a changing learning environment, assessment and evaluation strategies require reorientation. The reliability and validity of the OSCE remain subject to discussion. In particular, when it comes to content and design, the traditional OSCE might underestimate the performance level of postgraduate trainees in general practice. A reshaping of this OSCE to a more sophisticated design with more complex patient encounters appears to restore the validity of the test results.

  3. Near-peer education: a novel teaching program.

    Science.gov (United States)

    de Menezes, Sara; Premnath, Daphne

    2016-05-30

    This study aims to: 1) Evaluate whether a near-peer program improves perceived OSCE performance; 2) Identify factors motivating students to teach; 3) Evaluate role of near-peer teaching in medical education. A near-peer OSCE teaching program was implemented at Monash University's Peninsula Clinical School over the 2013 academic year. Forty 3rd-year and thirty final-year medical students were recruited as near-peer learners and educators, respectively. A post-program questionnaire was completed by learners prior to summative OSCEs (n=31), followed by post-OSCE focus groups (n=10). Near-peer teachers were interviewed at the program's conclusion (n=10). Qualitative data was analysed for emerging themes to assess the perceived value of the program. Learners felt peer-led teaching was more relevant to assessment, at an appropriate level of difficulty and delivered in a less threatening environment than other methods of teaching. They valued consistent practice and felt confident approaching their summative OSCEs. Educators enjoyed the opportunity to develop their teaching skills, citing mutual benefit and gratitude to past peer-educators as strong motivators to teach others. Near-peer education, valued by near-peer learners and teachers alike, was a useful method to improve preparation and perceived performance in summative examinations. In particular, a novel year-long, student-run initiative was regarded as a valuable and feasible adjunct to faculty teaching.

  4. Highly sensitive ratiometric detection of heparin and its oversulfated chondroitin sulfate contaminant by fluorescent peptidyl probe.

    Science.gov (United States)

    Mehta, Pramod Kumar; Lee, Hyeri; Lee, Keun-Hyeung

    2017-05-15

    The selective and sensitive detection of heparin, an anticoagulant in clinics as well as its contaminant oversulfated chondroitin sulfate (OSCS) is of great importance. We first reported a ratiometric sensing method for heparin as well as OSCS contaminants in heparin using a fluorescent peptidyl probe (Pep1, pyrene-GSRKR) and heparin-digestive enzyme. Pep1 exhibited a highly sensitive ratiometric response to nanomolar concentration of heparin in aqueous solution over a wide pH range (2~11) and showed highly selective ratiometric response to heparin among biological competitors such as hyaluronic acid and chondroitin sulfate. Pep1 showed a linear ratiometric response to nanomolar concentrations of heparin in aqueous solutions and in human serum samples. The detection limit for heparin was calculated to be 2.46nM (R 2 =0.99) in aqueous solutions, 2.98nM (R 2 =0.98) in 1% serum samples, and 3.43nM (R 2 =0.99) in 5% serum samples. Pep1 was applied to detect the contaminated OSCS in heparin with heparinase I, II, and III, respectively. The ratiometric sensing method using Pep1 and heparinase II was highly sensitive, fast, and efficient for the detection of OSCS contaminant in heparin. Pep1 with heparinase II could detect as low as 0.0001% (w/w) of OSCS in heparin by a ratiometric response. Copyright © 2017 Elsevier B.V. All rights reserved.

  5. Randomized trial of teaching brief motivational interviewing to pediatric trainees to promote healthy behaviors in families.

    Science.gov (United States)

    Lozano, Paula; McPhillips, Heather A; Hartzler, Bryan; Robertson, Andrea S; Runkle, Cecilia; Scholz, Kelley A; Stout, James W; Kieckhefer, Gail M

    2010-06-01

    That pediatric resident trainees would demonstrate increased counseling skill following training in brief motivational interviewing (MI). Randomized controlled trial. University of Washington Pediatric Residency. Pediatric residents (N = 18), including residents in postgraduate years 1, 2, 3, and 4. Collaborative Management in Pediatrics, a 9-hour behavior change curriculum based on brief MI plus written feedback on communication skills (based on a 3-month Objective Standardized Clinical Evaluation [OSCE]). The percentage of MI-consistent behavior (%MICO), a summary score for MI skill, was assessed via OSCEs in which standardized patients portray parents of children with asthma in 3 clinical scenarios (stations). The OSCEs were conducted at baseline and 3 and 7 months. Blinded coders rated videotaped OSCEs using a validated tool to tally communication behaviors. Training effects were assessed using linear regression controlling for baseline %MICO. Global ratings of counseling style served as secondary outcome measures. Trained residents demonstrated a trend toward increased skill (%MICO score) at 3 months compared with control residents. At 7 months, %MICO scores increased 16% to 20% (P < .02) across all OSCE stations after the combined intervention of Collaborative Management in Pediatrics training plus written feedback. The effect of training on global ratings supported the main findings. Pediatric trainees' skills in behavior change counseling improved following the combination of training in brief MI plus personalized feedback.

  6. Study of interface layer effect in organic solar cells by electric-field-induced optical second-harmonic generation measurement

    Energy Technology Data Exchange (ETDEWEB)

    Taguchi, Dai; Sumiyoshi, Ryota; Chen, Xiangyu; Manaka, Takaaki; Iwamoto, Mitsumasa, E-mail: iwamoto@pe.titech.ac.jp

    2014-03-03

    By using electric-field-induced optical second-harmonic generation (EFISHG) measurement, we studied the effect of the use of bathocuproine (BCP) interface layer. The EFISHG measurements of indium–zinc–oxide (IZO)/C{sub 60}/Al diodes showed that the BCP layer inserted between C{sub 60} and Al formed an electrostatic field |E{sub i}| = 2.5 × 10{sup 4} V/cm in the C{sub 60} layer, pointing in a direction from the Al to the IZO. Accordingly, in the IZO/pentacene/C{sub 60}/BCP/Al organic solar cells (OSCs), holes (electrons) move to the IZO (Al) electrode, enhancing the short-circuit current. The EFISHG measurement is capable of directly probing internal fields in the layers used for OSCs, and is helpful for studying the contribution of the interface layer in OSCs. - Highlights: • Internal field in organic solar cells (OSCs) were directly probed. • Interface layer formed internal electric field, enhancing the OSC performance. • Maxwell–Wagner effect accounts for the internal electric field formation.

  7. Agarose-gel electrophoresis for the quality assurance and purity of heparin formulations.

    Science.gov (United States)

    Volpi, Nicola; Buzzega, Dania

    2012-01-01

    The adulteration of raw heparin (Hep) with a synthetic oversulfated chondroitin sulfate (OSCS) not found in nature produced in 2007-2008 a global crisis giving rise to the development of additional, new and specific methods for its quality assurance and purity. In this study, a simple and sensitive agarose-gel electrophoresis method has been developed for the visualization of OSCS in Hep samples along with other natural glycosaminoglycans possibly present as "process-related impurities", in particular dermatan sulfate (DS) and chondroitin sulfate (CS). Agarose-gel electrophoresis under non-conventional conditions is able to separate OSCS from Hep with its two components, the slow-moving and fast-moving species, DS and CS by performing separation for 15 h (overnight) and under high voltage (100 mA, ∼200 V). Densitometric scanning enabled us to calculate a limit of detection of ∼0.5 μg OSCS with a linear behaviour from 0.1 to 5 μg, comparable to CS/DS. Contaminated samples from Hep manufacturers were analyzed and quantitative data were found comparable to previous studies. Due to its capacity to process many samples in a single run and to the equipment commonly available in laboratories, this analytical method would be suitable for the identification and quantification of contamination by other polysaccharides, in particular OSCS and DS, within Hep preparations and formulations. Copyright © 2012 Elsevier B.V. All rights reserved.

  8. 4P-NPD ultra thin-films as efficient exciton blocking layers in DBP/C70 based organic solar cells

    DEFF Research Database (Denmark)

    Patil, Bhushan Ramesh; Liu, Yiming; Qamar, Talha

    2017-01-01

    Exciton blocking effects from ultra thin layers of N,N'-di-1-naphthalenyl-N,N'-diphenyl [1,1':4',1'':4'',1'''-quaterphenyl]-4,4'''-diamine (4P-NPD) was investigated in small molecule based inverted Organic Solar Cells (OSCs) using Tetraphenyldibenzoperiflanthene (DBP) as the electron donor material...... and fullerene (C70) as the electron acceptor material. The short-circuit current density (Jsc) and PCE of the optimized OSCs with 0.7 nm thick 4P-NPD were approx. 16 % and 24 % higher, respectively, compared to reference devices without exciton blocking layers. Drift diffusion based device modeling...... was conducted to model the full Current density – Voltage (JV) characteristics and EQE spectrum of the OSCs, and photoluminescence measurements was conducted to investigate the exciton blocking effects with increasing thicknesses of the 4P-NPD layer. Importantly, coupled optical and electrical modeling studies...

  9. Osteopathia striata congenita with cranial sclerosis and intellectual disability due to contiguous gene deletions involving the WTX locus

    DEFF Research Database (Denmark)

    Holman, Sk; Morgan, T; Baujat, G

    2013-01-01

    Osteopathia striata congenita with cranial sclerosis (OSCS) is a skeletal dysplasia caused by germline deletions of or truncating point mutations in the X-linked gene WTX (FAM123B, AMER1). Females present with longitudinal striations of sclerotic bone along the long axis of long bones and cranial...... sclerosis, with a high prevalence of cleft palate and hearing loss. Intellectual disability or neurodevelopmental delay is not observed in females with point mutations in WTX leading to OSCS. One female has been described with a deletion spanning multiple neighbouring genes suggesting that deletion of some...... neighbouring loci may result in abnormal neurodevelopment. In this cohort of 13 females with OSCS resulting from deletions of WTX, a relationship is observed where deletion of ARHGEF9 and/or MTMR8 in conjunction with WTX results in an additional neurodevelopmental phenotype whereas deletion of ASB12 along...

  10. Augmented reality (AR and virtual reality (VR applied in dentistry

    Directory of Open Access Journals (Sweden)

    Ta-Ko Huang

    2018-04-01

    Full Text Available The OSCE is a reliable evaluation method to estimate the preclinical examination of dental students. The most ideal assessment for OSCE is used the augmented reality simulator to evaluate. This literature review investigated a recently developed in virtual reality (VR and augmented reality (AR starting of the dental history to the progress of the dental skill. As result of the lacking of technology, it needs to depend on other device increasing the success rate and decreasing the risk of the surgery. The development of tracking unit changed the surgical and educational way. Clinical surgery is based on mature education. VR and AR simultaneously affected the skill of the training lesson and navigation system. Widely, the VR and AR not only applied in the dental training lesson and surgery, but also improved all field in our life. Keywords: OSCE, Dental simulator, Augmented reality, Virtual reality, Dentistry

  11. A Review on Anodic Aluminum Oxide Methods for Fabrication of Nanostructures for Organic Solar Cells

    DEFF Research Database (Denmark)

    Goszczak, Arkadiusz Jaroslaw; Cielecki, Pawel Piotr

    2018-01-01

    Implementation of nanostructures into the organic solar cell (OSC) architecture has great influence on the device performance. Nanostructuring the active layer increases the interfacial area between donor and acceptor, which enhances the probability of exciton dissociation. Introduction of nanost......Implementation of nanostructures into the organic solar cell (OSC) architecture has great influence on the device performance. Nanostructuring the active layer increases the interfacial area between donor and acceptor, which enhances the probability of exciton dissociation. Introduction......, low fabrication cost and easy control over its nano-scale morphology, make AAO patterning methods an intriguing candidate for nanopatterning. Hence, in this work, we present a review on the fabrication techniques and on nanostructures from Anodic Aluminum Oxide (AAO) for OSC applications...

  12. Nanostructures for Organic Solar Cells

    DEFF Research Database (Denmark)

    Goszczak, Arkadiusz Jarosław

    2016-01-01

    The experimental work in this thesis is focused on the fabrication of nanostructures that can be implemented in organic solar cell (OSC) architecture for enhancement of the device performance. Solar devices made from organic material are gaining increased attention, compared to their inorganic...... counterparts, due to the promising advantages, such as transparency, flexibility, ease of processing etc. But their efficiencies cannot be compared to the inorganic ones. Boosting the efficiency of OSCs by nanopatterning has thus been puzzling many researchers within the past years. Therefore various methods...... have been proposed to be used for developing efficient nanostructures for OSC devices such as, plasmonic structures, nanowires (NWs), gratings, nanorods etc. The nanostructuring methods applied though, do not offer the possibility of a cheap, rapid, reproducible and scalable fabrication. It is the aim...

  13. Effect of organic small-molecule hole injection materials on the performance of inverted organic solar cells

    Science.gov (United States)

    Li, Jie; Zheng, Yifan; Zheng, Ding; Yu, Junsheng

    2016-07-01

    In this study, the influence of small-molecule organic hole injection materials on the performance of organic solar cells (OSCs) as the hole transport layer (HTL) with an architecture of ITO/ZnO/P3HT:PC71BM/HTL/Ag has been investigated. A significant enhancement on the performance of OSCs from 1.06% to 2.63% is obtained by using N, N‧-bis(1-naphthalenyl)-N, N‧-bis-phenyl-(1, 1‧-biphenyl)-4, 4‧-diamine (NPB) HTL. Through the resistance simulation and space-charge limited current analysis, we found that NPB HTL cannot merely improve the hole mobility of the device but also form the Ohmic contact between the active layer and anode. Besides, when we apply mix HTL by depositing the NPB on the surface of molybdenum oxide, the power conversion efficiency of OSC are able to be further improved to 2.96%.

  14. Use of Simulation to Integrate Cultural Humility Into Advanced Health Assessment for Nurse Practitioner Students.

    Science.gov (United States)

    Ndiwane, Abraham N; Baker, Nancy C; Makosky, Antonia; Reidy, Patricia; Guarino, Anthony J

    2017-09-01

    Increasing cultural humility among nursing students requires the application of knowledge and skills. The integration of an Objective Structured Clinical Examination (OSCE) offered nurse practitioner students practice in simulation. This learning activity included pre- and postassessments of knowledge regarding cultural issues and level of student satisfaction. Course content included an exemplar video and a simulation interview with an African American standardized patient. Of the 65 students enrolled, 97% completed OSCE interviews and 81% completed pre- and postsurveys. A 2-domain 3 × 2-time within-subjects ANOVA indicated a statistically significant interaction effect, reinforced by descriptive statistics. Follow-up paired t tests detected a significantly large knowledge increase. Standardized patient scenarios scored highest for satisfaction, followed by critical thinking, and with self-confidence scoring lowest. The favorable knowledge outcomes from this teaching intervention support future applications of OSCE methodology for teaching sensitive cross-cultural content. [J Nurs Educ. 2017;56(9):567-571.]. Copyright 2017, SLACK Incorporated.

  15. Assessment of pharmacy students' communication competence using the Roter Interaction Analysis System during objective structured clinical examinations.

    Science.gov (United States)

    Kubota, Yoshie; Yano, Yoshitaka; Seki, Susumu; Takada, Kaori; Sakuma, Mio; Morimoto, Takeshi; Akaike, Akinori; Hiraide, Atsushi

    2011-04-11

    To determine the value of using the Roter Interaction Analysis System during objective structured clinical examinations (OSCEs) to assess pharmacy students' communication competence. As pharmacy students completed a clinical OSCE involving an interview with a simulated patient, 3 experts used a global rating scale to assess students' overall performance in the interview, and both the student's and patient's languages were coded using the Roter Interaction Analysis System (RIAS). The coders recorded the number of utterances (ie, units of spoken language) in each RIAS category. Correlations between the raters' scores and the number and types of utterances were examined. There was a significant correlation between students' global rating scores on the OSCE and the number of utterances in the RIAS socio-emotional category but not the RIAS business category. The RIAS proved to be a useful tool for assessing the socio-emotional aspect of students' interview skills.

  16. Reduction of Charge Traps and Stability Enhancement in Solution-Processed Organic Field-Effect Transistors Based on a Blended n-Type Semiconductor.

    Science.gov (United States)

    Campos, Antonio; Riera-Galindo, Sergi; Puigdollers, Joaquim; Mas-Torrent, Marta

    2018-05-09

    Solution-processed n-type organic field-effect transistors (OFETs) are essential elements for developing large-area, low-cost, and all organic logic/complementary circuits. Nonetheless, the development of air-stable n-type organic semiconductors (OSCs) lags behind their p-type counterparts. The trapping of electrons at the semiconductor-dielectric interface leads to a lower performance and operational stability. Herein, we report printed small-molecule n-type OFETs based on a blend with a binder polymer, which enhances the device stability due to the improvement of the semiconductor-dielectric interface quality and a self-encapsulation. Both combined effects prevent the fast deterioration of the OSC. Additionally, a complementary metal-oxide semiconductor-like inverter is fabricated depositing p-type and n-type OSCs simultaneously.

  17. High-performance ternary blend polymer solar cells involving both energy transfer and hole relay processes.

    Science.gov (United States)

    Lu, Luyao; Chen, Wei; Xu, Tao; Yu, Luping

    2015-06-04

    The integration of multiple materials with complementary absorptions into a single junction device is regarded as an efficient way to enhance the power conversion efficiency (PCE) of organic solar cells (OSCs). However, because of increased complexity with one more component, only limited high-performance ternary systems have been demonstrated previously. Here we report an efficient ternary blend OSC with a PCE of 9.2%. We show that the third component can reduce surface trap densities in the ternary blend. Detailed studies unravel that the improved performance results from synergistic effects of enlarged open circuit voltage, suppressed trap-assisted recombination, enhanced light absorption, increased hole extraction, efficient energy transfer and better morphology. The working mechanism and high device performance demonstrate new insights and design guidelines for high-performance ternary blend solar cells and suggest that ternary structure is a promising platform to boost the efficiency of OSCs.

  18. Sweep time performance of optic streak camera

    International Nuclear Information System (INIS)

    Wang Zhebin; Yang Dong; Zhang Huige

    2012-01-01

    The sweep time performance of the optic streak camera (OSC) is of critical importance to its application. The systematic analysis of full-screen sweep velocity shows that the traditional method based on the averaged velocity and its nonlinearity would increase the uncertainty of sweep time and can not reflect the influence of the spatial distortion of OSC. A elaborate method for sweep time has been developed with the aid of full-screen sweep velocity and its uncertainty. It is proved by the theoretical analysis and experimental study that the method would decrease the uncertainty of sweep time within 1%, which would improve the accuracy of sweep time and the reliability of OSC application. (authors)

  19. A Review of Organic Photovoltaic Energy Source and Its Technological Designs

    Directory of Open Access Journals (Sweden)

    Egidius Rutatizibwa Rwenyagila

    2017-01-01

    Full Text Available This study reviews and describes some of the existing research and mechanisms of operation of organic photovoltaic (OPV cells. Introduced first are problems that exist with traditional fossil fuels that result in most of the world energy challenges such as environmental pollution. This is followed by the description of baseline organic solar cell (OSC structures and materials. Then, some of the existing modelling approaches that have implemented either a one- or a two-dimensional drift-diffusion model to examine OSC structures are reviewed, and their reproducibility is examined. Both experimental and modelling approaches reviewed are particularly important for more and better designed research to probe practical procedural problems associated with OSCs that hinder the commercialization of OPV technology.

  20. Selective observation of photo-induced electric fields inside different material components in bulk-heterojunction organic solar cell

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Xiangyu; Taguchi, Dai; Manaka, Takaaki; Iwamoto, Mitsumasa, E-mail: iwamoto@pe.titech.ac.jp [Department of Physical Electronics, Tokyo Institute of Technology, 2-12-1, S3-33 O-okayama, Meguro-ku, Tokyo 152-8552 (Japan)

    2014-01-06

    By using electric-field-induced optical second-harmonic generation (EFISHG) measurement at two laser wavelengths of 1000 nm and 860 nm, we investigated carrier behavior inside the pentacene and C{sub 60} component of co-deposited pentacene:C{sub 60} bulk-heterojunctions (BHJs) organic solar cells (OSCs). The EFISHG experiments verified the presence of two carrier paths for electrons and holes in BHJs OSCs. That is, two kinds of electric fields pointing in opposite directions are identified as a result of the selectively probing of SHG activation from C{sub 60} and pentacene. Also, under open-circuit conditions, the transient process of the establishment of open-circuit voltage inside the co-deposited layer has been directly probed, in terms of photovoltaic effect. The EFISHG provides an additional promising method to study carrier path of electrons and holes as well as dissociation of excitons in BHJ OSCs.

  1. La traducción de los valores democráticos en la participación organizativa de la sociedad civil: un estudios de caso entre México e Italia

    Directory of Open Access Journals (Sweden)

    Imke Hindrichs

    2011-01-01

    Full Text Available En este artículo se aborda el tema de la participación democrática al interior de las organizaciones de la sociedad civil (OSC desde el punto de vista de la psicología organizacional. En la primera parte se estudia la democracia como horizonte e imperativo en las OSC. Además, se plantea la referencia al liderazgo transformacional y al fortalecimiento como dimensiones útiles para el estudio y la mejora de culturas organizativas democráticas en las OSC. En la segunda parte se presenta un ánalisis cualitativo con base en el método del template analysis, como lectura de dos culturas organizativas en México e Italia vinculadas con las experiencias del movimiento de comercio justo.

  2. Use of Portable Digital Devices to Analyze Autonomic Stress Response in Psychology Objective Structured Clinical Examination.

    Science.gov (United States)

    Beltrán-Velasco, Ana Isabel; Bellido-Esteban, Alberto; Ruisoto-Palomera, Pablo; Clemente-Suárez, Vicente Javier

    2018-01-12

    The aim of the present study was to explore changes in the autonomic stress response of Psychology students in a Psychology Objective Structured Clinical Examination (OSCE) and their relationship with OSCE performance. Variables of autonomic modulation by the analysis of heart rate variability in temporal, frequency and non-linear domains, subjective perception of distress strait and academic performance were measured before and after the two different evaluations that composed the OSCE. A psychology objective structured clinical examination composed by two different evaluation scenarios produced a large anxiety anticipatory response, a habituation response in the first of the evaluation scenarios and a in the entire evaluation, and a no habituation response in the second evaluation scenario. Autonomic modulation parameters do not correlate with academic performance of students.

  3. Evaluation of clinical skills for first-year surgical residents using orientation programme and objective structured clinical evaluation as a tool of assessment

    Directory of Open Access Journals (Sweden)

    Pandya J

    2010-01-01

    Full Text Available Background: Postgraduate specialities require a combination of knowledge and clinical skills. The internship year is less structured. Clinical and practical skills that are picked up during training are not well regulated and the impact is not assessed. In this study, we assessed knowledge and skills using objective structured clinical examination (OSCE. Aim: To evaluate the clinical skills of new first-year surgical residents using orientation programme and OSCE as a tool for assessment. Settings and Design: Observational study. Materials and Methods: Twenty new first-year surgical residents (10 each in 2008 and 2009 participated in a detailed structured orientation programme conducted over a period of 7 days. Clinically important topics and skills expected at this level (e.g., suturing, wound care etc. were covered. The programme was preceded by an OSCE to test pre-programme knowledge (the "pre-test". The questions were validated by senior department staff. A post-programme OSCE (the "post-test" helped to evaluate the change in clinical skill level brought about by the orientation programme. Statistical Analysis: Wilcoxson matched-pairs signed-ranks test. Results: Passing performance was achieved by all participants in both pre- and post-tests. Following the orientation programme, significant improvement was seen in tasks testing the psychomotor and cognitive domains. (P = 0.0001 and P = 0.0401, respectively. Overall reliability of the OSCE was found to be 0.7026 (Cronbach′s coefficient alpha. Conclusions: This study highlighted the lacunae in current internship training, especially for skill-based tasks. There is a need for universal inclusion of structured orientation programmes in the training of first-year residents. OSCE is a reliable, valid and effective method for the assessment of clinical skills.

  4. Cloning and Functional Characterization of Cycloartenol Synthase from the Red Seaweed Laurencia dendroidea.

    Directory of Open Access Journals (Sweden)

    Gabriela Calegario

    Full Text Available The red seaweed Laurencia dendroidea belongs to the Rhodophyta, a phylum of eukaryotic algae that is widely distributed across the oceans and that constitute an important source of bioactive specialized metabolites. Laurencia species have been studied since 1950 and were found to contain a plethora of specialized metabolites, mainly halogenated sesquiterpenes, diterpenes and triterpenes that possess a broad spectrum of pharmacological and ecological activities. The first committed step in the biosynthesis of triterpenes is the cyclization of 2,3-oxidosqualene, an enzymatic reaction carried out by oxidosqualene cyclases (OSCs, giving rise to a broad range of different compounds, such as the sterol precursors cycloartenol and lanosterol, or triterpene precursors such as cucurbitadienol and β-amyrin. Here, we cloned and characterized the first OSC from a red seaweed. The OSC gene was identified through mining of a L. dendroidea transcriptome dataset and subsequently cloned and heterologously expressed in yeast for functional characterization, which indicated that the corresponding enzyme cyclizes 2,3-oxidosqualene to the sterol precursor cycloartenol. Accordingly, the gene was named L. dendroidea cycloartenol synthase (LdCAS. A phylogenetic analysis using OSCs genes from plants, fungi and algae revealed that LdCAS grouped together with OSCs from other red algae, suggesting that cycloartenol could be the common product of the OSC in red seaweeds. Furthermore, profiling of L. dendroidea revealed cholesterol as the major sterol accumulating in this species, implicating red seaweeds contain a 'hybrid' sterol synthesis pathway in which the phytosterol precursor cycloartenol is converted into the major animal sterol cholesterol.

  5. Multiple mini-interview as a predictor of performance in the objective structured clinical examination among Physician Associates in the United Kingdom: a cohort study

    Science.gov (United States)

    Kumar, Narendra; Bhardwaj, Shailaja; Rahman, Eqram

    2018-01-01

    Introduction Patient satisfaction and health care outcomes are directly linked to useful communication skills. Therefore, excellent interpersonal skills are imperative for health care professionals. Multiple mini-interview (MMI) is designed as a selection tool to assess the communication skills of applicants in medical schools during the admission process. However, objective structured clinical examination (OSCE) assesses students’ communication and clinical skills at the end of their academic terms. Recently, Anglia Ruskin University, Chelmsford, UK, adopted MMI in the selection process for the first cohort of MSc Physician Associate trainees for the academic year 2015–2016. This study aimed to determine the likelihood of MMI as a predictor of future performance of communication skills in the OSCE. Materials and methods The anonymous data of the average scores of communication skills attained in MMI and OSCE at the end of year 1 were collected for 30 students from the Physician Associate program team. Subsequently, Pearson’s correlation was computed to determine the relationship between the average scores of communication skills attained in MMI, and OSCE during trimester 2 and trimester 3 by the Physician Associate trainees. Results The study showed positive correlation between the scores of communication skills attained in MMI and OSCE during trimester 2 (r=0.956, n=30, p<0.001) and trimester 3 (r=0.966, n=30, p<0.001). Conclusion The study provides empirical evidence for the validity of MMI as a predictor of future performance of Physician Associate trainees’ communication skills during subsequent OSCEs. PMID:29695944

  6. Impact of night shifts on emergency medicine resident resuscitation performance.

    Science.gov (United States)

    Edgerley, Sarah; McKaigney, Conor; Boyne, Devon; Ginsberg, Darrell; Dagnone, J Damon; Hall, Andrew K

    2018-03-12

    Emergency medicine (EM) trainees often work nightshifts. We sought to measure how this circadian disruption affects EM resident performance during simulated resuscitations. This retrospective cohort study enrolled EM residents at a single Canadian academic centre over a six-year period. Residents completed twice-annual simulation-based resuscitation-focused objective structured clinical examinations (OSCEs) with assessment in four domains (primary assessment, diagnostic actions, therapeutic actions and communication), and a global assessment score (GAS). Primary and secondary exposures of interest were the presence of a nightshift (late-evening shifts ending between midnight and 03h00 or overnight shifts ending after 06h00) the day before or within three days before an OSCE. A random effects linear regression model was used to quantify the association between nightshifts and OSCE scores. From 57 residents, 136 OSCE scores were collected. Working a nightshift the day before an OSCE did not affect male trainee scores but was associated with a significant absolute decrease in mean total scores (-6% [95% CI -12% to 0%]), GAS (-7% [-13% to 0%]), and communication (-9% [-16% to -2%]) scores among women. Working any nightshift within three days before an OSCE lowered absolute mean total scores by 4% [-7% to 0%] and communication scores by 5% [-5% to 0%] irrespective of gender. Our results suggest that shift work may impact EM resident resuscitation performance, particularly in the communication domain. This impact may be more significant in women than men, suggesting a need for further investigation. Copyright © 2018 Elsevier B.V. All rights reserved.

  7. Self-regulated learning strategies used in surgical clerkship and the relationship with clinical achievement.

    Science.gov (United States)

    Turan, Sevgi; Konan, Ali

    2012-01-01

    Self-regulated learning indicates students' skills in controlling their own learning. Self-regulated learning, which a context-specific process, emphasizes autonomy and control. Students gain more autonomy with respect to learning in the clinical years. Examining the self-regulated learning skills of students in this period will provide important clues about the level at which students are ready to use these skills in real-life conditions. The self-regulated learning strategies used by medical students in surgical clerkship were investigated in this study and their relation with clinical achievement was analyzed. The study was conducted during the surgery clerkship of medical students. The participation rate was 94% (309 students). Motivated Strategies for Learning Questionnaire (MSLQ), a case-based examination, Objective Structured Clinical Examination (OSCE), and tutor evaluations for assessing achievement were used. The relationship between the Motivated Strategies for Learning Questionnaire scores of the students and clinical achievement was analyzed with multilinear regression analysis. The findings showed that students use self-regulated learning skills at medium levels during their surgery clerkship. A relationship between these skills and OSCE scores and tutor evaluations was determined. OSCE scores of the students were observed to increase in conjunction with increased self-efficacy levels. However, as students' beliefs regarding control over learning increased, OSCE scores decreased. No significant relationship was defined between self-regulated learning skills and case-based examination scores. We observed that a greater self-efficacy for learning resulted in higher OSCE scores. Conversely, students who believe that learning is a result of their own effort had lower OSCE scores. Copyright © 2012 Association of Program Directors in Surgery. Published by Elsevier Inc. All rights reserved.

  8. Implementing the objective structured clinical examination in a geriatrics fellowship program-a 3-year experience.

    Science.gov (United States)

    Avelino-Silva, Thiago J; Gil, Luiz A; Suemoto, Claudia K; Kikuchi, Elina L; Lin, Sumika M; Farias, Luciana L; Jacob-Filho, Wilson

    2012-07-01

    The Objective Structured Clinical Examination (OSCE) appears to be an effective alternative for assessing not only medical knowledge, but also clinical skills, including effective communication and physical examination skills. The purpose of the current study was to implement an OSCE model in a geriatrics fellowship program and to compare the instrument with traditional essay examination. Seventy first- and second-year geriatric fellows were initially submitted to a traditional essay examination and scored from 0 to 10 by a faculty member. The same fellows subsequently underwent an OSCE with eight 10-minute stations covering a wide range of essential aspects of geriatric knowledge. Each OSCE station had an examiner responsible for its evaluation according to a predefined checklist. Checklist items were classified for analysis purposes as clinical knowledge items (CKI) and communication skills items (CSI); fellow responses were scored from 0 to 10.Although essay examinations took from 30 to 45 minutes to complete, 180-200 minutes were required to evaluate fellows using the proposed OSCE method. Fellows scored an average of 6.2 ± 1.2 on the traditional essay examination and 6.6 ± 1.0 on the OSCE (P examination was similar to their performance on CKI (P = .13). Second-year fellows performed better than first-year fellows on the essay examination (P geriatrics fellowship program. Combining different testing modalities may provide the best assessment of competence for various domains of knowledge, skills, and behavior. © 2012, Copyright the Authors Journal compilation © 2012, The American Geriatrics Society.

  9. Organic solar cells using CVD-grown graphene electrodes

    International Nuclear Information System (INIS)

    Kim, Hobeom; Han, Tae-Hee; Lim, Kyung-Geun; Lee, Tae-Woo; Bae, Sang-Hoon; Ahn, Jong-Hyun

    2014-01-01

    We report on the development of flexible organic solar cells (OSCs) incorporating graphene sheets synthesized by chemical vapor deposition (CVD) as transparent conducting electrodes on polyethylene terephthalate (PET) substrates. A key barrier that must be overcome for the successful fabrication of OSCs with graphene electrodes is the poor-film properties of water-based poly(3,4-ethylenedioxythiphene):poly(styrenesulfonate) (PEDOT:PSS) when coated onto hydrophobic graphene surfaces. To form a uniform PEDOT:PSS film on a graphene surface, we added perfluorinated ionomers (PFI) to pristine PEDOT:PSS to create ‘GraHEL’, which we then successfully spin coated onto the graphene surface. We systematically investigated the effect of number of layers in layer-by-layer stacked graphene anode of an OSC on the performance parameters including the open-circuit voltage (V oc ), short-circuit current (J sc ), and fill factor (FF). As the number of graphene layers increased, the FF tended to increase owing to lower sheet resistance, while J sc tended to decrease owing to the lower light absorption. In light of this trade-off between sheet resistance and transmittance, we determined that three-layer graphene (3LG) represents the best configuration for obtaining the optimal power conversion efficiency (PCE) in OSC anodes, even at suboptimal sheet resistances. We finally developed efficient, flexible OSCs with a PCE of 4.33%, which is the highest efficiency attained so far by an OSC with CVD-grown graphene electrodes to the best of our knowledge. (paper)

  10. Development of the road aggregate test specifications for the modified ethylene glycol durability index for basic crystalline materials

    CSIR Research Space (South Africa)

    Leyland, RC

    2013-09-01

    Full Text Available had shown signs of “rapid weathering” using the method described by Higgs (1976). Both Orr and Higgs gave only qualitative assessments of the deterioration. During construction of the Lesotho Highland Water Project in South Africa (OSC 1986..., Shand and Lahmeyer McDonald Consortium (OSC). 1985. “Lesotho Highlands Water Project Feasibility Study: Supporting Report B, Geotechnical and construction materials studies.” Olivier, Shand and Lahmeyer McDonald Consortium. Orr, C.M. (1979). “Rapid...

  11. Nanoscale aluminum dimples for light-trapping in organic thin-films

    DEFF Research Database (Denmark)

    Goszczak, Arkadiusz Jaroslaw; Adam, Jost; Cielecki, Pawel Piotr

    Integration of nanostructures in organic solar cells (OSCs) has been investigated intensively in the past few years as an alternative way for enhancing the power conversion efficiency of the devices. Incorporating structured electrodes in the solar cell architecture holds potential for light...... absorption improvement in the active layer of the devices. A prospective, cheap and large-scale compatible method for structuring the electrodes in OSCs arises by the use of anodic aluminum oxide (AAO) membranes. In the present work, aluminum films of high purity and low roughness are formed via e...

  12. Data from thermal testing of the Open Source Cryostage

    DEFF Research Database (Denmark)

    Buch, Johannes Lørup; Ramløv, Hans

    2016-01-01

    The data presented here is related to the research article "An open source cryostage and software analysis method for detection of antifreeze activity" (Buch and Ramløv, 2016) [1]. The design of the Open Source Cryostage (OSC) is tested in terms of thermal limits, thermal efficiency and electrical...... efficiency. This article furthermore includes an overview of the electrical circuitry and a flowchart of the software program controlling the temperature of the OSC. The thermal efficiency data is presented here as degrees per volt and maximum cooling capacity....

  13. Light sensors based on organic phototransistors with absorption-enhancing nanoparticles

    DEFF Research Database (Denmark)

    Runge Walther, Anders; Linnet, Jes; Albrektsen, Ole

    Organic semiconductors (OSCs) exhibit promising electronic and optical properties applicable in photo-sensing devices. Previous studies have found that thiophene-based semiconductors are suitable as the active layer in organic optoelectronic devices such as light-sensing transistors [1]. The abil......Organic semiconductors (OSCs) exhibit promising electronic and optical properties applicable in photo-sensing devices. Previous studies have found that thiophene-based semiconductors are suitable as the active layer in organic optoelectronic devices such as light-sensing transistors [1...

  14. Utilizing alkoxyphenyl substituents for side-chain engineering of efficient benzo[1,2-b:4,5-b ']dithiophene-based small molecule organic solar cells

    DEFF Research Database (Denmark)

    Du, Zhengkun; Chen, Weichao; Qiu, Meng

    2015-01-01

    -processed organic solar cells (OSCs) as an electron donor material, in which an alkoxyphenyl group was introduced as a weak electrondonating side chain of the BDT moiety. The DCA3TBDTP molecule exhibited good solubility, a deep highest occupied molecular orbital (HOMO) level (-5.25 eV), an appropriate optical band......-gap (1.82 eV) and a high decomposition temperature (362 degrees C). By applying the simple solution spin-coating fabrication process, the bulk heterojunction (BHJ) OSCs based on DCA3TBDTP and [6,6]-phenyl-C-61-butyric acid methyl ester (PC61BM) exhibited a good power conversion efficiency (PCE) of 4...

  15. Health risk assessment of plasticizer in wastewater effluents and receiving freshwater systems

    CSIR Research Space (South Africa)

    Fatoki, O

    2012-03-01

    Full Text Available t Ku ils Riv er riv er Ve ltw ach ter Ef flu en t Ve ltw ach ter Ri ve r Kir ste nb osc h R ive r ug /l DEHP DEP NP 2CP Fig. 4. Concentrations (?gl-1) of phthalate and phenolic congeners detected in river and WWTP... ter Eff lue nt Ve ltw ach ter Riv er Kir ste nb osc h R ive r ug/ l DBP Fig. 5. DBP concentrations (?gl-1) detected in effluent and river water samples at the different sites. Health Risk Assessment of Plasticizer...

  16. Role of the Russian Federation in the Settlement of the Nagorno-Karabakh Conflict

    Directory of Open Access Journals (Sweden)

    H L Paronyan

    2013-12-01

    Full Text Available The article examines the role and the mediation efforts of Russian Federation, aimed at the settlement of the Karabakh conflict, as well as the activity of the OSCE Minsk group (today that is Russia, the United States and France, engaged in the settlement of the Nagorno-Karabakh conflict in 1992. In the conditions of intransigence of positions between conflicting parties, international mediation acquires particular significance in the settlement of the conflict. In opinion of both Armenian and Russian sides, the format of OSCE Minsk group is mostly responsible for the further settlement of the Karabakh conflict.

  17. Modeling nanostructure-enhanced light trapping in organic solar cells

    DEFF Research Database (Denmark)

    Adam, Jost

    A promising approach for improving the power conversion efficiencies of organic solar cells (OSCs) is by incorporating nanostructures in their thin film architecture to improve the light absorption in the device’s active polymer layers. Here, we present a modelling framework for the prediction...... of optical and plasmonic field enhancement by nanostructures in (or close to) the active layers and electrodes in OSCs. We incorporate finite-difference time-domain (FDTD) calculations alongside semi- analytical approaches, as the rigorous coupled-wave analysis (RCWA) and mode-coupling theory. Our simulation...

  18. How does preclinical laboratory training impact physical examination skills during the first clinical year? A retrospective analysis of routinely collected objective structured clinical examination scores among the first two matriculating classes of a reformed curriculum in one Polish medical school.

    Science.gov (United States)

    Świerszcz, Jolanta; Stalmach-Przygoda, Agata; Kuźma, Marcin; Jabłoński, Konrad; Cegielny, Tomasz; Skrzypek, Agnieszka; Wieczorek-Surdacka, Ewa; Kruszelnicka, Olga; Chmura, Kaja; Chyrchel, Bernadeta; Surdacki, Andrzej; Nowakowski, Michał

    2017-09-01

    As a result of a curriculum reform launched in 2012 at our institution, preclinical training was shortened to 2 years instead of the traditional 3 years, creating additional incentives to optimise teaching methods. In accordance with the new curriculum, a semester-long preclinical module of clinical skills (CS) laboratory training takes place in the second year of study, while an introductory clinical course (ie, brief introductory clerkships) is scheduled for the Fall semester of the third year. Objective structured clinical examinations (OSCEs) are carried out at the conclusion of both the preclinical module and the introductory clinical course. Our aim was to compare the scores at physical examination stations between the first and second matriculating classes of a newly reformed curriculum on preclinical second-year OSCEs and early clinical third-year OSCEs. Analysis of routinely collected data. One Polish medical school. Complete OSCE records for 462 second-year students and 445 third-year students. OSCE scores by matriculation year. In comparison to the first class of the newly reformed curriculum, significantly higher (ie, better) OSCE scores were observed for those students who matriculated in 2013, a year after implementing the reformed curriculum. This finding was consistent for both second-year and third-year cohorts. Additionally, the magnitude of the improvement in median third-year OSCE scores was proportional to the corresponding advancement in preceding second-year preclinical OSCE scores for each of two different sets of physical examination tasks. In contrast, no significant difference was noted between the academic years in the ability to interpret laboratory data or ECG - tasks which had not been included in the second-year preclinical training. Our results suggest the importance of preclinical training in a CS laboratory to improve students' competence in physical examination at the completion of introductory clinical clerkships during

  19. The GP tests of competence assessment: which part best predicts fitness to practise decisions?

    Science.gov (United States)

    Jayaweera, Hirosha Keshani; Potts, Henry W W; Keshwani, Karim; Valerio, Chris; Baker, Magdalen; Mehdizadeh, Leila; Sturrock, Alison

    2018-01-02

    The General Medical Council (GMC) conducts Tests of Competence (ToC) for doctors referred for Fitness to Practise (FtP) issues. GPs take a single best answer knowledge test, an Objective Structured Clinical Examination (OSCE), and a Simulated Surgery (SimSurg) assessment which is a simulated GP consultation. The aim of this study was to examine the similarities between OSCEs and SimSurg to determine whether each assessment contributed something unique to GP ToCs. A mixed methods approach was used. Data were collated on 153 GPs who were required to undertake a ToC as a part of being investigated for FtP issues between February 2010 and October 2016. Using correlation analysis, we examined to what degree performance on the knowledge test, OSCE, and SimSurg related to case examiner recommendations and FtP outcomes, including the unique predictive power of these three assessments. The outcome measures were case examiner recommendations (i) not fit to practise; ii) fit to practise on a limited basis; or iii) fit to practise) as well as FtP outcomes (i) erased/removed from the register; ii) having restrictions/conditions; or iii) be in good standing). For the qualitative component, 45 GP assessors were asked to rate whether they assess the same competencies and which assessment provides better feedback about candidates. There was significant overlap between OSCEs and SimSurg, p < 0.001. SimSurg had additional predictive power in the presence of OSCEs and the knowledge test (p = 0.030) in distinguishing doctors from different FtP categories, while OSCEs did not (p = 0.080). Both the OSCEs (p = 0.004) and SimSurg (p < 0.001) had significant negative correlations with case examiner recommendations when accounting for the effects of the other two assessments. Inductive thematic analysis of the responses to the questionnaire showed that assessors perceived OSCEs to be better suited to target specific knowledge and skills. SimSurg was thought to produce a

  20. Implementation of the Forest Service Open Space Conservation Strategy in Washington State: Exploring the Role of the National Forest System

    Science.gov (United States)

    Richard J. Pringle; Lee K. Cerveny; Gordon A. Bradley

    2015-01-01

    The loss of open space was declared one of the “four threats to the health of our nation’s forests” by former USDA Forest Service Chief Dale Bosworth in 2004. Since then, the agencywide Open Space Conservation Strategy (OSCS) was released and the “four threats” were incorporated into the agency’s National Strategic Plan. These actions indicate that the OSCS is in the...

  1. Development of low light-off catalyst; Teion kassei ni sugureta shokubai no kaihatsu

    Energy Technology Data Exchange (ETDEWEB)

    Takemoto, T; Ichikawa, S; Koda, Y; Yamamoto, E; Sumida, H; Yamada, H; Shigetsu, M; Komatsu, K [Mazda Motor Corp., Tokyo (Japan)

    1997-10-01

    A new type of three way catalyst was developed in order to reduce HC, CO and NOx in cold exhaust gas. This catalyst consists of double layer, and has a base support material of alumina and oxygen storage components (OSC) loaded with active metals including platinum. palladium and rhodium. It has good light-off performance and high catalytic activity. This catalyst includes two types of OSC. One is CeO2, and the other is CePrO2 that makes possible to improve NOx conversion at high exhaust gas temperature. 8 refs., 13 figs., 2 tabs.

  2. Interfacial spectroscopic characterization of organic/ferromagnet hetero-junction of 3,4,9,10-perylene-teracarboxylic dianhydride-based organic spin valves

    Energy Technology Data Exchange (ETDEWEB)

    Hong, Jhen-Yong; Ou Yang, Kui-Hon; Li, Kai-Shin [Department of Physics, National Taiwan University, 10617 Taipei, Taiwan (China); Wang, Bo-Yao [Department of Physics, National Taiwan University, 10617 Taipei, Taiwan (China); Department of Physics, National Changhua University of Education, Changhua 500, Taiwan (China); Shiu, Hung-Wei; Chen, Chia-Hao; Chan, Yuet-Loy; Wei, Der-Hsin; Chang, Fan-Hsiu; Lin, Hong-Ji [National Synchrotron Radiation Research Center, 30076 Hsinchu, Taiwan (China); Chiang, Wen-Chung, E-mail: wchiang@faculty.pccu.edu.tw [Department of Physics, Chinese Culture University, 11114 Taipei, Taiwan (China); Lin, Minn-Tsong, E-mail: mtlin@phys.ntu.edu.tw [Department of Physics, National Taiwan University, 10617 Taipei, Taiwan (China); Institute of Atomic and Molecular Sciences, Academia Sinica, 10617 Taipei, Taiwan (China)

    2014-02-24

    We report interfacial characterization of 3,4,9,10-perylene-teracarboxylic dianhydride (PTCDA)-based organic spin valves (OSV) dusted with a thin layer of partially oxidized alumina at the organic semiconductor (OSC)/ferromagnet (FM) interfaces. Up to 13.5% magnetoresistance is achieved at room temperature. X-ray photoelectron spectroscopy measurements reveal interfacial electronic interaction between PTCDA and FM while the application of a thin alumina layer at the PTCDA/FM interfaces prevents the electronic hybridization and effectively preserves the spin injection into the OSC spacer. This finding demonstrates the critical effect of interfacial structure on magnetotransport behavior in OSV.

  3. Preparation of Composited Graphene/PEDOT:PSS Film for Its Possible Application in Graphene-based Organic Solar Cells

    Institute of Scientific and Technical Information of China (English)

    YU; Yue; LI; Meicheng; CHU; Lihua; YU; Hakki; Wodtke; A.M.; ZHAO; Yan; ZHANG; Zhongmo

    2015-01-01

    The interface between graphene and organic layers is a key factor responsible for the performance of graphene-based organic solar cells(OSCs). In this paper, we focus on coating PEDOT:PSS onto the surface of graphene. We demonstrate two approaches, applying UV/Ozone treatment on graphene and modifying PEDOT:PSS with Zonyl, to get a PEDOT:PSS well-coated graphene film. Our results prove that both methods can be effective to solve the interface issue between graphene and PEDOT: PSS. Thereby it shows a positive application of the composited graphene/PEDOT:PSS film on graphene-based OSCs.

  4. Preparation of Composited Graphene/PEDOT:PSS Film for Its Possible Application in Graphene-based Organic Solar Cells

    Institute of Scientific and Technical Information of China (English)

    YU Yue; LI Meicheng; CHU Lihua; YU Hakki; Wodtke A M; ZHAO Yan; ZHANG Zhongmo

    2015-01-01

    The interface between graphene and organic layers is a key factor responsible for the performance of gra-phene-based organic solar cells (OSCs). In this paper, we focus on coating PEDOT:PSS onto the surface of graphene. We demonstrate two approaches, applying UV/Ozone treatment on graphene and modifying PEDOT:PSS with Zonyl, to get a PEDOT:PSS well-coated graphene film . Our results prove that both methods can be effective to solve the interface issue between graphene and PEDOT: PSS. Thereby it shows a positive application of the composited gra-phene/PEDOT:PSS film on graphene-based OSCs.

  5. Contrary interfacial exciton dissociation at metal/organic interface in regular and reverse configuration organic solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Bo; Wu, Zhenghui; Tam, Hoi Lam; Zhu, Furong, E-mail: frzhu@hkbu.edu.hk [Department of Physics, Institute of Advanced Materials, and Institute of Research and Continuing Education (Shenzhen), Hong Kong Baptist University, 224 Waterloo Road, Kowloon Tong, NT (Hong Kong)

    2014-09-08

    An opposite interfacial exciton dissociation behavior at the metal (Al)/organic cathode interface in regular and inverted organic solar cells (OSCs) was analyzed using transient photocurrent measurements. It is found that Al/organic contact in regular OSCs, made with the blend layer of poly[[4,8-bis[(2-ethylhexyl)oxy]benzo[1,2-b:4,5-b′]dithiophene-2,6-diyl] -[3-fluoro-2-[(2-ethylhexyl)carbonyl]thieno[3,4-b]-thiophenediyl

  6. Individual employee's perceptions of " Group-level Safety Climate" (supervisor referenced) versus " Organization-level Safety Climate" (top management referenced): Associations with safety outcomes for lone workers.

    Science.gov (United States)

    Huang, Yueng-Hsiang; Lee, Jin; McFadden, Anna C; Rineer, Jennifer; Robertson, Michelle M

    2017-01-01

    Research has shown that safety climate is among the strongest predictors of safety behavior and safety outcomes in a variety of settings. Previous studies have established that safety climate is a multi-faceted construct referencing multiple levels of management within a company, most generally: the organization level (employee perceptions of top management's commitment to and prioritization of safety) and group level (employee perceptions of direct supervisor's commitment to and prioritization of safety). Yet, no research to date has examined the potential interaction between employees' organization-level safety climate (OSC) and group-level safety climate (GSC) perceptions. Furthermore, prior research has mainly focused on traditional work environments in which supervisors and workers interact in the same location throughout the day. Little research has been done to examine safety climate with regard to lone workers. The present study aims to address these gaps by examining the relationships between truck drivers' (as an example of lone workers) perceptions of OSC and GSC, both potential linear and non-linear relationships, and how these predict important safety outcomes. Participants were 8095 truck drivers from eight trucking companies in the United States with an average response rate of 44.8%. Results showed that employees' OSC and GSC perceptions are highly correlated (r= 0.78), but notable gaps between the two were observed for some truck drivers. Uniquely, both OSC and GSC scores were found to have curvilinear relationships with safe driving behavior, and both scores were equally predictive of safe driving behavior. Results also showed the two levels of climate significantly interacted with one another to predict safety behavior such that if either the OSC or GSC scores were low, the other's contribution to safety behavior became stronger. These findings suggest that OSC and GSC may function in a compensatory manner and promote safe driving behavior even

  7. La religión como asignatura no confesional

    OpenAIRE

    Rodríguez Acevedo, Cruz Javier

    2016-01-01

    Las Constituciones de los estados de la Organización de Seguridad y Cooperación Europea (OSCE) establecen como derecho fundamental la educación de sus ciudadanos o nacionales. En el contexto del correlativo deber estatal de facilitar una enseñanza integral, se discute si el estado se debe de ocupar de la enseñanza de la religión como asignatura. A este propósito en els eno de la OSCE se elaboró un documento, "Los principios orientadores de Toledo sobre la enseñanza acerca de las religiones y ...

  8. Light Optics for Optical Stochastic Cooling

    Energy Technology Data Exchange (ETDEWEB)

    Andorf, Matthew [NICADD, DeKalb; Lebedev, Valeri [Fermilab; Piot, Philippe [NICADD, DeKalb; Ruan, Jinhao [Fermilab

    2016-06-01

    In Optical Stochastic Cooling (OSC) radiation generated by a particle in a "pickup" undulator is amplified and transported to a downstream "kicker" undulator where it interacts with the same particle which radiated it. Fermilab plans to carry out both passive (no optical amplifier) and active (optical amplifier) tests of OSC at the Integrable Optics Test Accelerator (IOTA) currently in construction*. The performace of the optical system is analyzed with simulations in Synchrotron Radiation Workshop (SRW) accounting for the specific temporal and spectral properties of undulator radiation and being augmented to include dispersion of lens material.

  9. Effect of pentacene/Ag anode buffer and UV-ozone treatment on durability of small-molecule organic solar cells

    International Nuclear Information System (INIS)

    Inagaki, S; Sueoka, S; Harafuji, K

    2017-01-01

    Three surface modifications of indium tin oxide (ITO) are experimentally investigated to improve the performance of small-molecule organic solar cells (OSCs) with an ITO/anode buffer layer (ABL)/copper phthalocyanine (CuPc)/fullerene/bathocuproine/Ag structure. An ultrathin Ag ABL and ultraviolet (UV)-ozone treatment of ITO independently improve the durability of OSCs against illumination stress. The thin pentacene ABL provides good ohmic contact between the ITO and the CuPc layer, thereby producing a large short-circuit current. The combined use of the abovementioned three modifications collectively achieves both better initial performance and durability against illumination stress. (paper)

  10. Effect of pentacene/Ag anode buffer and UV-ozone treatment on durability of small-molecule organic solar cells

    Science.gov (United States)

    Inagaki, S.; Sueoka, S.; Harafuji, K.

    2017-06-01

    Three surface modifications of indium tin oxide (ITO) are experimentally investigated to improve the performance of small-molecule organic solar cells (OSCs) with an ITO/anode buffer layer (ABL)/copper phthalocyanine (CuPc)/fullerene/bathocuproine/Ag structure. An ultrathin Ag ABL and ultraviolet (UV)-ozone treatment of ITO independently improve the durability of OSCs against illumination stress. The thin pentacene ABL provides good ohmic contact between the ITO and the CuPc layer, thereby producing a large short-circuit current. The combined use of the abovementioned three modifications collectively achieves both better initial performance and durability against illumination stress.

  11. Objective Structured Clinical Examination as an Assessment Tool for Clinical Skills in Dermatology.

    Science.gov (United States)

    Saceda-Corralo, D; Fonda-Pascual, P; Moreno-Arrones, Ó M; Alegre-Sánchez, A; Hermosa-Gelbard, Á; Jiménez-Gómez, N; Vañó-Galván, S; Jaén-Olasolo, P

    2017-04-01

    Objective Structured Clinical Evaluation (OSCE) is an excellent method to evaluate student's abilities, but there are no previous reports implementing it in dermatology. To determine the feasibility of implementation of a dermatology OSCE in the medical school. Five stations with standardized patients and image-based assessment were designed. A specific checklist was elaborated in each station with different items which evaluated one competency and were classified into five groups (medical history, physical examination, technical skills, case management and prevention). A total of 28 students were tested. Twenty-five of them (83.3%) passed the exam globally. Concerning each group of items tested: medical interrogation had a mean score of 71.0; physical examination had a mean score of 63.0; management had a mean score of 58.0; and prevention had a mean score of 58.0 points. The highest results were obtained in interpersonal skills items with 91.8 points. Testing a small sample of voluntary students may hinder generalization of our study. OSCE is an useful tool for assessing clinical skills in dermatology and it is possible to carry it out. Our experience enhances that medical school curriculum needs to establish OSCE as an assessment tool in dermatology. Copyright © 2016 AEDV. Publicado por Elsevier España, S.L.U. All rights reserved.

  12. Performance of International Medical Students In psychosocial medicine.

    Science.gov (United States)

    Huhn, D; Lauter, J; Roesch Ely, D; Koch, E; Möltner, A; Herzog, W; Resch, F; Herpertz, S C; Nikendei, C

    2017-07-10

    Particularly at the beginning of their studies, international medical students face a number of language-related, social and intercultural challenges. Thus, they perform poorer than their local counterparts in written and oral examinations as well as in Objective Structured Clinical Examinations (OSCEs) in the fields of internal medicine and surgery. It is still unknown how international students perform in an OSCE in the field of psychosocial medicine compared to their local fellow students. All students (N = 1033) taking the OSCE in the field of psychosocial medicine and an accompanying written examination in their eighth or ninth semester between 2012 and 2015 were included in the analysis. The OSCE consisted of four different stations, in which students had to perform and manage a patient encounter with simulated patients suffering from 1) post-traumatic stress disorder, 2) schizophrenia, 3) borderline personality disorder and 4) either suicidal tendency or dementia. Students were evaluated by trained lecturers using global checklists assessing specific professional domains, namely building a relationship with the patient, conversational skills, anamnesis, as well as psychopathological findings and decision-making. International medical students scored significantly poorer than their local peers (p International students showed poorer results in clinical-practical exams in the field of psychosocial medicine, with conversational skills yielding the poorest scores. However, regarding factual and practical knowledge examined via a multiple-choice test, no differences emerged between international and local students. These findings have decisive implications for relationship building in the doctor-patient relationship.

  13. Intraosseous access can be taught to medical students using the four-step approach

    DEFF Research Database (Denmark)

    Afzali, Monika; Kvisselgaard, Ask Daffy; Lyngeraa, Tobias Stenbjerg

    2017-01-01

    was evaluated by an objective structured clinical examination (OSCE) and rated using a weighted checklist. To evaluate the validity of the checklist, three raters rated performance and Cohen's kappa was performed to assess inter-rater reliability (IRR). To examine the strength of the overall IRR, Randolph...

  14. Terpenoid pathway discovery in Tripterygium wilfordii

    DEFF Research Database (Denmark)

    Hansen, Nikolaj Lervad

    -29-oic acid and its precursor 29-hydroxyfriedelin from friedelin, which was formed by the identified oxidosqualene cyclase TwOSC4 (Chapter 5; manuscript in preparation). A different study probed residues important for product identity in two functionally distinct but closely related class II...

  15. Open source community organization

    CSIR Research Space (South Africa)

    Molefe, Onkgopotse M

    2009-05-01

    Full Text Available Open Source communities (OSCs), sometimes referred to as virtual or online communities play a significant role in terms of the contribution they continue to make in producing user-friendly Open Source Software (OSS) solutions. Many projects have...

  16. All solution processing of ITO-free organic solar cell modules directly on barrier foil

    DEFF Research Database (Denmark)

    Angmo, Dechan; Hösel, Markus; Krebs, Frederik C

    2012-01-01

    In this study, we demonstrate fully solution processed semi-transparent silver electrodes on flexible substrates having a sheet resistance as low as 5Ω/□ and transmittance of ∼30% at 550nm. We demonstrate the use of this electrode as a substitute for ITO in an inverted organic solar cell (OSC...

  17. Sustained knowledge acquisition among Rwandan physicians participating in six-month ultrasound training program

    Directory of Open Access Journals (Sweden)

    P.C. Henwood*

    2013-12-01

    Conclusions: Trainees demonstrated significant knowledge improvement after an intensive introductory ultrasound course, which increased through the training program. Mean OSCE scores remained above 80% throughout the course. Participants in an ultrasound training program with an initial training phase and periodic skill reinforcement can acquire and retain ultrasound knowledge and scanning skills.

  18. Kazakhstan's Chairmanship of the Organization for Security and Cooperation in Europe: An Assessment

    Directory of Open Access Journals (Sweden)

    - Shirin Akiner

    2011-06-01

    Full Text Available Massive international comment and analysis was devoted to the Kazakhstan's Chairmanship in the Organization for Security and Cooperation in Europe (OSCE. No previous candidate for this office received such treatment. Kazakhstan's agenda of aims and objectives included important issues. During the year several steps were taken towards implementing Kazakhstan's agenda.

  19. Introduction to the Issue on Organic Nanophotonics

    DEFF Research Database (Denmark)

    2016-01-01

    impressive outcomes include organic light-emitting devices (OLEDs) that are now competing with the well-established liquid crystal display technology in the mobile and television markets. In addition, organic solar cells (OSCs) offer the potential to create new paradigms for ultrathin and lightweight plastic...

  20. Compact fibre-laser-pumped Ho:YLF oscillator-amplifier system

    CSIR Research Space (South Africa)

    Bollig, C

    2009-06-01

    Full Text Available -amplifier system. 0 5 10 15 20 25 0 1 2 3 4 5 Repetition Rate [kHz] Pu lse En er gy [m J] 0 50 100 150 200 250 Pu lse Le n gt h [ns ] Simulation Results Amp Pulse Energy Osc Pulse Energy Amp Pulse Length Fig. 2 Output energy...

  1. Roll coated large area ITO- and vacuum-free all organic solar cells from diketopyrrolopyrrole based non-fullerene acceptors with molecular geometry effects

    DEFF Research Database (Denmark)

    Brandt, Rasmus Guldbaek; Zhang, Fei; Andersen, Thomas Rieks

    2016-01-01

    morphology, and photovoltaic performance of both spin-coated ITO based and roll coated large area, ITO- and vacuum-free organic solar cells (OSCs). For spin-coated devices based on P3HT as the donor polymer the solar cells gave power conversion efficiencies (PCEs) in the following order for (P3HT:PhDMe(DPP)2...

  2. 2D3 Pilotstudy: Accelerated learning in anaesthetic training

    DEFF Research Database (Denmark)

    Bisgaard, Claus Hedebo; Holdgaard, Hans Ole; Rubak, Sune Leisgaard Mørck

    2011-01-01

    of the one year curriculum. The skills training were assessed with OSATS and global rating scales for each procedure. Summary of results: As assessed with an OSCE the residents accelerated their competencies in airway management and general anaesthesia from week 10-12 to 4, spinal anaesthesia from week 10...

  3. Digital assessments – challenges, choices and pitfalls

    DEFF Research Database (Denmark)

    Simonsen, Eivind Ortind

    assessments at the faculty of Health, Aarhus University. Today (2015) we have digitalized approximately 70 % of our assessments, including MCQ (multiple choice) and OSCE (objective structured clinical examination), with 7-800 students assessed each semester. We have developed our own systems...

  4. Global Security in the Twenty First Century - The Challenge to International Organizations, Alliances and Coalitions

    National Research Council Canada - National Science Library

    Seymour, N

    1999-01-01

    ... for Security and Cooperation in Europe (OSCE) Naturally, it would be too simplistic for the answer to be either one or the other; the probable solution is more likely to be a hybrid that embodies the strengths of both, not to mention the UN.

  5. Triterpenoid Saponin Biosynthesis in the non-model Crucifer Plant Barbares Vulgaris

    DEFF Research Database (Denmark)

    Erthmann, Pernille Østerbye

    ratios were identified In vivo results suggest the rate limiting step for saponin biosynthesis in B. vulgaris to be the expression levels of 2,3-oxidosqualene cyclase. To support these findings, an in vivo knock-out of the OSC via CRISPER/Cas was desired. To achieve this, stable transformants of B...

  6. Novos desafios para os atores da sociedade civil brasileira em un contexto de mudancas na cooperacao internacional

    NARCIS (Netherlands)

    K. Biekart (Kees)

    2013-01-01

    markdownabstractIntro A pesquisa conduzida pela FGV sobre cooperação internacional e a arquitetura financeira das Organizações da Sociedade Civil (OSCs) brasileiras (CEAPG & ARTICULAÇÃO D3, 2013) tem gerado resultados importantes. Auxiliam no melhor entendimento sobre as mudanças nacionais e

  7. Synthesis and Characterization of Poly-3,4-ethylenedioxythiophene/2,5-Dimercapto-1,3,4-thiadiazole (PEDOT-DMcT) Hybrids

    International Nuclear Information System (INIS)

    Rodríguez-Calero, Gabriel G.; Conte, Sean; Lowe, Michael A.; Gao, Jie; Kiya, Yasuyuki; Henderson, Jay C.; Abruña, Héctor D.

    2015-01-01

    Graphical abstract: Display Omitted -- Abstract: Organosulfur Compounds (OSCs) represent an attractive alternative as organic cathode materials for electrochemical energy storage (EES) applications. They intrinsically have high gravimetric capacity (although low volumetric) and are typically inexpensive, since they are composed of abundant elements (i.e. C, N, O, and S). However, OSCs, specifically thiolate-containing OSCs generally suffer from slow charge transfer kinetics. To mitigate the charge transfer limitations, conducting polymers (CPs) such as poly-3,4-ethylenedioxythiophene (PEDOT) have been employed as electrocatalysts. In this manuscript, we have covalently modified a PEDOT film with an OSC (i.e. 2,5-dimercapto-1,3,4-thiadiazole di-lithium salt (Li 2 DMcT)). We have developed a synthetic strategy that employs, for the first time, a post-polymerization modification reaction as a tractable and viable technique to modify organic materials for EES electrodes. Electrochemical characterization, via cyclic voltammetry showed the expected pseudocapacitive response of PEDOT with the superimposed faradaic processes of the covalently bound DMcT. Moreover, spectroscopic characterization using Raman spectroscopy provided mechanistic insights into the electrochemical reactions. Furthermore, we electropolymerized films onto coin-cell electrodes and tested them in half-cell configurations and found that the capacity retention of the films was significantly enhanced, when compared with the PEDOT/DMcT composites (mixed but not covalently bound)

  8. Ternary solution-processed organic solar cells incorporating 2D materials

    Science.gov (United States)

    Stylianakis, Minas M.; Konios, Dimitrios; Petridis, Constantinos; Kakavelakis, George; Stratakis, Emmanuel; Kymakis, Emmanuel

    2017-12-01

    Recently, the study of ternary organic solar cells (OSCs) has attracted the efforts of the scientific community, leading to significantly higher performance due to the enhanced harvesting of incoming irradiation. Here, for the first time, and in order to promote this OSC architecture, we review the progress implemented by the application of two-dimensional (2D) materials in the field of blend bulk heterojunction ternary OSCs. Power conversion efficiency (PCE) improvements of the order of 40% compared to the reference binary devices, and PCEs in excess of 8% have been reported by incorporating graphene-based or other 2D materials as a third element inside the active layer. These OSCs combine the synergetic advantages of ternary devices and the superb properties of the 2D material family. In conclusion, the incorporation of the unique properties of graphene and other 2D materials inside the active layer opens up a very promising pathway in the design and construction of high-performance, simply fabricated and low- cost photovoltaic devices.

  9. Improving Communication With Surrogate Decision-Makers: A Pilot Initiative.

    Science.gov (United States)

    Meltzer, Ellen C; Shi, Zhenzhen; Suppes, Alexandra; Hersh, Jennifer E; Orlander, Jay D; Calhoun, Aaron W; Tung, Judy; Logio, Lia; Manna, Ruth; Bialer, Philip A; Acres, Cathleen A; Fins, Joseph J

    2017-08-01

    Difficult conversations in medical care often occur between physicians and patients' surrogates, individuals entrusted with medical decisions for patients who lack the capacity to make them. Poor communication between patients' surrogates and physicians may exacerbate anxiety and guilt for surrogates, and may contribute to physician stress and burnout. This pilot study assesses the effectiveness of an experiential learning workshop that was conducted in a clinical setting, and aimed at improving resident physician communication skills with a focus on surrogate decision-making. From April through June 2016, we assessed internal medicine residents' baseline communication skills through an objective structured clinical examination (OSCE) with actors representing standardized surrogates. After an intensive, 6-hour communication skills workshop, residents were reassessed via an OSCE on the same day. A faculty facilitator and the surrogate evaluated participants' communication skills via the expanded Gap Kalamazoo Consensus Statement Assessment Form. Wilcoxon signed rank tests (α of .05) compared mean pre- and postworkshop scores. Of 44 residents, 33 (75%) participated. Participants' average preworkshop OSCE scores ( M  = 3.3, SD = 0.9) were significantly lower than postworkshop scores ( M  = 4.3; SD = 0.8; Z  = 4.193; P  decision-making benefit from focused interventions. Our pilot assessment of a workshop showed promise, and additionally demonstrated the feasibility of bringing OSCEs and simulated encounters into a busy clinical practice.

  10. Development of Annealing-Free, Solution-Processable Inverted Organic Solar Cells with N-Doped Graphene Electrodes using Zinc Oxide Nanoparticles.

    Science.gov (United States)

    Jung, Seungon; Lee, Junghyun; Seo, Jihyung; Kim, Ungsoo; Choi, Yunseong; Park, Hyesung

    2018-02-14

    An annealing-free process is considered as a technological advancement for the development of flexible (or wearable) organic electronic devices, which can prevent the distortion of substrates and damage to the active components of the device and simplify the overall fabrication process to increase the industrial applications. Owing to its outstanding electrical, optical, and mechanical properties, graphene is seen as a promising material that could act as a transparent conductive electrode for flexible optoelectronic devices. Owing to their high transparency and electron mobility, zinc oxide nanoparticles (ZnO-NP) are attractive and promising for their application as charge transporting materials for low-temperature processes in organic solar cells (OSCs), particularly because most charge transporting materials require annealing treatments at elevated temperatures. In this study, graphene/annealing-free ZnO-NP hybrid materials were developed for inverted OSC by successfully integrating ZnO-NP on the hydrophobic surface of graphene, thus aiming to enhance the applicability of graphene as a transparent electrode in flexible OSC systems. Chemical, optical, electrical, and morphological analyses of ZnO-NPs showed that the annealing-free process generates similar results to those provided by the conventional annealing process. The approach was effectively applied to graphene-based inverted OSCs with notable power conversion efficiencies of 8.16% and 7.41% on the solid and flexible substrates, respectively, which promises the great feasibility of graphene for emerging optoelectronic device applications.

  11. Cyber Warfare: China’s Strategy to Dominate in Cyber Space

    Science.gov (United States)

    2011-06-10

    fundamentally philosophical in nature rather than based on material goods or wealth . Concepts such as time, power, and wealth are radically different...China, ed David A. Graff and Robin Higham (Boulder, CO: 2002), 285-288. 28Krekel, 6. 29OSC, ―China‘s Naitonal Defence in 2010.‖ 30Ibid. 40

  12. Range and energetics of charge hopping in organic semiconductors

    Science.gov (United States)

    Abdalla, Hassan; Zuo, Guangzheng; Kemerink, Martijn

    2017-12-01

    The recent upswing in attention for the thermoelectric properties of organic semiconductors (OSCs) adds urgency to the need for a quantitative description of the range and energetics of hopping transport in organic semiconductors under relevant circumstances, i.e., around room temperature (RT). In particular, the degree to which hops beyond the nearest neighbor must be accounted for at RT is still largely unknown. Here, measurements of charge and energy transport in doped OSCs are combined with analytical modeling to reach the univocal conclusion that variable-range hopping is the proper description in a large class of disordered OSC at RT. To obtain quantitative agreement with experiment, one needs to account for the modification of the density of states by ionized dopants. These Coulomb interactions give rise to a deep tail of trap states that is independent of the material's initial energetic disorder. Insertion of this effect into a classical Mott-type variable-range hopping model allows one to give a quantitative description of temperature-dependent conductivity and thermopower measurements on a wide range of disordered OSCs. In particular, the model explains the commonly observed quasiuniversal power-law relation between the Seebeck coefficient and the conductivity.

  13. Applicability and fairness of the oral examination in undergraduate ...

    African Journals Online (AJOL)

    Applicability and fairness of the oral examination in undergraduate psychiatry training in South Africa. ... Objective: There are several methods of evaluating medical students' performance, such as written examination, oral examination and objective structured clinical examination (OSCE). Many studies have focused on the ...

  14. 40 CFR 300.440 - Procedures for planning and implementing off-site response actions.

    Science.gov (United States)

    2010-07-01

    ... unless the Remedial Project Manager or OSC assures the proper management of the CERCLA waste samples or... OIL AND HAZARDOUS SUBSTANCES POLLUTION CONTINGENCY PLAN Hazardous Substance Response § 300.440... § 300.440(d). (5) Off-site transfers of those laboratory samples and treatability study CERCLA wastes...

  15. Cooptimization of Adhesion and Power Conversion Efficiency of Organic Solar Cells by Controlling Surface Energy of Buffer Layers.

    Science.gov (United States)

    Lee, Inhwa; Noh, Jonghyeon; Lee, Jung-Yong; Kim, Taek-Soo

    2017-10-25

    Here, we demonstrate the cooptimization of the interfacial fracture energy and power conversion efficiency (PCE) of poly[N-9'-heptadecanyl-2,7-carbazole-alt-5,5-(4',7'-di-2-thienyl-2',1',3'-benzothiadiazole)] (PCDTBT)-based organic solar cells (OSCs) by surface treatments of the buffer layer. The investigated surface treatments of the buffer layer simultaneously changed the crack path and interfacial fracture energy of OSCs under mechanical stress and the work function of the buffer layer. To investigate the effects of surface treatments, the work of adhesion values were calculated and matched with the experimental results based on the Owens-Wendt model. Subsequently, we fabricated OSCs on surface-treated buffer layers. In particular, ZnO layers treated with poly[(9,9-bis(3'-(N,N-dimethylamino)propyl)-2,7-fluorene)-alt-2,7-(9,9-dioctylfluorene)] (PFN) simultaneously satisfied the high mechanical reliability and PCE of OSCs by achieving high work of adhesion and optimized work function.

  16. 4P-NPD ultra-thin films as efficient exciton blocking layers in DBP/C70 based organic solar cells

    Science.gov (United States)

    Patil, Bhushan R.; Liu, Yiming; Qamar, Talha; Rubahn, Horst-Günter; Madsen, Morten

    2017-09-01

    Exciton blocking effects from ultra-thin layers of N,N‧-di-1-naphthalenyl-N,N‧-diphenyl [1,1‧:4‧,1″:4″,1‴-quaterphenyl]-4,4‴-diamine (4P-NPD) were investigated in small molecule-based inverted organic solar cells (OSCs) using tetraphenyldibenzoperiflanthene as the electron donor material and fullerene (C70) as the electron acceptor material. The short-circuit current density (J SC) and power conversion efficiency (PCE) of the optimized OSCs with 0.7 nm thick 4P-NPD were approximately 16% and 24% higher, respectively, compared to reference devices without exciton blocking layers (EBLs). Drift diffusion-based device modeling was conducted to model the full current density-voltage (JV) characteristics and external quantum efficiency spectrum of the OSCs, and photoluminescence measurements were conducted to investigate the exciton blocking effects with increasing thicknesses of the 4P-NPD layer. Importantly, coupled optical and electrical modeling studies of the device behaviors and exciton generation rates and densities in the active layer for different 4P-NPD layer thicknesses were conducted, in order to gain a complete understanding of the observed increase in PCE for 4P-NPD layer thicknesses up to 1 nm, and the observed decrease in PCE for layer thicknesses beyond 1 nm. This work demonstrates a route for guiding the integration of EBLs in OSC devices.

  17. Heated squabble over Belarus marks beginning of the year / Linas Jegelevicius

    Index Scriptorium Estoniae

    Jegelevicius, Linas

    2011-01-01

    Leedu ekspresident Valdas Adamkus on kritiseerinud president Dalia Grybauskaite välispoliitikat Valgevene suhtes. 3. jaanuaril toimunud presidendi ja välisminister Andronius Azubalise kohtumisel räägiti ka Valgevene presidendivalimistest ja sealsest olukorrast. Dalia Grybauskaite prognoose ja eesmärke 2011. aastaks on samuti kritiseeritud. Leedu on 2011. aastal OSCE eesistuja

  18. Development and implementation of an objective structured clinical examination to provide formative feedback on communication and interpersonal skills in geriatric training.

    Science.gov (United States)

    O'Sullivan, Patricia; Chao, Serena; Russell, Matthew; Levine, Sharon; Fabiny, Anne

    2008-09-01

    Teaching and assessment of communication and interpersonal skills, one of the American Council for Graduate Medical Education-designated core competencies, is an important but difficult task in the training of physicians. Assessment of trainees offers an opportunity to provide explicit feedback on their skills and encourages learning. This article describes a pilot study in which clinician-educators affiliated with the geriatrics training programs at Beth Israel Deaconess Medical Center and Boston University Medical Center designed and piloted a novel Objective Structured Clinical Examination (OSCE) to assess the communication and interpersonal skills of medical, dental, and geriatric psychiatry fellows. The OSCE consisted of three stations where geriatricians and standardized patients evaluated candidates using specifically designed checklists and an abbreviated version of the Master Interview Rating Scale. Communication skills were assessed through performance of specific "real life" clinical tasks, such as obtaining a medical history, explaining a diagnosis and prognosis, giving therapeutic instructions, and counseling. Interpersonal skills were assessed through the effect of the communication between doctor and standardized patient on fostering trust, relieving anxiety, and establishing a therapeutic relationship. This pilot study demonstrated that the OSCE format of assessment provides a valid means of evaluating the communication and interpersonal skills of interdisciplinary geriatric trainees and provides a valuable forum for formative assessment and feedback. Given that geriatricians and non geriatricians involved in elder care both need communication and interpersonal skills, this novel OSCE can be used for assessment of these skills in trainees in diverse healthcare subspecialties.

  19. Molecular Packing and Arrangement Govern the Photo-Oxidative Stability of Organic Photovoltaic Materials

    KAUST Repository

    Mateker, William R.

    2015-08-19

    For long-term performance chemically robust materials are desired for organic solar cells (OSCs). Illuminating neat films of OSC materials in air and tracking the rate of absorption loss, or photobleaching, can quickly screen a material’s photo-chemical stability. In this report, we photobleach neat films of OSC materials including polymers, solution-processed oligomers, solution-processed small molecules, and vacuum-deposited small molecules. Across the materials we test, we observe photobleaching rates that span seven orders of magnitude. Furthermore, we find that the film morphology of any particular material impacts the observed photobleaching rate, and that amorphous films photobleach faster than crystalline ones. In an extreme case, films of amorphous rubrene photobleach at a rate 2500 times faster than polycrystalline films. When we compare density to photobleaching rate, we find that stability increases with density. We also investigate the relationship between backbone planarity and chemical reactivity. The polymer PBDTTPD is more photostable than it’s more twisted and less ordered furan derivitative, PBDFTPD. Finally, we relate our work to what is known about the chemical stability of structural polymers, organic pigments, and organic light emitting diode materials. For the highest chemical stability, planar materials that form dense, crystalline film morphologies should be designed for OSCs.

  20. A remarkable paradox: Freshwater algae (Botryococcus braunii) in an ancient hypersaline euxinic ecosytem

    NARCIS (Netherlands)

    Sinninghe Damsté, J.S.; Grice, K.; Schouten, S.; Nissenbaum, A.; Charrach, J.

    1998-01-01

    Two relatively immature hypersaline sediments of Miocene/Pliocene age from the Sdom Formation, Dead Sea, Israel were studied using both GC-MS and irm-GCMS analyses. A novel series of extractable organosulfur compounds (OSC) derived from functionalised lipids of freshwater Botryococcus braunii algae

  1. Study of the Contributions of Donor and Acceptor Photoexcitations to Open Circuit Voltage in Bulk Heterojunction Organic Solar Cells

    Directory of Open Access Journals (Sweden)

    Douglas Yeboah

    2017-10-01

    Full Text Available One of the key parameters in determining the power conversion efficiency (PCE of bulk heterojunction (BHJ organic solar cells (OSCs is the open circuit voltage . The processes of exciting the donor and acceptor materials individually in a BHJ OSC are investigated and are found to produce two different expressions for . Using the contributions of electron and hole quasi-Fermi levels and charge carrier concentrations, the two different expressions are derived as functions of the energetics of the donor and acceptor materials and the photo-generated charge carrier concentrations, and calculated for a set of donor-acceptor blends. The simultaneous excitation of both the donor and acceptor materials is also considered and the corresponding , which is different from the above two, is derived. The calculated from the photoexcitation of the donor is found to be somewhat comparable with that obtained from the photoexcitation of the acceptor in most combinations of the donor and acceptor materials considered here. It is also found that the calculated from the simultaneous excitations of donor and acceptor in BHJ OSCs is also comparable with the other two . All three thus derived produce similar results and agree reasonably well with the measured values. All three depend linearly on the concentration of the photoexcited charge carriers and hence incident light intensity, which agrees with experimental results. The outcomes of this study are expected to help in finding materials that may produce higher and hence enhanced PCE in BHJ OSCs.

  2. Special issue on recent progress in organic electronics and photonics

    Institute of Scientific and Technical Information of China (English)

    Fei Huang; Yong Cao

    2017-01-01

    Organic electronic and photonic devices have received tremendous attention from both academia and industry because of their great promise for practical use as organic light-emitting diodes(OLEDs),organic solar cells(OSCs),organic field-effect transistors(OFETs),and chemical and biological sensors.During the past decade,remarkable pro-

  3. 33 CFR 154.1020 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... Coordinator (OSC) means the definition in the National Oil and Hazardous Substances Pollution Contingency Plan... Contingency Plan (ACP) (for planning) or by members of the Federal On-Scene Coordinator's spill response... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Definitions. 154.1020 Section 154...

  4. Preparation and Characterization of Lignocellulosic Oil Sorbent by Hydrothermal Treatment of Populus Fiber

    Directory of Open Access Journals (Sweden)

    Yue Zhang

    2014-09-01

    Full Text Available This study is aimed at achieving the optimum conditions of hydrothermal treatment and acetylation of Populus fiber to improve its oil sorption capacity (OSC in an oil-water mixture. The characteristics of the hydrolyzed and acetylated fibers were comparatively investigated by FT-IR, CP-MAS 13C-NMR, SEM and TGA. The optimum conditions of the hydrothermal treatment and acetylation were obtained at170 °C for 1 h and 120 °C for 2 h, respectively. The maximum OSC of the hydrolyzed fiber (16.78 g/g was slightly lower than that of the acetylated fiber (21.57 g/g, but they were both higher than the maximum OSC of the unmodified fiber (3.94 g/g. In addition, acetylation after hydrothermal treatment for the Populus fiber was unnecessary as the increment of the maximum OSC was only 3.53 g/g. The hydrolyzed and the acetylated Populus fibers both displayed a lumen orifice enabling a high oil entrapment. The thermal stability of the modified fibers was shown to be increased in comparison with that of the raw fiber. The hydrothermal treatment offers a new approach to prepare lignocellulosic oil sorbent.

  5. Effects of Job Burnout and Emotional Labor on Objective Structured Clinical Examination Performance Among Interns and Residents in Taiwan.

    Science.gov (United States)

    Wang, Chen-Yu; Chen, Jen-De; Wang, Chih-Hung; Wang, Jong-Yi; Tai, Chih-Jaan; Hsieh, Tsu-Yi; Chen, Der-Yuan

    2017-01-01

    Medical education faces challenges concerning job burnout and emotional labor among junior physicians, which poses a potential threat to the quality of medical care. Although studies have investigated job burnout and emotional labor among physicians, empirical research on the association between job burnout, emotional labor, and clinical performance is lacking. This study investigated the effects of job burnout and emotional labor on clinical performance by using the objective structured clinical examination (OSCE) scores of interns and residents. Specifically, this cross-sectional study utilized the Maslach Burnout Inventory and the Emotional Labor Questionnaire as measurement instruments. A total of 225 interns and residents in central Taiwan answered structured questionnaires before beginning their OSCE. The major statistical analysis method employed was logistic regression. After adjustment for covariates, first-year residents were less likely than other residents to obtain high OSCE scores. The odds of high OSCE performance among interns and residents with high interaction component scores in emotional labor were significantly higher than those with low interaction scores. A high score in the interaction dimension of emotional labor was associated with strong clinical performance. The findings suggest that interventions which motivate positive attitudes and increase interpersonal interaction skills among physicians should receive higher priority.

  6. Impact of Electrodes on Recombination in Bulk Heterojunction Organic Solar Cells

    NARCIS (Netherlands)

    Chatri, Azadeh Rahimi; Torabi, Solmaz; Le Corre, Vincent M.; Koster, L. Jan Anton

    2018-01-01

    In recent years, the efficiency of organic solar cells (OSCs) has increased to more than 13%, although different barriers are on the way for reaching higher efficiencies. One crucial barrier is the recombination of charge carriers, which can either occur as the bulk recombination of photogenerated

  7. Molecular Packing and Arrangement Govern the Photo-Oxidative Stability of Organic Photovoltaic Materials

    KAUST Repository

    Mateker, William R.; Heumueller, Thomas; Cheacharoen, Rongrong; Sachs-Quintana, I. T.; Warnan, Julien; Liu, Xiaofeng; Bazan, Guillermo C.; Beaujuge, Pierre; McGehee, Michael D.

    2015-01-01

    For long-term performance chemically robust materials are desired for organic solar cells (OSCs). Illuminating neat films of OSC materials in air and tracking the rate of absorption loss, or photobleaching, can quickly screen a material’s photo-chemical stability. In this report, we photobleach neat films of OSC materials including polymers, solution-processed oligomers, solution-processed small molecules, and vacuum-deposited small molecules. Across the materials we test, we observe photobleaching rates that span seven orders of magnitude. Furthermore, we find that the film morphology of any particular material impacts the observed photobleaching rate, and that amorphous films photobleach faster than crystalline ones. In an extreme case, films of amorphous rubrene photobleach at a rate 2500 times faster than polycrystalline films. When we compare density to photobleaching rate, we find that stability increases with density. We also investigate the relationship between backbone planarity and chemical reactivity. The polymer PBDTTPD is more photostable than it’s more twisted and less ordered furan derivitative, PBDFTPD. Finally, we relate our work to what is known about the chemical stability of structural polymers, organic pigments, and organic light emitting diode materials. For the highest chemical stability, planar materials that form dense, crystalline film morphologies should be designed for OSCs.

  8. Bosnia ja Kosovo riigiloomise õppetunnid / Karin Maandi

    Index Scriptorium Estoniae

    Maandi, Karin

    2005-01-01

    OSCE missiooni koosseisus Kosovos ning Bosnias ja Hertsegoviinas viibinud Karin Maandi kirjeldab aspekte, mis on olnud olulised stabiilsuse tagamisel Balkanil ja Afganistanis. Autori sõnul ei võta välismaailm konflikti sekkudes tihti arvesse, et konfliktist on puudutatud paljud valdkonnad ja et pakutud lahendused peavad sobima kohalikesse oludesse. Lisa: Õppetunnid

  9. Open Source Communities in Technical Writing: Local Exigence, Global Extensibility

    Science.gov (United States)

    Conner, Trey; Gresham, Morgan; McCracken, Jill

    2011-01-01

    By offering open-source software (OSS)-based networks as an affordable technology alternative, we partnered with a nonprofit community organization. In this article, we narrate the client-based experiences of this partnership, highlighting the ways in which OSS and open-source culture (OSC) transformed our students' and our own expectations of…

  10. A digital peer-to-peer learning platform for clinical skills development.

    Science.gov (United States)

    Basnak, Jesse; Ortynski, Jennifer; Chow, Meghan; Nzekwu, Emeka

    2017-02-01

    Due to constraints in time and resources, medical curricula may not provide adequate opportunities for pre-clerkship students to practice clinical skills. To address this, medical students at the University of Alberta developed a digital peer-to-peer learning initiative. The initiative assessed if students can learn clinical skills from their peers in co-curricular practice objective structured clinical exams (OSCEs). A total of 144 first-year medical students participated. Students wrote case scenarios that were reviewed by physicians. Students enacted the cases in practice OSCEs, acting as the patient, physician, and evaluator. Verbal and electronic evaluations were completed. A digital platform was used to automate the process. Surveys were disseminated to assess student perceptions of their experience. Seventy-five percent of participants said they needed opportunities to practice patient histories and physical exams in addition to those provided in the medical school curriculum. All participants agreed that the co-curricular practice OSCEs met this need. The majority of participants also agreed that the digital platform was efficient and easy to use. Students found the practice OSCEs and digital platform effective for learning clinical skills. Thus, peer-to-peer learning and computer automation can be useful adjuncts to traditional medical curricula.

  11. Proceedings of the UAEM/IRIEM Research Symposium on Resuscitation (1985).

    Science.gov (United States)

    1985-08-01

    cardiac output, and tissue peru - Steroids slowing the heart rate in patients with sion. 4 It the pulse rate exceeds 120 Small -Rlpl.’icmt I )osc. It...than 1%) were anemia . noutropenia, lymphopenia, thrombocytopenia and prolongation of the prothrom- Stenle Water 3 days 10 days bin time 99% Sodium

  12. F-18-FDG positron emission tomography findings correlate pathological proliferative activity of oral squamous cell carcinoma

    International Nuclear Information System (INIS)

    Toyoizumi, Osamu; Oriuchi, Noboru; Miyakubo, Mitsuyuki

    2010-01-01

    It is still controversial whether fluorodeoxyglucose (FDG) uptake is correlated with cellular proliferation and prognosis of oral squamous cell carcinoma (OSC). In this study, we performed positron emission tomography (PET) study and immunohistochemical analysis to elucidate the relationship between FDG uptake and expression of cellular proliferative markers and pathological prognostic markers in patients with OSC. FDG PET and immunohistochemical staining have been carried out in sixteen patients with OSC. Tumor uptake of FDG was expressed with standardized uptake value (SUV). The expression of Ki-67, Topoisomerase IIα (Topo IIα), p53, and p63 in cancer cells was quantitatively assessed with positivity of the immunohistochemical staining. SUV was compared with the results of immunohistochemical analysis. FDG PET study revealed that SUV ranged from 3.6 to 22.1 with average of 10.4. Average positive rate of Ki-67, Topo IIα, p53, and p63 was 68.9%, 58.9%, 72.0%, and 65.2%, respectively. Pearson product-moment correlation coefficient analysis revealed that SUV was significantly correlated with Ki-67 (r=0.616, p=0.01), Topo IIα (r=0.677, p=0.004), p53 (r=0.613, p=0.01), and p63 (r=0.710, p=0.002), respectively. The present preliminary study indicated that FDG uptake was closely correlated with pathological cellular proliferative and prognostic markers in patients with OSC. (author)

  13. Alkaline earth metal doped tin oxide as a novel oxygen storage material

    Energy Technology Data Exchange (ETDEWEB)

    Dong, Qiang, E-mail: dong@tagen.tohoku.ac.jp [Institute of Multidisciplinary Research for Advanced Materials, Tohoku University, 2-1-1 Katahira, Aoba-ku Sendai 980-8577 (Japan); Yin, Shu; Yoshida, Mizuki; Wu, Xiaoyong; Liu, Bin [Institute of Multidisciplinary Research for Advanced Materials, Tohoku University, 2-1-1 Katahira, Aoba-ku Sendai 980-8577 (Japan); Miura, Akira; Takei, Takahiro; Kumada, Nobuhiro [Department of Research Interdisciplinary Graduate School of Medicine and Engineering, University of Yamanashi, Miyamae cho-7, Kofu 400-8511 (Japan); Sato, Tsugio [Institute of Multidisciplinary Research for Advanced Materials, Tohoku University, 2-1-1 Katahira, Aoba-ku Sendai 980-8577 (Japan)

    2015-09-15

    Alkaline earth metal doped tin oxide (SnO{sub 2}) hollow nanospheres with a diameter of 50 nm have been synthesized successfully via a facial solvothermal route in a very simple system composed of only ethanol, acetic acid, SnCl{sub 4}·5H{sub 2}O and A(NO{sub 3}){sub 2}·xH{sub 2}O (A = Mg, Ca, Sr, Ba). The synthesized undoped SnO{sub 2} and A-doped SnO{sub 2} hollow nanospheres were characterized by the oxygen storage capacity (OSC), X-ray diffraction, transmission electron microscopy and the Brunauer–Emmet–Teller (BET) technique. The OSC values of all samples were measured using thermogravimetric-differential thermal analysis. The incorporation of alkaline earth metal ion into tin oxide greatly enhanced the thermal stability and OSC. Especially, Ba-doped SnO{sub 2} hollow nanospheres calcined at 1000 °C for 20 h with a BET surface area of 61 m{sup 2} g{sup −1} exhibited the considerably high OSC of 457 μmol-O g{sup −1} and good thermal stability. Alkaline earth metal doped tin oxide has the potential to be a novel oxygen storage material.

  14. Decohesion Kinetics in Polymer Organic Solar Cells

    KAUST Repository

    Bruner, Christopher; Novoa, Fernando; Dupont, Stephanie; Dauskardt, Reinhold

    2014-01-01

    © 2014 American Chemical Society. We investigate the role of molecular weight (MW) of the photoactive polymer poly(3-hexylthiophene) (P3HT) on the temperature-dependent decohesion kinetics of bulk heterojunction (BHJ) organic solar cells (OSCs). The MW of P3HT has been directly correlated to its carrier field effect mobilities and the ambient temperature also affects OSC in-service performance and P3HT arrangement within the BHJ layer. Under inert conditions, time-dependent decohesion readily occurs within the BHJ layer at loads well below its fracture resistance. We observe that by increasing the MW of P3HT, greater resistance to decohesion is achieved. However, failure consistently occurs within the BHJ layer representing the weakest layer within the device stack. Additionally, it was found that at temperatures below the glass transition temperature (∼41-45 °C), decohesion was characterized by brittle failure via molecular bond rupture. Above the glass transition temperature, decohesion growth occurred by a viscoelastic process in the BHJ layer, leading to a significant degree of viscoelastic deformation. We develop a viscoelastic model based on molecular relaxation to describe the resulting behavior. The study has implications for OSC long-term reliability and device performance, which are important for OSC production and implementation.

  15. AcEST: BP913968 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp_hit_id P09311 Definition sp|P09311|US10_VZVD Genes 64/69 protein OS=Varicella-zoster virus (strain Dumas...1.6 OS=C... 30 8.2 >sp|P09311|US10_VZVD Genes 64/69 protein OS=Varicella-zoster virus (strain Dumas

  16. Effects of communication training on real practice performance: a role-play module versus a standardized patient module.

    NARCIS (Netherlands)

    Schlegel, C.; Woermann, U.; Shaha, M.; Rethans, J.J.; Vleuten, C.P.M. van der

    2012-01-01

    This study investigated the effectiveness of modules involving standardized patients and role-plays on training communication skills. The first module involved standardized patients and an Objective Structured Clinical Examination (OSCE); the second module consisted of peer role-plays and a written

  17. Flipped Learning: Can Rheumatology Lead the Shift in Medical Education?

    Science.gov (United States)

    El Miedany, Yasser; El Gaafary, Maha; El Aroussy, Nadia; Youssef, Sally

    2018-04-16

    To: 1. implement flipped classroom rheumatology teaching for undergraduate education. 2. Evaluate outcomes of teaching using OSCE assessment and student perceived effectiveness and satisfaction survey. The flipped classroom education was conducted in 3 phases. Phase 1: carried out in the students' own time. Web links were emailed to assist exposure of the instructional part of the lesson online. Phase 2: interactive in-class activity to share personal reflection and reinforce the key aspects. Phase 3: a simulated OSCE assessment. A cohort of 56-students, who were taught in the last educational year on the same topics according to standard teaching protocols, were included as control group. The clinical Outcomes were assessed using the scores of the OSCE examination model. Academic outcomes included the engagement measure as well as the students' answers to perceived effectiveness and satisfaction survey. There was no significant difference regarding demographics between the 2 students' groups. There was significant improvement (plearning, in contrast to the control group, in terms of clinical (OSCE score) as well as communication skills. Student perceived effectiveness and satisfaction was significantly higher among the flipped learning (plearning cohort showed a state of engagement significantly higher than the control group (plearning implementation musculoskeletal learning successfully demonstrated a promising platform for using technology to make better use of the students' time, and for increasing their satisfaction. Active learning increases student engagement and can lead to improved retention of knowledge. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

  18. 40 CFR 300.305 - Phase II-Preliminary assessment and initiation of action.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 27 2010-07-01 2010-07-01 false Phase II-Preliminary assessment and initiation of action. 300.305 Section 300.305 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... the OSC is informed of their activities in natural resource damage assessment that may affect response...

  19. The Reliability, Validity, and Evaluation of the Objective Structured Clinical Examination in Podiatry (Chiropody).

    Science.gov (United States)

    Woodburn, Jim; Sutcliffe, Nick

    1996-01-01

    The Objective Structured Clinical Examination (OSCE), initially developed for undergraduate medical education, has been adapted for assessment of clinical skills in podiatry students. A 12-month pilot study found the test had relatively low levels of reliability, high construct and criterion validity, and good stability of performance over time.…

  20. Outcome of parent-physician communication skills training for pediatric residents.

    Science.gov (United States)

    Nikendei, Christoph; Bosse, Hans Martin; Hoffmann, Katja; Möltner, Andreas; Hancke, Rabea; Conrad, Corinna; Huwendiek, Soeren; Hoffmann, Georg F; Herzog, Wolfgang; Jünger, Jana; Schultz, Jobst-Hendrik

    2011-01-01

    communication skills represent an essential component of clinical competence. In the field of pediatrics, communication between physicians and patients' parents is characterized by particular difficulties. To investigate the effects of a parent-physician communication skills training program on OSCE performance and self-efficacy in a group control design. parallel to their daily work in the outpatient department, intervention-group experienced clinicians in practice (n=14) participated in a communication training with standardized parents. Control-group physicians (n=14) did not receive any training beyond their daily work. Performance was assessed by independent video ratings of an OSCE. Both groups rated their self-efficacy prior to and following training. regarding OSCE performance, the intervention group demonstrated superior skills in building relationships with parents (pperform better in exploring parents' problems (pcommunication training program led to significant improvement in self-efficacy with respect to the specific training objectives in the intervention group (pcommunication training with standardized parents leads to significant improvement in OSCE performance and self-efficacy. PRACTISE IMPLICATIONS: briefness and tight structure make the presented communication training program applicable even for experienced physicians in daily clinical practice. 2010 Elsevier Ireland Ltd. All rights reserved.

  1. What to Expect During a Colonoscopy

    Medline Plus

    Full Text Available ... Pathway on the Education Universe NYU OSCE Toolkit GI Fellowship Programs Find a GI Fellowship Program GI ... Video & PSAs (YouTube) Podcasts ACG Sites GI.ORG GI.ORG cancel GI.ORG ACG CASE REPORTS ACG ...

  2. 40 CFR 300.323 - Spills of national significance.

    Science.gov (United States)

    2010-07-01

    ... affected parties and the public, and coordinating federal, state, local, and international resources at the..., EMERGENCY PLANNING, AND COMMUNITY RIGHT-TO-KNOW PROGRAMS NATIONAL OIL AND HAZARDOUS SUBSTANCES POLLUTION... to assist the OSC in communicating with affected parties and the public and coordinating federal...

  3. 78 FR 20128 - Extension of the Designation of Nicaragua for Temporary Protected Status

    Science.gov (United States)

    2013-04-03

    ... applicants may also call the OSC Worker Information Hotline at 800-255-7688 (TDD for the hearing impaired is..., Hurricane Mitch resulted in the loss of thousands of lives, displacement of thousands more, collapse of... Mitch, various hurricanes, tropical depressions, and tropical storms have resulted in loss of life...

  4. Surface functionalization of polyethylene via covalent immobilization of O-stearoyl-chitosan

    International Nuclear Information System (INIS)

    Xin, Zhirong; Hou, Juan; Ding, Jiaotong; Yang, Zongfeng; Yan, Shunjie; Liu, Chan

    2013-01-01

    When used in blood-contacting field, the hemocompatibility of polyethylene (PE) needs further to be improved. In this article, O-stearoyl-chitosans (OSC) with different esterification degrees were successfully prepared via changing the ratios of chitosan and stearoyl chloride for decreasing the cationic and hydrogen bond strength, thus improving the solubility of chitosan. The PE film was grafted with carboxyl groups of acrylic acid (AA) (PE-g-PAA) by means of O 2 plasma pre-treatment and UV-induced graft polymerization, and then PE-g-PAA was used for covalent immobilization of OSC. The above surface modification was confirmed by ATR-FTIR and XPS. Effect of the UV-irradiated graft polymerization parameters, i.e., the discharge power, the plasma pretreatment time, the UV irradiation time and the monomer concentration on the grafting density of AA was investigated. Relative to the value of about 107° for the virgin sample, the water contact angle (WCA) of the PAA-grafted film was about 50°. After the further immobilization of OSC onto the PAA-grafted film, the strength of negative charge of the PAA-grafted surface was decreased by the electropositive OSC, thus presenting a WCA value of about 62° and the excellent performance of anti-platelet adhesion with respect to the virgin and PAA-grafted samples.

  5. 32 CFR 516.72 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... RELATIONS LITIGATION Cooperation With the Office of Special Counsel § 516.72 Procedures. (a) Witnesses and... government agencies in the normal course of official business. Records constituting attorney work product... funding for travel, per diem and other necessary expenses related to the OSC investigation. These expenses...

  6. 78 FR 26332 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2013-05-06

    ... Department of Defense is publishing the unclassified text of a section 36(b)(1) arms sales notification. This... type of mission. 2. The AN/ALE-47 Counter-Measures Dispensing System (CMDS) is an integrated, threat... multiple Optical Sensor Converter (OSC) units, a Computer Processor (CP) and a Control Indicator (CI). The...

  7. Assessing clinical skills – standard setting in the objective structured ...

    African Journals Online (AJOL)

    Standardisation of the OSCE is required to define the pass mark above which a candidate performs at the level expected of a family physician. A number of standardisation processes have been described that either judge the test items prior to the exam or judge the individual during the exam. In this paper we report on an ...

  8. Adapting Objective Structured Clinical Examinations to Assess Social Work Students' Performance and Reflections

    Science.gov (United States)

    Bogo, Marion; Regehr, Cheryl; Logie, Carmen; Katz, Ellen; Mylopoulos, Maria; Regehr, Glenn

    2011-01-01

    The development of standardized, valid, and reliable methods for assessment of students' practice competence continues to be a challenge for social work educators. In this study, the Objective Structured Clinical Examination (OSCE), originally used in medicine to assess performance through simulated interviews, was adapted for social work to…

  9. Decohesion Kinetics in Polymer Organic Solar Cells

    KAUST Repository

    Bruner, Christopher

    2014-12-10

    © 2014 American Chemical Society. We investigate the role of molecular weight (MW) of the photoactive polymer poly(3-hexylthiophene) (P3HT) on the temperature-dependent decohesion kinetics of bulk heterojunction (BHJ) organic solar cells (OSCs). The MW of P3HT has been directly correlated to its carrier field effect mobilities and the ambient temperature also affects OSC in-service performance and P3HT arrangement within the BHJ layer. Under inert conditions, time-dependent decohesion readily occurs within the BHJ layer at loads well below its fracture resistance. We observe that by increasing the MW of P3HT, greater resistance to decohesion is achieved. However, failure consistently occurs within the BHJ layer representing the weakest layer within the device stack. Additionally, it was found that at temperatures below the glass transition temperature (∼41-45 °C), decohesion was characterized by brittle failure via molecular bond rupture. Above the glass transition temperature, decohesion growth occurred by a viscoelastic process in the BHJ layer, leading to a significant degree of viscoelastic deformation. We develop a viscoelastic model based on molecular relaxation to describe the resulting behavior. The study has implications for OSC long-term reliability and device performance, which are important for OSC production and implementation.

  10. Decohesion kinetics in polymer organic solar cells.

    Science.gov (United States)

    Bruner, Christopher; Novoa, Fernando; Dupont, Stephanie; Dauskardt, Reinhold

    2014-12-10

    We investigate the role of molecular weight (MW) of the photoactive polymer poly(3-hexylthiophene) (P3HT) on the temperature-dependent decohesion kinetics of bulk heterojunction (BHJ) organic solar cells (OSCs). The MW of P3HT has been directly correlated to its carrier field effect mobilities and the ambient temperature also affects OSC in-service performance and P3HT arrangement within the BHJ layer. Under inert conditions, time-dependent decohesion readily occurs within the BHJ layer at loads well below its fracture resistance. We observe that by increasing the MW of P3HT, greater resistance to decohesion is achieved. However, failure consistently occurs within the BHJ layer representing the weakest layer within the device stack. Additionally, it was found that at temperatures below the glass transition temperature (∼41-45 °C), decohesion was characterized by brittle failure via molecular bond rupture. Above the glass transition temperature, decohesion growth occurred by a viscoelastic process in the BHJ layer, leading to a significant degree of viscoelastic deformation. We develop a viscoelastic model based on molecular relaxation to describe the resulting behavior. The study has implications for OSC long-term reliability and device performance, which are important for OSC production and implementation.

  11. Space closing versus space opening for bilateral missing upper laterals - aesthetic judgments of laypeople: a web-based survey.

    Science.gov (United States)

    Qadri, Salim; Parkin, Nicola A; Benson, Philip E

    2016-06-01

    To investigate the opinions of laypeople regarding the aesthetic outcome of treating patients with developmental absence of both maxillary lateral incisors using either orthodontic space closure (OSC) or space opening and prosthetic replacement (PR). Cross sectional, web-based survey. A panel of five orthodontists and five restorative dentists examined post-treatment intra-oral images of 21 patients with developmental absence of both upper lateral incisors. A consensus view was obtained about the 10 most attractive images (5 OSC; 5 PR). The 10 selected images were used in a web-based survey involving staff and students at the University of Sheffield. In the first section, the participants were asked to evaluate the attractiveness of the 10 randomly arranged single images using a 5-point Likert scale. In the second section, an image of OSC was paired with an image of PR according to their attractiveness ranking by the clinician panel, and the participants were asked to indicate which of the two images they preferred. The survey received 959 completed responses with 9590 judgements. The images of OSC were perceived to be more attractive (mean rating 3·34 out of 5; SD 0·56) compared with the images of PR (mean rating 3·14 out of 5; SD 0·58) (mean diff 0·21; P Space closing was perceived to be more attractive than space opening by lay people. The findings have implications for advising patients about the best aesthetic outcome when both maxillary lateral incisors are missing.

  12. East And Central African Journal of Surgery Volume 11 Number 2 ...

    African Journals Online (AJOL)

    user

    2006-12-02

    Dec 2, 2006 ... In the last two years, teaching and learning becomes more clinical as students rotate through the clinical disciplines. Both formative and summative assessment (including OSCE and. OSPE) is used. .... The theme is designed by a theme design group, ... coincided with changes in our health care system.

  13. What do graduates think about a two-week rational pharmacotherapy course in the fifth year of medical education?

    NARCIS (Netherlands)

    Karaalp, A; Akici, A; Kocabasoglu, YE; Oktay, S

    The present study aims to assess the short-and mid-term post-graduation impact of a pharmacotherapy course in the fifth year at Marmara University School of Medicine by an objective (OSCE) and a subjective (questionnaires) evaluation. Statistical comparison of pretest, posttest-exposed case and

  14. Study of various n-type organic semiconductors on ultraviolet detective and electroluminescent properties of optoelectronic integrated device

    Science.gov (United States)

    Deng, Chaoxu; Shao, Bingyao; Zhao, Dan; Zhou, Dianli; Yu, Junsheng

    2017-11-01

    Organic optoelectronic integrated device (OID) with both ultraviolet (UV) detective and electroluminescent (EL) properties was fabricated by using a thermally activated delayed fluorescence (TADF) semiconductor of (4s, 6s)-2,4,5,6-tetra(9H-carbazol-9-yl)isophthalonitrile (4CzIPN) as an emitter. The effect of five kinds of n-type organic semiconductors (OSCs) on the enhancement of UV detective and EL properties of OID was systematically studied. The result shows that two orders of magnitude in UV detectivity from 109 to 1011 Jones and 3.3 folds of luminance from 2499 to 8233 cd m-2 could be achieved. The result shows that not only the difference of lowest unoccupied molecular orbital (LUMO) between active layer and OSC but also the variety of electron mobility have a significant effect on the UV detective and EL performance through adjusting electron injection/transport. Additionally, the optimized OSC thickness is beneficial to confine the leaking of holes from the active layer to cathode, leading to the decrease of dark current for high detective performance. This work provides a useful method on broadening OSC material selection and device architecture construction for the realization of high performance OID.

  15. Organic and perovskite solar cells: Working principles, materials and interfaces.

    Science.gov (United States)

    Marinova, Nevena; Valero, Silvia; Delgado, Juan Luis

    2017-02-15

    In the last decades organic solar cells (OSCs) have been considered as a promising photovoltaic technology with the potential to provide reasonable power conversion efficiencies combined with low cost and easy processability. Unexpectedly, Perovskite Solar Cells (PSCs) have experienced unprecedented rise in Power Conversion Efficiency (PCE) thus emerging as a highly efficient photovoltaic technology. OSCs and PSCs are two different kind of devices with distinct charge generation mechanism, which however share some similarities in the materials processing, thus standard strategies developed for OSCs are currently being employed in PSCs. In this article, we recapitulate the main processes in these two types of photovoltaic technologies with an emphasis on interfacial processes and interfacial modification, spotlighting the materials and newest approaches in the interfacial engineering. We discuss on the relevance of well-known materials coming from the OSCs field, which are now being tested in the PSCs field, while maintaining a focus on the importance of the material design for highly efficient, stable and accessible solar cells. Copyright © 2016 Elsevier Inc. All rights reserved.

  16. Emulsion-Based RIR-MAPLE Deposition of Conjugated Polymers: Primary Solvent Effect and Its Implications on Organic Solar Cell Performance.

    Science.gov (United States)

    Ge, Wangyao; Li, Nan K; McCormick, Ryan D; Lichtenberg, Eli; Yingling, Yaroslava G; Stiff-Roberts, Adrienne D

    2016-08-03

    Emulsion-based, resonant infrared matrix-assisted pulsed laser evaporation (RIR-MAPLE) has been demonstrated as an alternative technique to deposit conjugated polymer films for photovoltaic applications; yet, a fundamental understanding of how the emulsion target characteristics translate into film properties and solar cell performance is unclear. Such understanding is crucial to enable the rational improvement of organic solar cell (OSC) efficiency and to realize the expected advantages of emulsion-based RIR-MAPLE for OSC fabrication. In this paper, the effect of the primary solvent used in the emulsion target is studied, both experimentally and theoretically, and it is found to determine the conjugated polymer cluster size in the emulsion as well as surface roughness and internal morphology of resulting polymer films. By using a primary solvent with low solubility-in-water and low vapor pressure, the surface roughness of deposited P3HT and PCPDTBT polymer films was reduced to 10 nm, and the efficiency of P3HT:PC61BM OSCs was increased to 3.2% (∼100 times higher compared to the first MAPLE OSC demonstration [ Caricato , A. P. ; Appl. Phys. Lett. 2012 , 100 , 073306 ]). This work unveils the mechanism of polymer film formation using emulsion-based RIR-MAPLE and provides insight and direction to determine the best ways to take advantage of the emulsion target approach to control film properties for different applications.

  17. Validation of the behavior and concept based assessment of professionalism competence in postgraduate first-year residents

    Directory of Open Access Journals (Sweden)

    Ying-Ying Yang

    2013-04-01

    Conclusion: The current study suggests that the p-OSCE, p-360° evaluation, and p-mini-CEX are feasible methods for evaluating professionalism in clinical training of PGY1 residents. Combination of the above three evaluations, participation, and support from multiple constituencies and multiple representatives provides good reliability and adds credibility in the assessment of professionalism competence.

  18. Surgical insertion of central venous catheters in low-birth-weight ...

    African Journals Online (AJOL)

    Aim: Neonatal central vascular access (CVA) represents a daily practice in neonatal intensive care unit. Low birth weight (LBW) neonates pose a challenge to anesthetists who try the landmark technique to cannulate central veins. We reported our experience of open surgical cutdown (OSC) to insert catheters through right ...

  19. The Implementation and Development of an Objective Structured Clinical Examination in the Community Pharmacy Course of a Select Gulf-Region Academic Institution (Ras Al Khaimah College of Pharmaceutical Sciences): A Pilot Study

    Science.gov (United States)

    Al-Azzawi, Amad Mohammed Jamil; Nagavi, B.G.; Hachim, Mahmood Y.; Mossa, Omar H.

    2016-01-01

    Background: Objective Structured Clinical Examinations (OSCEs) were used to assess translational pharmacotherapeutic skills of a Gulf-region representative academic institution. Aim: The aim of the current study was to assess the clinical skills of students enrolled within the third year Bachelor of Pharmacy (BPharm) programme within Ras Al…

  20. Use of an Objective Structured Clinical Examination in Clinical Nurse Specialist Education.

    Science.gov (United States)

    Cuevas, Heather E; Timmerman, Gayle M

    2016-01-01

    Helping patients maximize their potential using expert coaching to facilitate lifestyle change is an important practice area for clinical nurse specialists (CNSs). The purpose is to determine the usefulness of objective structured clinical examinations (OSCEs) for evaluating CNS students' coaching competencies in the context of facilitating lifestyle change. Despite the use of OSCEs to assess competencies in clinical skills (eg, performance of procedures, decision making), its potential for evaluating coaching competencies for lifestyle change has not been demonstrated. We developed 4 OSCEs dealing with coaching patients in exercise, weight loss, stress reduction, or nonpharmacologic management of hyperlipidemia. Evaluation criteria included (1) approach to the patient, (2) information gathering, (3) motivational interviewing, and (4) management (medical and behavioral strategies). Student performance ranged from highly organized with proficient coaching skills to disorganized and focused solely on clinical management and prescriptive communication. Student responses were positive. Objective structured clinical examinations were highly useful for evaluating CNS students' coaching competencies for lifestyle change. Using OSCEs early in the semester to provide students feedback on their performance and again at the end to determine improvement optimizes use of this teaching strategy.

  1. 75 FR 67169 - Foreign Institutions-Federal Student Aid Programs

    Science.gov (United States)

    2010-11-01

    ... research done by an individual student in the United States for not more than one academic year is... student in the United States for not more than one academic year, if it is conducted during the..., modified essay questions (MEQs), essays, and Objective Structured Clinical Exams (OSCEs)--are given greater...

  2. Solution processable organic polymers and small molecules for bulk-heterojunction solar cells: A review

    International Nuclear Information System (INIS)

    Sharma, G. D.

    2011-01-01

    Solution processed bulk heterojunction (BHJ) organic solar cells (OSCs) have gained wide interest in past few years and are established as one of the leading next generation photovoltaic technologies for low cost power production. Power conversion efficiencies up to 6% and 6.5% have been reported in the literature for single layer and tandem solar cells, respectively using conjugated polymers. A recent record efficiency about 8.13% with active area of 1.13 cm 2 has been reported. However Solution processable small molecules have been widely applied for photovoltaic (PV) devices in recent years because they show strong absorption properties, and they can be easily purified and deposited onto flexible substrates at low cost. Introducing different donor and acceptor groups to construct donor--acceptor (D--A) structure small molecules has proved to be an efficient way to improve the properties of organic solar cells (OSCs). The power conversion efficiency about 4.4 % has been reported for OSCs based on the small molecules. This review deals with the recent progress of solution processable D--A structure small molecules and discusses the key factors affecting the properties of OSCs based on D--A structure small molecules: sunlight absorption, charge transport and the energy level of the molecules.

  3. Late stage crystallization and healing during spin-coating enhance carrier transport in small-molecule organic semiconductors

    KAUST Repository

    Chou, Kang Wei; Khan, Hadayat Ullah; Niazi, Muhammad Rizwan; Yan, Buyi; Li, Ruipeng; Payne, Marcia M.; Anthony, John Edward; Smilgies, Detlef Matthias; Amassian, Aram

    2014-01-01

    Spin-coating is currently the most widely used solution processing method in organic electronics. Here, we report, for the first time, a direct investigation of the formation process of the small-molecule organic semiconductor (OSC) 6,13-bis

  4. Incorporating Active Learning into a Psychiatry Clerkship: Does It Make a Difference?

    Science.gov (United States)

    Morreale, Mary; Arfken, Cynthia; Bridge, Patrick; Balon, Richard

    2012-01-01

    Objective: Medical students' satisfaction with the psychiatry clerkship, sense of preparedness for an institutional Objective Structured Clinical Exam (OSCE), expressed likelihood of choosing psychiatry as a specialty, and National Board of Medical Examiners (NBME) psychiatry shelf-examination scores were compared after a curriculum based on…

  5. A cost-benefit analysis of the outpatient smoking cessation services in Taiwan from a societal viewpoint.

    Science.gov (United States)

    Chen, Pei-Ching; Lee, Yue-Chune; Tsai, Shih-Tzu; Lai, Chih-Kuan

    2012-05-01

    This study applied a cost-benefit analysis from a societal viewpoint to evaluate the Outpatient Smoking Cessation Services (OSCS) program. The costs measured in this study include the cost to the health sector, non-health sectors, the patients and their family, as well as the loss of productivity as a result of smoking. The benefits measured the medical costs savings and the earnings due to the increased life expectancy of a person that has stopped smoking for 15 years. Data were obtained from the primary data of a telephone survey, the literatures and reports from the Outpatient Smoking Cessation Management Center and government. Sensitivity analyses were conducted to verify the robustness of the results. There were 169,761 cases that participated in the outpatient smoking cessation program in the years 2007 and 2008, of those cases, 8,282 successfully stopped smoking. The total cost of the OSCS program was 18 million USD. The total benefits of the program were 215 million USD with a 3% discount rate; the net benefit to society was 196 million USD. After conducting sensitivity analyses on the different abstinence, relapse, and discount rates, from a societal perspective, the benefits still far exceeded the costs, while from a health care perspective, there was only a net benefit when the respondent's abstinence rate was used. From a societal perspective, the OSCS program in Taiwan is cost-beneficial. This study provides partial support for the policy makers to increase the budget and expand the OSCS program.

  6. Technical skills acquisition in surgery-bound senior medical students: an evaluation of student assertiveness.

    Science.gov (United States)

    Talbott, Vanessa A; Marks, Joshua A; Bodzin, Adam S; Comeau, Jason A; Maxwell, Pinckney J; Isenberg, Gerald A; Martin, Niels D

    2012-01-01

    To prepare students pursuing surgical careers, we devised a senior subinternship curriculum supplement that focused on the acquisition of technical skills required of surgical residents. We hypothesized that more assertive students, those that accomplished more of the curriculum, would perform better on a technical skills Objective Structured Clinical Examination (OSCE). Senior medical students rotating on their first general surgery subinternship were administered a 6-station OSCE on the first day of their subinternship and again during the final week of the month-long rotation. A self-directed, 38-task "scavenger hunt" representing common intern level clinical skills, procedures, and patient care activities was provided to each student. The study was performed at Jefferson Medical College, a large, private medical school in Philadelphia, PA. Forty-nine senior students completed surgical subinternships between July 2009 and September 2010, and participated both in the pre-/post-OSCEs and the scavenger hunt. Students performed significantly better on the post-rotation OSCE than on the pre-rotation OSCE; 70.2% ± 8.1% vs. 60.4% ± 12.0%, p Assertiveness scores from the "scavenger hunt" did not correlate with final OSCE scores (r = -0.328, p = 0.25), and were negatively correlated with the change between pre- and post-OSCE scores (r = -0.573, p assertiveness scores were determined by the number of tasks completed over the course of the rotation. As surgical education becomes more streamlined with evolving work hour restrictions, medical school education is playing an increasingly pivotal role in preparing students for internship. In our study, individual assertiveness in completing structured self-directed learning tasks did not directly predict the acquisition of proficiency in technical skills. We feel assertiveness is overshadowed by other factors that may carry more weight in terms of technical skills acquisition. Further studies are required to delineate these

  7. Evaluation of the Effectiveness of Postgraduate General Medicine Training by Objective Structured Clinical Examination—Pilot Study and Reflection on the Experiences of Kaohsiung Medical University Hospital

    Directory of Open Access Journals (Sweden)

    Jer-Chia Tsai

    2008-12-01

    Full Text Available Objective structured clinical examination (OSCE is an effective assessment method to evaluate medical students' clinical competencies performance. Postgraduate year 1 (PGY1 residents have been initiated in a general medicine training program in Taiwan since 2003. However, little is known about the learning effectiveness of trainees from this program. This pilot study aimed to evaluate the clinical core competencies of PGY1 residents using OSCE, and to reflect on the strengths and weaknesses of this pilot assessment project. OSCE was conducted for five PGY1 examinees (4 men, 1 woman with five stations covering core themes, including history taking, physical examination, clinical procedure of airway intubation, clinical reasoning, and communication skills for informing bad news. Itemized checklists and five-point Likert scale global ratings were used for evaluating performance. The results showed that the performance of our PGY1 residents on history taking was significantly better after about 2 months of postgraduate training on general internal medicine. Self-evaluation on performance by examinees revealed significantly lower global ratings on post-course OSCE (4.14 ± 0.80 vs. 3.68 ± 0.66; p < 0.02. Surveys from tutors and standardized patients (SPs completed at pre- and post-course OSCEs showed consistently favorable responses on the purposes, content, process, and environment of this assessment (4.0 ± 0.17 vs. 4.0 ± 0.12, nonsignificant. However, a survey of the examinees completed at preand post-course OSCEs showed relatively unfavorable responses to the same aspects, and to tutors and SPs (4.1 ± 0.09 vs. 3.7 ± 0.18; p < 0.05. Qualitative information revealed that tutors and SPs remarked that PGY1 residents' medical knowledge performance was satisfactory but their clinical reasoning performance, communication skills (giving bad news and self-confidence were unsatisfactory. In conclusion, this pilot study has demonstrated that OSCE is a

  8. Oxygen storage capacity and structural properties of Ni-doped LaMnO3 perovskites

    International Nuclear Information System (INIS)

    Ran, Rui; Wu, Xiaodong; Weng, Duan; Fan, Jun

    2013-01-01

    Graphical abstract: Dynamic OSC of (a) fresh and (b) aged LaMn 1−x Ni x O 3 perovskites (0.1 Hz). Aged condition: 1050 °C, 5 h, 7% steam in air. The LaMn 1−x Ni x O 3 perovskites exhibit considerable dynamic OSC in comparison to CeO 2 –ZrO 2 (CZ), even after 1050 °C hydrothermal ageing for 5 h. Highlights: •Ni-doped LaMnO 3 perovskites exhibit very large dynamic OSC and high oxygen storage rate. •Mn 4+ is favourable to the releasable oxygen. •Doping of Ni ions increase the Mn 4+ content and the oxygen vacancies. •Doping of Ni ions reduce the BO 6 distortion in the LaMnO 3 perovskites. -- Abstract: A series of Ni doped LaMnO 3 perovskites were prepared by a sol–gel method as oxygen storage materials. Powder X-ray diffraction (XRD), X-ray adsorption fine structure (XAFS), oxygen storage capacity (OSC) and H 2 -temperature program reduction (TPR) measurements were performed to investigate the OSC of the perovskites as well as the effects of Ni on the structural properties. The results showed that the Ni-doped LaMnO 3 perovskite exhibited very large dynamic OSC and high oxygen release rate, which provided a possibility to serve as an oxygen storage material candidate in three-way catalysts. The available oxygen species below 500 °C primarily originated from the redox reaction between Mn 4+ and Mn 3+ , and the more Mn 4+ were favourable to the releasable oxygen. The doping of appropriate Ni ions promoted the OSC of the LaMnO 3 perovskites by increasing the Mn 4+ content and adjusting the structural defects. On the other hand, the doped Ni ions could make the BO 6 distortion disappearing in the LaMnO 3 perovskites to reduce the lattice oxygen activity

  9. Objective structured clinical examination "Death Certificate" station - Computer-based versus conventional exam format.

    Science.gov (United States)

    Biolik, A; Heide, S; Lessig, R; Hachmann, V; Stoevesandt, D; Kellner, J; Jäschke, C; Watzke, S

    2018-04-01

    One option for improving the quality of medical post mortem examinations is through intensified training of medical students, especially in countries where such a requirement exists regardless of the area of specialisation. For this reason, new teaching and learning methods on this topic have recently been introduced. These new approaches include e-learning modules or SkillsLab stations; one way to objectify the resultant learning outcomes is by means of the OSCE process. However, despite offering several advantages, this examination format also requires considerable resources, in particular in regards to medical examiners. For this reason, many clinical disciplines have already implemented computer-based OSCE examination formats. This study investigates whether the conventional exam format for the OSCE forensic "Death Certificate" station could be replaced with a computer-based approach in future. For this study, 123 students completed the OSCE "Death Certificate" station, using both a computer-based and conventional format, half starting with the Computer the other starting with the conventional approach in their OSCE rotation. Assignment of examination cases was random. The examination results for the two stations were compared and both overall results and the individual items of the exam checklist were analysed by means of inferential statistics. Following statistical analysis of examination cases of varying difficulty levels and correction of the repeated measures effect, the results of both examination formats appear to be comparable. Thus, in the descriptive item analysis, while there were some significant differences between the computer-based and conventional OSCE stations, these differences were not reflected in the overall results after a correction factor was applied (e.g. point deductions for assistance from the medical examiner was possible only at the conventional station). Thus, we demonstrate that the computer-based OSCE "Death Certificate" station

  10. Chlorophyll J-aggregates: from bioinspired dye stacks to nanotubes, liquid crystals, and biosupramolecular electronics.

    Science.gov (United States)

    Sengupta, Sanchita; Würthner, Frank

    2013-11-19

    Among the natural light-harvesting (LH) systems, those of green sulfur and nonsulfur photosynthetic bacteria are exceptional because they lack the support of a protein matrix. Instead, these so-called chlorosomes are based solely on "pigments". These are self-assembled bacteriochlorophyll c, d, and e derivatives, which consist of a chlorophyll skeleton bearing a 3(1)-hydroxy functional group. Chemists consider the latter as an essential structural unit to direct the formation of light-harvesting self-assembled dye aggregates with J-type excitonic coupling. The intriguing properties of chlorosomal J-type aggregates, particularly narrow red-shifted absorption bands, compared with monomers and their ability to delocalize and migrate excitons, have inspired intense research activities toward synthetic analogues in this field. The ultimate goal of this research field is the development of (opto-)electronic devices based on the architectural principle of chlorosomal LH systems. In this regard, the challenge is to develop small, functional building blocks with appropriate substituents that are preprogrammed to self-assemble across different length scales and to emulate functions of natural LH systems or to realize entirely new functions beyond those found in nature. In this Account, we highlight our achievements in the past decade with semisynthetic zinc chlorins (ZnChls) as model compounds of bacteriochlorophylls obtained from the naturally most abundant chlorin precursor: chlorophyll a. To begin, we explore how supramolecular strategies involving π-stacking, hydrogen bonding, and metal-oxygen coordination can be used to design ZnChl-based molecular stack, tube, and liquid crystalline assemblies conducive to charge and energy transport. Our design principle is based on the bioinspired functionalization of the 3(1)-position of ZnChl with a hydroxy or methoxy group; the former gives rise to tubular assemblies, whereas the latter induces stack assemblies. Functionalization

  11. Acceptability and Impact of a Required Palliative Care Rotation with Prerotation and Postrotation Observed Simulated Clinical Experience during Internal Medicine Residency Training on Primary Palliative Communication Skills.

    Science.gov (United States)

    Vergo, Maxwell T; Sachs, Sharona; MacMartin, Meredith A; Kirkland, Kathryn B; Cullinan, Amelia M; Stephens, Lisa A

    2017-05-01

    Improving communication training for primary palliative care using a required palliative care rotation for internal medicine (IM) residents has not been assessed. To assess skills acquisition and acceptability for IM residents not selecting an elective. A consecutive, single-arm cohort underwent preobjective structured clinical examination (OSCE) with learner-centric feedback, two weeks of clinical experience, and finally a post-OSCE to crystallize learner-centric take home points. IM second year residents from Dartmouth-Hitchcock were exposed to a required experiential palliative care rotation. Pre- and post-OSCE using a standardized score card for behavioral skills, including patient-centered interviewing, discussing goals of care/code status, and responding to emotion, as well as a confidential mixed qualitative and quantitative evaluation of the experience. Twelve residents were included in the educational program (two were excluded because of shortened experiences) and showed statistically significant improvements in overall communication and more specifically in discussing code status and responding to emotions. General patient-centered interviewing skills were not significantly improved, but prerotation scores reflected pre-existing competency in this domain. Residents viewed the observed simulated clinical experience (OSCE) and required rotation as positive experiences, but wished for more opportunities to practice communication skills in real clinical encounters. A required palliative care experiential rotation flanked by OSCEs at our institution improved the acquisition of primary palliative care communication skills similarly to other nonclinical educational platforms, but may better meet the needs of the resident and faculty as well as address all required ACGME milestones.

  12. Ag-Pd-Cu alloy inserted transparent indium tin oxide electrodes for organic solar cells

    International Nuclear Information System (INIS)

    Kim, Hyo-Joong; Seo, Ki-Won; Kim, Han-Ki; Noh, Yong-Jin; Na, Seok-In

    2014-01-01

    The authors report on the characteristics of Ag-Pd-Cu (APC) alloy-inserted indium tin oxide (ITO) films sputtered on a glass substrate at room temperature for application as transparent anodes in organic solar cells (OSCs). The effect of the APC interlayer thickness on the electrical, optical, structural, and morphological properties of the ITO/APC/ITO multilayer were investigated and compared to those of ITO/Ag/ITO multilayer electrodes. At the optimized APC thickness of 8 nm, the ITO/APC/ITO multilayer exhibited a resistivity of 8.55 × 10 −5 Ω cm, an optical transmittance of 82.63%, and a figure-of-merit value of 13.54 × 10 −3 Ω −1 , comparable to those of the ITO/Ag/ITO multilayer. Unlike the ITO/Ag/ITO multilayer, agglomeration of the metal interlayer was effectively relieved with APC interlayer due to existence of Pd and Cu elements in the thin region of the APC interlayer. The OSCs fabricated on the ITO/APC/ITO multilayer showed higher power conversion efficiency than that of OSCs prepared on the ITO/Ag/ITO multilayer below 10 nm due to the flatness of the APC layer. The improved performance of the OSCs with ITO/APC/ITO multilayer electrodes indicates that the APC alloy interlayer prevents the agglomeration of the Ag-based metal interlayer and can decrease the thickness of the metal interlayer in the oxide-metal-oxide multilayer of high-performance OSCs

  13. Electrohydrodynamic spinning of random-textured silver webs for electrodes embedded in flexible organic solar cells

    Science.gov (United States)

    Yoon, Dai Geon; Chin, Byung Doo; Bail, Robert

    2017-03-01

    A convenient process for fabricating a transparent conducting electrode on a flexible substrate is essential for numerous low-cost optoelectronic devices, including organic solar cells (OSCs), touch sensors, and free-form lighting applications. Solution-processed metal-nanowire arrays are attractive due to their low sheet resistance and optical clarity. However, the limited conductance at wire junctions and the rough surface topology still need improvement. Here, we present a facile process of electrohydrodynamic spinning using a silver (Ag) - polymer composite paste with high viscosity. Unlike the metal-nanofiber web formed by conventional electrospinning, a relatively thick, but still invisible-to-naked eye, Ag-web random pattern was formed on a glass substrate. The process parameters such as the nozzle diameter, voltage, flow rate, standoff height, and nozzle-scanning speed, were systematically engineered. The formed random texture Ag webs were embedded in a flexible substrate by in-situ photo-polymerization, release from the glass substrate, and post-annealing. OSCs with a donor-acceptor polymeric heterojunction photoactive layer were prepared on the Ag-web-embedded flexible films with various Ag-web densities. The short-circuit current and the power conversion efficiency of an OSC with a Ag-web-embedded electrode were not as high as those of the control sample with an indium-tin-oxide electrode. However, the Ag-web textures embedded in the OSC served well as electrodes when bent (6-mm radius), showing a power conversion efficiency of 2.06% (2.72% for the flat OSC), and the electrical stability of the Ag-web-textured patterns was maintained for up to 1,000 cycles of bending.

  14. Exploring personality dimensions that influence practice and performance of a simulated laparoscopic task in the objective structured clinical examination.

    Science.gov (United States)

    Malhotra, Neha; Poolton, Jamie M; Wilson, Mark R; Leung, Gilberto; Zhu, Frank; Fan, Joe K M; Masters, Rich S W

    2015-01-01

    Surgical educators have encouraged the investigation of individual differences in aptitude and personality in surgical performance. An individual personality difference that has been shown to influence laparoscopic performance under time pressure is movement specific reinvestment. Movement specific reinvestment has 2 dimensions, movement self-consciousness (MS-C) (i.e., the propensity to consciously monitor movements) and conscious motor processing (CMP) (i.e., the propensity to consciously control movements), which have been shown to differentially influence laparoscopic performance in practice but have yet to be investigated in the context of psychological stress (e.g., the objective structured clinical examination [OSCE]). This study investigated the role of individual differences in propensity for MS-C and CMP in practice of a fundamental laparoscopic skill and in laparoscopic performance during the OSCE. Furthermore, this study examined whether individual differences during practice of a fundamental laparoscopic skill were predictive of laparoscopic performance during the OSCE. Overall, 77 final-year undergraduate medical students completed the movement specific reinvestment scale, an assessment tool that quantifies the propensity for MS-C and CMP. Participants were trained to proficiency on a fundamental laparoscopic skill. The number of trials to reach proficiency was measured, and completion times were recorded during early practice, later practice, and the OSCE. There was a trend for CMP to be negatively associated with the number of trials to reach proficiency (p = 0.064). A higher propensity for CMP was associated with fewer trials to reach proficiency (β = -0.70, p = 0.023). CMP and MS-C did not significantly predict completion times in the OSCE (p > 0.05). Completion times in early practice (β = 0.05, p = 0.016) and later practice (β = 0.47, p personality differences and individual differences in ability during practice could help inform the

  15. Short communication: Persistent socio-economic inequality in frequent headache among Danish adolescents from 1991 to 2014.

    Science.gov (United States)

    Holstein, B E; Andersen, A; Denbaek, A M; Johansen, A; Michelsen, S I; Due, P

    2018-05-01

    The association between socio-economic status (SES) and headache among adolescents is an understudied issue, and no study has examined whether such an association changes over time. The aim was to examine trends in socio-economic inequality in frequent headache among 11- to 15-year-olds in Denmark from 1991 to 2014, using occupational social class (OSC) as indicator of SES. The study applies data from the Danish part of the international Health Behaviour in School-aged Children (HBSC) study. HBSC includes nationally representative samples of 11-, 13- and 15-year-olds. This study combines data from seven data survey years from 1991 to 2014, participation rate 88.6%, n = 31,102. We report absolute inequality as per cent difference in frequent headache between high and low OSC and relative inequality as odds ratio for frequent headache by OSC. In the entire study population, 10.4% reported frequent headache. There was a significant increase in frequent headache from 8.0% in 1991 to 12.9% in 2014, test for trend, p economic inequality in frequent headache was persistent from 1991 to 2014. There was a significant and persistent socio-economic inequality, i.e. increasing prevalence of frequent headache with decreasing OSC. The association between socio-economic position and headache did not significantly change over time, i.e. the statistical interaction between OSC and survey year was insignificant. The prevalence of frequent headache among adolescents increases with decreasing SES. This socio-economic inequality has been persistent among adolescents in Denmark from 1991 to 2014. Clinicians should be aware of this social inequality. © 2018 European Pain Federation - EFIC®.

  16. Radiology as part of an objective structured clinical examination on clinical skills

    Energy Technology Data Exchange (ETDEWEB)

    Berk, I.A.H. van den, E-mail: i.a.h.van_den_berk@lumc.nl [Department of Radiology, Leiden University Medical Centre, Postbus 9600, 2300 RC Leiden (Netherlands); Ridder, J.M.M. van de, E-mail: J.M.M.vandeRidder@umcutrecht.nl [School of Medical Sciences, University Medical Centre Utrecht, Heidelberglaan 100, 3584 CX Utrecht (Netherlands); Schaik, J.P.J. van, E-mail: J.P.J.vanSchaik@umcutrecht.nl [Department of Radiology, University Medical Centre Utrecht, Heidelberglaan 100 E01-132, 3584 CX Utrecht (Netherlands)

    2011-06-15

    Introduction: An objective structured clinical examination (OSCE) assessess clinical competence in a standardised and context related manner. Compared with written tests, OSCE's are more susceptible to reliability errors because of the use of multiple cases and multiple examiners. In the pre-clinical phase of the medical curriculum of the University Medical Centre Utrecht, an OSCE is organised as a medical consult. We evaluated the radiology station. Method: Four questions were formulated: {center_dot}What is the internal consistency of the items of the radiology station? {center_dot}How do the scores on the radiology station compare with the scores on the test excluding radiology? {center_dot}How do different cases differ in scores? {center_dot}What are the differences in score between the examiners? We analysed the OSCE results of second year medical students in 2004. Results: Two hundred and sixty-five students were examined in the OSCE in 2004. Ninty-three Students were examined in the radiology station. Cronbach's alpha coefficient for the radiology station was 0.92. The average score for the radiology station was 3.8 (0.87). The average score for the test without radiology was 3.9 (0.32). The range of the average scores for the six different cases was 0.5 (3.6-4.1). The range of the average scores for the five examiners was 1.0 (3.3-4.3). Conclusion: The internal consistency of the items in the radiology station is good. The average score for the radiology station is similar to that of the other stations. The range of the scores between the different cases was relatively small. The range of the scores between the different examiners was clearly larger.

  17. Ternary Organic Solar Cells with Coumarin7 as the Donor Exhibiting Greater Than 10% Power Conversion Efficiency and a High Fill Factor of 75.

    Science.gov (United States)

    Chen, Xin-Wei; Tao, Si-Lu; Fan, Cong; Chen, Dong-Cheng; Zhou, Ling; Lin, Hui; Zheng, Cai-Jun; Su, Shi-Jian

    2017-09-06

    Ternary bulk heterojunction (BHJ) is a brilliant photovoltaic technology for improving the performance of organic solar cells (OSCs), because the light absorption range can be significantly extended by using multiple donors or acceptor materials. In this paper, coumarin7 (C7), a small organic molecule typical led used in organic light-emitting diodes, was initially exploited as second electron-donor component in ternary bulk heterojunction OSCs along with conventional blend system spolythieno[3,4-b]-thiophene/benzodithiophene(PTB7) and [6,6]-phenyl-C71 -butyric acid methyl(PC 71 BM). A champion PCE value of 10.28% was realized in the ternary OSCs when incorporated with 10 wt % C7 doping ratio in the donors, corresponding to about 35% enhancement compared with the PTB7:PC 71 BM-based OSCs, a high fill factor (FF) of 75.03%, a short-circuit currentdensity (J sc ) of 18.72 mA cm -2 and an open-circuit voltage (V oc ) of 0.73 V. The enhanced performance of the ternary OSCs can be attributed to the simultaneous improvement of the FF and the J sc . In addition to extended light absorption, a perfect nanofiber filament active layer morphology is obtained due to the good compatibility between C7 and PTB7, which facilitates the balance of charge transportation and the suppression of charge recombination. This investigation suggests that coumarin derivatives, which have completely different structure with polymer donors, can also be used to fabricate ternary solar cells and have the potential applications to obtain amazing performance after further device engineering and optimization.

  18. The Office of Site Closure: Progress in the Face of Challenges

    International Nuclear Information System (INIS)

    Fiore, J. J.; Murphie, W. E.; Meador, S. W.

    2002-01-01

    The Office of Site Closure (OSC) was formed in November 1999 when the Department of Energy's (DOE's) Office of Environmental Management (EM) reorganized to focus specifically on site cleanup and closure. OSC's objective is to achieve safe and cost-effective cleanups and closures that are protective of our workers, the public, and the environment, now and in the future. Since its inception, OSC has focused on implementing a culture of safe closure, with emphasis in three primary areas: complete our responsibility for the Closure Sites Rocky Flats, Mound, Fernald, Ashtabula, and Weldon Spring; complete our responsibility for cleanup at sites where the DOE mission has been completed (examples include Battelle King Avenue and Battelle West Jefferson in Columbus, and General Atomics) or where other Departmental organizations have an ongoing mission (examples include the Brookhaven, Livermore, or Los Alamos National Laboratories, and the Nevada Test Site); and create a framework a nd develop specific business closure tools that will help sites close, such as guidance for and decisions on post-contract benefit liabilities, records retention, and Federal employee incentives for site closure. This paper discusses OSC's 2001 progress in achieving site cleanups, moving towards site closure, and developing specific business closure tools to support site closure. It describes the tools used to achieve progress towards cleanup and closure, such as the application of new technologies, changes in contracting approaches, and the development of agreements between sites and with host states. The paper also identifies upcoming challenges and explores options for how Headquarters and the sites can work together to address these challenges. Finally, it articulates OSC's new focus on oversight of Field Offices to ensure they have the systems in place to oversee contractor activities resulting in site cleanups and closures

  19. The impact of outpatient clinical teaching on students' academic performance in obstetrics and gynecology.

    Science.gov (United States)

    Hassan, Bahaeldin A; Elfaki, Omer A; Khan, Muhammed A

    2017-01-01

    Clinical teaching at outpatient settings is an essential part of undergraduate medical students' training. The increasing number of students in many medical schools and short hospital stays makes inpatient teaching alone insufficient to provide students with the required clinical skills. To make up this shortfall, outpatient clinical teaching has been implemented by our Department of Obstetrics and Gynecology, King Khalid University, KSA, throughout the academic year 2015-2016. The aim of this study was to evaluate the impact of clinical teaching at outpatient settings on the academic performance of our students. In this comparative retrospective study, the effects of outpatient clinical teaching of obstetrics and gynecology on the academic performance of student was assessed through an objective structured clinical examination (OSCE). During their course on obstetrics and gynecology, 58 students had their clinical teaching both at inpatient and outpatient settings and constituted "study group". The remaining 52 students had clinical teaching only at inpatient settings and were considered "control group". Students in both groups sat for OSCE at the end of week 8 of the gynecology course. Students in both groups sat for OSCE at the end of week 8 of the gynecology course. Four stations were used for assessment: obstetric history, gynecological history, obstetric physical examination of pregnant women, and gynecological procedure station. Twenty marks were allocated for each station giving a total score of 80. The OSCE scores for study group were compared with those of the control group using Student's t -test; p performance in OSCE. There is evidence of remarkable improvement in the mastery of clinical skills as manifested in the students' scores in physical examination and procedures stations. These results will encourage us to have clinical teaching in other disciplines at outpatient settings.

  20. Does a Rater's Professional Background Influence Communication Skills Assessment?

    Science.gov (United States)

    Artemiou, Elpida; Hecker, Kent G; Adams, Cindy L; Coe, Jason B

    2015-01-01

    There is increasing pressure in veterinary education to teach and assess communication skills, with the Objective Structured Clinical Examination (OSCE) being the most common assessment method. Previous research reveals that raters are a large source of variance in OSCEs. This study focused on examining the effect of raters' professional background as a source of variance when assessing students' communication skills. Twenty-three raters were categorized according to their professional background: clinical sciences (n=11), basic sciences (n=4), clinical communication (n=5), or hospital administrator/clinical skills technicians (n=3). Raters from each professional background were assigned to the same station and assessed the same students during two four-station OSCEs. Students were in year 2 of their pre-clinical program. Repeated-measures ANOVA results showed that OSCE scores awarded by the rater groups differed significantly: (F(matched_station_1) [2,91]=6.97, p=.002), (F(matched_station_2) [3,90]=13.95, p=.001), (F(matched_station_3) [3,90]=8.76, p=.001), and ((Fmatched_station_4) [2,91]=30.60, p=.001). A significant time effect between the two OSCEs was calculated for matched stations 1, 2, and 4, indicating improved student performances. Raters with a clinical communication skills background assigned scores that were significantly lower compared to the other rater groups. Analysis of written feedback provided by the clinical sciences raters showed that they were influenced by the students' clinical knowledge of the case and that they did not rely solely on the communication checklist items. This study shows that it is important to consider rater background both in recruitment and training programs for communication skills' assessment.

  1. Multilevel Safety Climate and Safety Performance in the Construction Industry: Development and Validation of a Top-Down Mechanism

    Directory of Open Access Journals (Sweden)

    Ran Gao

    2016-11-01

    Full Text Available The character of construction projects exposes front-line workers to dangers and accidents. Safety climate has been confirmed to be a predictor of safety performance in the construction industry. This study aims to explore the underlying mechanisms of the relationship between multilevel safety climate and safety performance. An integrated model was developed to study how particular safety climate factors of one level affect those of other levels, and then affect safety performance from the top down. A questionnaire survey was administered on six construction sites in Vietnam. A total of 1030 valid questionnaires were collected from this survey. Approximately half of the data were used to conduct exploratory factor analysis (EFA and the remaining data were submitted to structural equation modeling (SEM. Top management commitment (TMC and supervisors’ expectation (SE were identified as factors to represent organizational safety climate (OSC and supervisor safety climate (SSC, respectively, and coworkers’ caring and communication (CCC and coworkers’ role models (CRM were identified as factors to denote coworker safety climate (CSC. SEM results show that OSC factor is positively related to SSC factor and CSC factors significantly. SSC factor could partially mediate the relationship between OSC factor and CSC factors, as well as the relationship between OSC factor and safety performance. CSC factors partially mediate the relationship between OSC factor and safety performance, and the relationship between SSC factor and safety performance. The findings imply that a positive safety culture should be established both at the organizational level and the group level. Efforts from all top management, supervisors, and coworkers should be provided to improve safety performance in the construction industry.

  2. Radiology as part of an objective structured clinical examination on clinical skills

    International Nuclear Information System (INIS)

    Berk, I.A.H. van den; Ridder, J.M.M. van de; Schaik, J.P.J. van

    2011-01-01

    Introduction: An objective structured clinical examination (OSCE) assessess clinical competence in a standardised and context related manner. Compared with written tests, OSCE's are more susceptible to reliability errors because of the use of multiple cases and multiple examiners. In the pre-clinical phase of the medical curriculum of the University Medical Centre Utrecht, an OSCE is organised as a medical consult. We evaluated the radiology station. Method: Four questions were formulated: ·What is the internal consistency of the items of the radiology station? ·How do the scores on the radiology station compare with the scores on the test excluding radiology? ·How do different cases differ in scores? ·What are the differences in score between the examiners? We analysed the OSCE results of second year medical students in 2004. Results: Two hundred and sixty-five students were examined in the OSCE in 2004. Ninty-three Students were examined in the radiology station. Cronbach's alpha coefficient for the radiology station was 0.92. The average score for the radiology station was 3.8 (0.87). The average score for the test without radiology was 3.9 (0.32). The range of the average scores for the six different cases was 0.5 (3.6-4.1). The range of the average scores for the five examiners was 1.0 (3.3-4.3). Conclusion: The internal consistency of the items in the radiology station is good. The average score for the radiology station is similar to that of the other stations. The range of the scores between the different cases was relatively small. The range of the scores between the different examiners was clearly larger.

  3. Improving antibiotic prescribing skills in medical students: the effect of e-learning after 6 months.

    Science.gov (United States)

    Sikkens, Jonne J; Caris, Martine G; Schutte, Tim; Kramer, Mark H H; Tichelaar, Jelle; van Agtmael, Michiel A

    2018-05-09

    Antimicrobial prescribing behaviour is first established during medical study, but teachers often cite lack of time as an important problem in the implementation of antimicrobial stewardship in the medical curriculum. The use of electronic learning (e-learning) is a potentially time-efficient solution, but its effectiveness in changing long-term prescribing behaviour in medical students is as yet unknown. We performed a prospective controlled intervention study of the long-term effects of a short interactive e-learning course among fourth year medical students in a Dutch university. The e-learning was temporarily implemented as a non-compulsory course during a 6 week period. Six months later, all students underwent an infectious disease-based objective structured clinical examination (OSCE) aimed at simulating postgraduate prescribing. If they passed, each student did the OSCE only once. We created a control group of students from a period when the e-learning was not implemented. Main outcomes were the OSCE pass percentage and knowledge, drug choice and overall scores. We used propensity scores to create equal comparisons. We included 71 students in the intervention group and 285 students in the control group. E-learning participation in the intervention group was 81%. The OSCE pass percentage was 86% in the control group versus 97% in the intervention group (+11%, OR 5.9, 95% CI 1.7-20.0). OSCE overall, knowledge and drug choice grades (1-10) were also significantly higher in the intervention group (differences +0.31, +0.31 and +0.51, respectively). E-learning during a limited period can significantly improve medical students' performance of an antimicrobial therapeutic consultation in a situation simulating clinical practice 6 months later.

  4. Multilevel Safety Climate and Safety Performance in the Construction Industry: Development and Validation of a Top-Down Mechanism.

    Science.gov (United States)

    Gao, Ran; Chan, Albert P C; Utama, Wahyudi P; Zahoor, Hafiz

    2016-11-08

    The character of construction projects exposes front-line workers to dangers and accidents. Safety climate has been confirmed to be a predictor of safety performance in the construction industry. This study aims to explore the underlying mechanisms of the relationship between multilevel safety climate and safety performance. An integrated model was developed to study how particular safety climate factors of one level affect those of other levels, and then affect safety performance from the top down. A questionnaire survey was administered on six construction sites in Vietnam. A total of 1030 valid questionnaires were collected from this survey. Approximately half of the data were used to conduct exploratory factor analysis (EFA) and the remaining data were submitted to structural equation modeling (SEM). Top management commitment (TMC) and supervisors' expectation (SE) were identified as factors to represent organizational safety climate (OSC) and supervisor safety climate (SSC), respectively, and coworkers' caring and communication (CCC) and coworkers' role models (CRM) were identified as factors to denote coworker safety climate (CSC). SEM results show that OSC factor is positively related to SSC factor and CSC factors significantly. SSC factor could partially mediate the relationship between OSC factor and CSC factors, as well as the relationship between OSC factor and safety performance. CSC factors partially mediate the relationship between OSC factor and safety performance, and the relationship between SSC factor and safety performance. The findings imply that a positive safety culture should be established both at the organizational level and the group level. Efforts from all top management, supervisors, and coworkers should be provided to improve safety performance in the construction industry.

  5. Disruptive behavior in the workplace: Challenges for gastroenterology fellows.

    Science.gov (United States)

    Srisarajivakul, Nalinee; Lucero, Catherine; Wang, Xiao-Jing; Poles, Michael; Gillespie, Colleen; Zabar, Sondra; Weinshel, Elizabeth; Malter, Lisa

    2017-05-14

    To assess first-year gastroenterology fellows' ability to address difficult interpersonal situations in the workplace using objective structured clinical examinations (OSCE). Two OSCEs ("distracted care team" and "frazzled intern") were created to assess response to disruptive behavior. In case 1, a fellow used a colonoscopy simulator while interacting with a standardized patient (SP), nurse, and attending physician all played by actors. The nurse and attending were instructed to display specific disruptive behavior and disregard the fellow unless requested to stop the disruptive behavior and focus on the patient and procedure. In case 2, the fellow was to calm an intern managing a patient with massive gastrointestinal bleeding. The objective in both scenarios was to assess the fellows' ability to perform their duties while managing the disruptive behavior displayed by the actor. The SPs used checklists to rate fellows' performances. The fellows completed a self-assessment survey. Twelve fellows from four gastrointestinal fellowship training programs participated in the OSCE. In the "distracted care team" case, one-third of the fellows interrupted the conflict and refocused attention to the patient. Half of the fellows were able to display professionalism despite the heated discussion nearby. Fellows scored lowest in the interprofessionalism portion of post-OSCE surveys, measuring their ability to handle the conflict. In the "frazzled intern" case, 68% of fellows were able to establish a calm and professional relationship with the SP. Despite this success, only half of the fellows were successfully communicate a plan to the SP and only a third scored "well done" in a domain that focused on allowing the intern to think through the case with the fellow's guidance. Fellows must receive training on how to approach disruptive behavior. OSCEs are a tool that can assess fellow skills and set a culture for open discussion.

  6. Cloning and characterization of oxidosqualene cyclases from Kalanchoe daigremontiana: enzymes catalyzing up to 10 rearrangement steps yielding friedelin and other triterpenoids.

    Science.gov (United States)

    Wang, Zhonghua; Yeats, Trevor; Han, Hong; Jetter, Reinhard

    2010-09-24

    The first committed step in triterpenoid biosynthesis is the cyclization of oxidosqualene to polycyclic alcohols or ketones C(30)H(50)O. It is catalyzed by single oxidosqualene cyclase (OSC) enzymes that can carry out varying numbers of carbocation rearrangements and, thus, generate triterpenoids with diverse carbon skeletons. OSCs from diverse plant species have been cloned and characterized, the large majority of them catalyzing relatively few rearrangement steps. It was recently predicted that special OSCs must exist that can form friedelin, the pentacyclic triterpenoid whose formation involves the maximum possible number of rearrangement steps. The goal of the present study, therefore, was to clone a friedelin synthase from Kalanchoe daigremontiana, a plant species known to accumulate this triterpenoid in its leaf surface waxes. Five OSC cDNAs were isolated, encoding proteins with 761-779 amino acids and sharing between 57.4 and 94.3% nucleotide sequence identity. Heterologous expression in yeast and GC-MS analyses showed that one of the OSCs generated the steroid cycloartenol together with minor side products, whereas the other four enzymes produced mixtures of pentacyclic triterpenoids dominated by lupeol (93%), taraxerol (60%), glutinol (66%), and friedelin (71%), respectively. The cycloartenol synthase was found expressed in all leaf tissues, whereas the lupeol, taraxerol, glutinol, and friedelin synthases were expressed only in the epidermis layers lining the upper and lower surfaces of the leaf blade. It is concluded that the function of these enzymes is to form respective triterpenoid aglycones destined to coat the leaf exterior, probably as defense compounds against pathogens or herbivores.

  7. Cloning and Characterization of Oxidosqualene Cyclases from Kalanchoe daigremontiana

    Science.gov (United States)

    Wang, Zhonghua; Yeats, Trevor; Han, Hong; Jetter, Reinhard

    2010-01-01

    The first committed step in triterpenoid biosynthesis is the cyclization of oxidosqualene to polycyclic alcohols or ketones C30H50O. It is catalyzed by single oxidosqualene cyclase (OSC) enzymes that can carry out varying numbers of carbocation rearrangements and, thus, generate triterpenoids with diverse carbon skeletons. OSCs from diverse plant species have been cloned and characterized, the large majority of them catalyzing relatively few rearrangement steps. It was recently predicted that special OSCs must exist that can form friedelin, the pentacyclic triterpenoid whose formation involves the maximum possible number of rearrangement steps. The goal of the present study, therefore, was to clone a friedelin synthase from Kalanchoe daigremontiana, a plant species known to accumulate this triterpenoid in its leaf surface waxes. Five OSC cDNAs were isolated, encoding proteins with 761–779 amino acids and sharing between 57.4 and 94.3% nucleotide sequence identity. Heterologous expression in yeast and GC-MS analyses showed that one of the OSCs generated the steroid cycloartenol together with minor side products, whereas the other four enzymes produced mixtures of pentacyclic triterpenoids dominated by lupeol (93%), taraxerol (60%), glutinol (66%), and friedelin (71%), respectively. The cycloartenol synthase was found expressed in all leaf tissues, whereas the lupeol, taraxerol, glutinol, and friedelin synthases were expressed only in the epidermis layers lining the upper and lower surfaces of the leaf blade. It is concluded that the function of these enzymes is to form respective triterpenoid aglycones destined to coat the leaf exterior, probably as defense compounds against pathogens or herbivores. PMID:20610397

  8. Open standing castration in Thoroughbred racehorses in Hong Kong: Prevalence and severity of complications 30 days post-castration.

    Science.gov (United States)

    Rosanowski, S M; MacEoin, F; Graham, R J T Y; Riggs, C M

    2018-05-01

    Complications following open standing castration (OSC) in Thoroughbred racehorses are well recognised but variation in their prevalence and severity between populations is not well documented. To describe the prevalence and severity of complications in the 30 days following OSC. A retrospective cohort study of veterinary clinical records relating to horses that underwent OSC between July 2007 and July 2012. Complications were graded on a severity score from N, no complications, to C3, severe complications. Additional data were accessed for each horse including age, import date, racing history, trainer and veterinarian performing the castration. Bacterial culture and antimicrobial sensitivities were performed on a limited number of castration wounds that became infected. In total, 250 horses were castrated in Hong Kong using the OSC technique over the period of the study. Sixty percent (150/250) of horses experienced some type of post-castration complication, with eight horses experiencing a severe (C3) complication requiring intensive veterinary treatment. Scrotal swelling, funiculitis and seroma formation were present in 70.0%, 36.7% and 24.7% of cases respectively. Most horses experiencing complications required wound reopening (87.3%; 131/150), and/or an extended course of first-line antimicrobials and/or nonsteroidal anti-inflammatory drugs (75/150; 50.0%). Eight horses had cultures submitted for bacterial sensitivity, with 17 bacterial isolates grown. In vitro, the bacteria cultured were sensitive to enrofloxacin (76%; 13/17) and ceftiofur (100%; 17/17). Resistance was detected to penicillin, gentamicin, oxytetracycline, metronidazole and trimethoprim-sulfadiazine. Differences in post-castration management cannot be accounted for in this study. Complications following OSC in horses in Hong Kong were common. The majority were mild and were successfully treated using antimicrobials and simple wound management. Given the high rate of complications and

  9. High-throughput differentiation of heparin from other glycosaminoglycans by pyrolysis mass spectrometry.

    Science.gov (United States)

    Nemes, Peter; Hoover, William J; Keire, David A

    2013-08-06

    Sensors with high chemical specificity and enhanced sample throughput are vital to screening food products and medical devices for chemical or biochemical contaminants that may pose a threat to public health. For example, the rapid detection of oversulfated chondroitin sulfate (OSCS) in heparin could prevent reoccurrence of heparin adulteration that caused hundreds of severe adverse events including deaths worldwide in 2007-2008. Here, rapid pyrolysis is integrated with direct analysis in real time (DART) mass spectrometry to rapidly screen major glycosaminoglycans, including heparin, chondroitin sulfate A, dermatan sulfate, and OSCS. The results demonstrate that, compared to traditional liquid chromatography-based analyses, pyrolysis mass spectrometry achieved at least 250-fold higher sample throughput and was compatible with samples volume-limited to about 300 nL. Pyrolysis yielded an abundance of fragment ions (e.g., 150 different m/z species), many of which were specific to the parent compound. Using multivariate and statistical data analysis models, these data enabled facile differentiation of the glycosaminoglycans with high throughput. After method development was completed, authentically contaminated samples obtained during the heparin crisis by the FDA were analyzed in a blinded manner for OSCS contamination. The lower limit of differentiation and detection were 0.1% (w/w) OSCS in heparin and 100 ng/μL (20 ng) OSCS in water, respectively. For quantitative purposes the linear dynamic range spanned approximately 3 orders of magnitude. Moreover, this chemical readout was successfully employed to find clues in the manufacturing history of the heparin samples that can be used for surveillance purposes. The presented technology and data analysis protocols are anticipated to be readily adaptable to other chemical and biochemical agents and volume-limited samples.

  10. Psammochthoniidae n. fam., a paedomorphic family of oribatid mites (Oribatida: Enarthronota) from sandy soil in Thailand, Brazil and the U.S.A.

    Science.gov (United States)

    Fuangarworn, Marut; Norton, Roy A

    2013-01-01

    A new genus and species of enarthronote oribatid mite, Psammochthonius kethleyi n.g., n. sp., is described and illustrated based on adult and immature specimens collected from coastal sandy soil in Thailand (Phangnga), Brazil (SAo Paulo) and the U.S.A. (Mississippi). Analysis shows that it is a member of Hypochthonioidea, but not of any named family, so the monobasic family Psammochthoniidae n. fain. is proposed. Traits that are unique among hypochthonioid mites include an adult body length under 250 microm, a functionally trichoid body form (postpedal flexing), strong lateral displacement of setae in row e, which insert on a unique form of transverse scissure, subcapitular stenarthry, leg IV vestiges and a possible precocious genital swelling in the larva, apparent absence of an anal segment, and a highly regressed leg setation. The latter two, and some other traits that were previously unknown in Hypochthonioidea, suggest that Psammochthoniidae represents the first clearly paedomorphic lineage in this diverse superfamily. Like all other known hypochthonioid mites, P. kethleyi appears to be thelytokous.

  11. Morphological changes induced by thermal treatment and gamma irradiation on the males' hind legs of Spodoptera littoralis (Noctuidae; Lepidoptera

    Directory of Open Access Journals (Sweden)

    Mai S. EL-Degwi

    2015-10-01

    Full Text Available External morphology of males' hind legs of Spodoptera littoralis subjected to thermal treatment (33 °C and 37 °C or/and irradiated with substerilizing doses of gamma radiation (75, 100 and 150 Gy were studied using scanning electron microscopy (SEM in the parental generation. Five types of sensilla have been distinguished; three types of trichoid sensilla (T1,T2 and T3, sensilla basiconica and sensilla auricillica, which are considered as olfactory chemoreceptors. Moreover, sensilla chaetica are contact chemoreceptors, whereas sensilla styloconica are thermo–hygro/gustatory mechanoreceptors. The impact of thermal treatment or/and gamma irradiation reflect a clear morphological change in S. littoralis legs'sensilla, claws, spurs and scales. Otherwise, the degree of deformity was thermal and dose dependent, as it increased with an increase of the degree of temperature and dose of irradiation applied. Substerilizing doses 75 and 100 Gy, either alone or combined with thermal treatment 33 °C, have low undesirable effects on the hind legs with successful mobility or courtship behavior. Consequently, synergistic effect of gamma radiation and thermal stress induced successful application in the integrated pest management program for controlling S. littoralis.

  12. Cloning and functional characterization of three new pheromone receptors from the diamondback moth, Plutella xylostella.

    Science.gov (United States)

    Liu, Yipeng; Liu, Yang; Jiang, Xingchuan; Wang, Guirong

    The highly specialized olfactory receptor neurons (ORNs) on the antennae of male moths can recognize blends of several pheromone components. In previous studies, a total of six candidate pheromone receptor (PR) genes were cloned and functionally characterized in the diamondback moth, Plutella xylostella. In the present work, we report on three novel candidate pheromone receptor genes: PxylOR8, PxylOR41, and PxylOR45 in the same species. Gene expression analysis revealed that PxylOR8 is specifically expressed in female adult antennae, while PxylOR41 and PxylOR45 are expressed in antennae in both sexes, but with a male bias. In situ hybridization revealed that PxylOR8, PxylOR41 and PxylOR45 are localized in long trichoid sensilla. Functional analyses on the three pheromone receptor genes were then performed using the heterologous expression system of Xenopus oocytes. PxylOR41 was tuned to two minor pheromone components Z9-14:Ac, Z9-14:OH, and their analog Z9-14:Ald. PxylOR8 and PxylOR45 did not respond to any tested pheromone components and analogs. These results may contribute to clarifying how pheromone detection works in P. xylostella. Copyright © 2018 Elsevier Ltd. All rights reserved.

  13. SNMP is a signaling component required for pheromone sensitivity in Drosophila.

    Science.gov (United States)

    Jin, Xin; Ha, Tal Soo; Smith, Dean P

    2008-08-05

    The only known volatile pheromone in Drosophila, 11-cis-vaccenyl acetate (cVA), mediates a variety of behaviors including aggregation, mate recognition, and sexual behavior. cVA is detected by a small set of olfactory neurons located in T1 trichoid sensilla on the antennae of males and females. Two components known to be required for cVA reception are the odorant receptor Or67d and the extracellular pheromone-binding protein LUSH. Using a genetic screen for cVA-insensitive mutants, we have identified a third component required for cVA reception: sensory neuron membrane protein (SNMP). SNMP is a homolog of CD36, a scavenger receptor important for lipoprotein binding and uptake of cholesterol and lipids in vertebrates. In humans, loss of CD36 is linked to a wide range of disorders including insulin resistance, dyslipidemia, and atherosclerosis, but how CD36 functions in lipid transport and signal transduction is poorly understood. We show that SNMP is required in pheromone-sensitive neurons for cVA sensitivity but is not required for sensitivity to general odorants. Using antiserum to SNMP infused directly into the sensillum lymph, we show that SNMP function is required on the dendrites of cVA-sensitive neurons; this finding is consistent with a direct role in cVA signal transduction. Therefore, pheromone perception in Drosophila should serve as an excellent model to elucidate the role of CD36 members in transmembrane signaling.

  14. Nymphal development and lerp construction of Glycaspis sp. (Hemiptera: Psylloidea) on Eucalyptus sideroxylon (Myrtaceae) in central-west New South Wales, Australia.

    Science.gov (United States)

    Sharma, Anamika; Raman, Anantanarayanan; Taylor, Gary; Fletcher, Murray

    2013-11-01

    The ability to form lerps is common in Australian Psylloidea. Various species of Glycaspis Taylor (Aphalaridae) form conical lerps on different species of Eucalyptus. Lerps, being a rich sugar source, are preferentially fed by bell miners (Aves: Meliphagidae). In this paper we report the process of lerp construction by a purported new species of Glycaspis living on Eucalyptus sideroxylon. This taxon constructs lerps with anal sugary exudates first building the ribs of the lerps and later filling the space between the polymerized ribs with horizontal tractions of the same sugary substance. Developmental events in this taxon do not follow Dyar's rule strictly. Oviposition induces a non-lethal hypersensitive response in the host leaf. Population trends assessed in 2011-2012 and 2012-2013 showed distinct variations, which have been related to environmental factors. In the 2012-2013 sampling, oviposition occurred preferentially proximally to leaf cracks (possibly induced by intense frost events); we infer that this could be a strategy of this taxon to establish an 'easier' access to moisture. Sensillar designs vary between the nymphal instars and adults. The trichoid sensilla and sensillar cavities on the antennae perform mechanosensory and olfactory functions. The mouthpart complex includes a relatively long stylet bundle. Copyright © 2013 Elsevier Ltd. All rights reserved.

  15. Tarsal taste neuron activity and proboscis extension reflex in response to sugars and amino acids in Helicoverpa armigera (Hubner).

    Science.gov (United States)

    Zhang, Yun-Feng; van Loon, Joop J A; Wang, Chen-Zhu

    2010-08-15

    In adult female Helicoverpa armigera (Hübner), the fifth tarsomere of the prothoracic legs bears 14 gustatory trichoid chemosensilla. These chemosensilla were characterized through electrophysiological experiments by stimulating with sucrose, glucose, fructose, maltose, myo-inositol and 20 common amino acids. In electrophysiological recordings from nine sensilla, responses were obtained to certain compounds tested at 100 mmol l(-1), and the response spectra differed from broad to narrow. The four sugars excited the same receptor neuron in sensillum a and sensillum b; sucrose and myo-inositol, sucrose and lysine, myo-inositol and lysine excited two different receptor neurons respectively in sensillum a; fructose and lysine excited two different receptor neurons in sensillum n. Furthermore, the four sugars, myo-inositol and lysine all elicited concentration-dependent electrophysiological responses. These six compounds also induced the proboscis extension reflex (PER) followed by ingestion of the solution when they were applied on the tarsi. Lysine and sucrose caused the strongest electrophysiological responses. However, sucrose had the strongest stimulatory effect on the PER whereas lysine had the weakest. Mixtures of sucrose with the other sugars or with lysine had a similar stimulatory effect on the PER as sucrose alone. The electrophysiological and behavioural responses caused by a range of sucrose concentrations were positively correlated. We conclude that the tarsal gustatory sensilla play an essential role in perceiving sugars available in floral nectar and provide chemosensory information determining feeding behaviour. Tarsal taste-receptor-neuron responses to lysine are implicated in oviposition behaviour.

  16. Fine structure and distribution pattern of antennal sensilla of Lutzomyia longipalpis (Diptera: Psychodidae) sand flies.

    Science.gov (United States)

    Fernandes, Fernando de Freitas; Bahia-Nascimento, Ana Cristina; Pinto, Luciana Conceição; Leal, Cynthia de Sousa; Secundino, Nágila Francinete Costa; Pimenta, Paulo Filemon Paolucci

    2008-11-01

    The specific aims of this work were to examine the antennal sensilla of Lutzomyia longipalpis (Lutz & Neiva 1912) (Diptera: Psychodidae) adults and to characterize their typology and topography, with special attention to olfactory sensilla. The surfaces of the antennal segments of Lu. longipalpis males and females were studied by scanning electron microscopy (SEM). Lu. longipalpis used in the current study were obtained from a colony originating from Lapinha Cave, Minas Gerais state, Brazil. Microtrichiae and 11 subtypes of sensilla were observed and characterized according to the following categories: five subtypes of trichoid sensilla (short, medium, long blunt-tipped, long pointed-tipped, and apical), two coeloconic sensilla (grooved and praying hands), and campaniform, chaetic, basiconic, and squamiform sensilla. SEM analyses showed few differences between males and females in the typology, topography, and quantity of antennal sensilla described. The current study is the first to identify several categories of antennal sensilla of the genus Lutzomyia and their distribution patterns. The identification of these sensillar types may be important in planning future electrophysiological studies to develop alternative measures of control and monitoring of Lu. longipalpis.

  17. Functional Characteristics, Electrophysiological and Antennal Immunolocalization of General Odorant-Binding Protein 2 in Tea Geometrid, Ectropis obliqua

    Directory of Open Access Journals (Sweden)

    Ya-Li Zhang

    2018-03-01

    Full Text Available As one of the main lepidopteran pests in Chinese tea plantations, Ectropis obliqua Warren (tea geometrids can severely decrease yields of tea products. The olfactory system of the adult tea geometrid plays a significant role in seeking behaviors, influencing their search for food, mating partners, and even spawning grounds. In this study, a general odorant-binding protein (OBP gene, EoblGOBP2, was identified in the antennae of E. obliqua using reverse transcription quantification PCR (RT-qPCR. Results showed that EoblGOBP2 was more highly expressed in the antennae of males than in females relative to other tissues. The recombinant EoblGOBP2 protein was prepared in Escherichia coli and then purified through affinity chromatography. Ligand-binding assays showed that EoblGOBP2 had a strong binding affinity for some carbonyl-containing tea leaf volatiles (e.g., (E-2-hexenal, methyl salicylate, and acetophenone. Electrophysiological tests confirmed that the male moths were more sensitive to these candidate tea plant volatiles than the female moths. Immunolocalization results indicated that EoblGOBP2 was regionally confined to the sensilla trichoid type-II in the male antennae. These results indicate that EoblGOBP2 may be primarily involved in the olfactory activity of male E. obliqua moths, influencing their ability to sense tea leaf volatiles. This study provides a new perspective of insect GOBPs and implies that olfactory function can be used to prevent and control the tea geometrid.

  18. Civic engagement among orphans and non-orphans in five low- and middle-income countries.

    Science.gov (United States)

    Gray, Christine L; Pence, Brian W; Messer, Lynne C; Ostermann, Jan; Whetten, Rachel A; Thielman, Nathan M; O'Donnell, Karen; Whetten, Kathryn

    2016-10-11

    Communities and nations seeking to foster social responsibility in their youth are interested in understanding factors that predict and promote youth involvement in public activities. Orphans and separated children (OSC) are a vulnerable population whose numbers are increasing, particularly in resource-poor settings. Understanding whether and how OSC are engaged in civic activities is important for community and world leaders who need to provide care for OSC and ensure their involvement in sustainable development. The Positive Outcomes for Orphans study (POFO) is a multi-country, longitudinal cohort study of OSC randomly sampled from institution-based care and from family-based care, and of non-OSC sampled from the same study regions. Participants represent six sites in five low-and middle-income countries. We examined civic engagement activities and government trust among subjects > =16 years old at 90-month follow-up (approximately 7.5 years after baseline). We calculated prevalences and estimated the association between key demographic variables and prevalence of regular volunteer work using multivariable Poisson regression, with sampling weights to accounting for the complex sampling design. Among the 1,281 POFO participants > =16 who were assessed at 90-month follow-up, 45 % participated in regular community service or volunteer work; two-thirds of those volunteers did so on a strictly voluntary basis. While government trust was fairly high, at approximately 70 % for each level of government, participation in voting was only 15 % among those who were > =18 years old. We did not observe significant associations between demographic characteristics and regular volunteer work, with the exception of large variation by study site. As the world's leaders grapple with the many competing demands of global health, economic security, and governmental stability, the participation of today's youth in community and governance is essential for

  19. Validating relationships among attachment, emotional intelligence and clinical communication.

    Science.gov (United States)

    Cherry, M Gemma; Fletcher, Ian; O'Sullivan, Helen

    2014-10-01

    In a previous study, we found that emotional intelligence (EI) mediates the negative influences of Year 1 medical students' attachment styles on their provider-patient communication (PPC). However, in that study, students were examined on a relatively straightforward PPC skill set and were not assessed on their abilities to elicit relevant clinical information from standardised patients. The influence of these psychological variables in more demanding and realistic clinical scenarios warrants investigation. This study aimed to validate previous research findings by exploring the mediating effect of EI on the relationship between medical students' attachment styles and their PPC across an ecologically valid PPC objective structured clinical examination (OSCE). Year 2 medical students completed measures of attachment (the Experiences in Close Relationships-Short Form [ECR-SF], a 12-item measure which provides attachment avoidance and attachment anxiety dimensional scores) and EI (the Mayer-Salovey-Caruso Emotional Intelligence Test [MSCEIT], a 141-item measure on the perception, use, understanding and management of emotions), prior to their summative PPC OSCE. Provider-patient communication was assessed using OSCE scores. Structural equation modelling (SEM) was used to validate our earlier model of the relationships between attachment style, EI and PPC. A total of 296 of 382 (77.5%) students participated. Attachment avoidance was significantly negatively correlated with total EI scores (r = -0.23, p < 0.01); total EI was significantly positively correlated with OSCE scores (r = 0.32, p < 0.01). Parsimonious SEM confirmed that EI mediated the negative influence of attachment avoidance on OSCE scores. It significantly predicted 14% of the variance in OSCE scores, twice as much as the 7% observed in the previous study. In more demanding and realistic clinical scenarios, EI makes a greater contribution towards effective PPC. Attachment is perceived to be stable

  20. Identification of heparin samples that contain impurities or contaminants by chemometric pattern recognition analysis of proton NMR spectral data

    Energy Technology Data Exchange (ETDEWEB)

    Zang, Qingda [University of Medicine and Dentistry of New Jersey, Department of Pharmacology, Robert Wood Johnson Medical School, Piscataway, NJ (United States); Snowdon, Inc., Monmouth Junction, NJ (United States); University of Medicine and Dentistry of New Jersey, Department of Health Informatics, School of Health Related Professions, Newark, NJ (United States); Keire, David A.; Buhse, Lucinda F.; Trehy, Michael L. [Food and Drug Administration, CDER, Division of Pharmaceutical Analysis, St. Louis, MO (United States); Wood, Richard D. [Snowdon, Inc., Monmouth Junction, NJ (United States); Mital, Dinesh P.; Haque, Syed; Srinivasan, Shankar [University of Medicine and Dentistry of New Jersey, Department of Health Informatics, School of Health Related Professions, Newark, NJ (United States); Moore, Christine M.V.; Nasr, Moheb; Al-Hakim, Ali [Food and Drug Administration, CDER, Office of New Drug Quality Assessment, Silver Spring, MD (United States); Welsh, William J. [University of Medicine and Dentistry of New Jersey, Department of Pharmacology, Robert Wood Johnson Medical School, Piscataway, NJ (United States)

    2011-08-15

    Chemometric analysis of a set of one-dimensional (1D) {sup 1}H nuclear magnetic resonance (NMR) spectral data for heparin sodium active pharmaceutical ingredient (API) samples was employed to distinguish USP-grade heparin samples from those containing oversulfated chondroitin sulfate (OSCS) contaminant and/or unacceptable levels of dermatan sulfate (DS) impurity. Three chemometric pattern recognition approaches were implemented: classification and regression tree (CART), artificial neural network (ANN), and support vector machine (SVM). Heparin sodium samples from various manufacturers were analyzed in 2008 and 2009 by 1D {sup 1}H NMR, strong anion-exchange high-performance liquid chromatography, and percent galactosamine in total hexosamine tests. Based on these data, the samples were divided into three groups: Heparin, DS {<=} 1.0% and OSCS = 0%; DS, DS > 1.0% and OSCS = 0%; and OSCS, OSCS > 0% with any content of DS. Three data sets corresponding to different chemical shift regions (1.95-2.20, 3.10-5.70, and 1.95-5.70 ppm) were evaluated. While all three chemometric approaches were able to effectively model the data in the 1.95-2.20 ppm region, SVM was found to substantially outperform CART and ANN for data in the 3.10-5.70 ppm region in terms of classification success rate. A 100% prediction rate was frequently achieved for discrimination between heparin and OSCS samples. The majority of classification errors between heparin and DS involved cases where the DS content was close to the 1.0% DS borderline between the two classes. When these borderline samples were removed, nearly perfect classification results were attained. Satisfactory results were achieved when the resulting models were challenged by test samples containing blends of heparin APIs spiked with non-, partially, or fully oversulfated chondroitin sulfate A, heparan sulfate, or DS at the 1.0%, 5.0%, and 10.0% (w/w) levels. This study demonstrated that the combination of 1D {sup 1}H NMR spectroscopy

  1. Quantum transport in the FMO photosynthetic light-harvesting complex.

    Science.gov (United States)

    Karafyllidis, Ioannis G

    2017-06-01

    The very high light-harvesting efficiency of natural photosynthetic systems in conjunction with recent experiments, which showed quantum-coherent energy transfer in photosynthetic complexes, raised questions regarding the presence of non-trivial quantum effects in photosynthesis. Grover quantum search, quantum walks, and entanglement have been investigated as possible effects that lead to this efficiency. Here we explain the near-unit photosynthetic efficiency without invoking non-trivial quantum effects. Instead, we use non-equilibrium Green's functions, a mesoscopic method used to study transport in nano-conductors to compute the transmission function of the Fenna-Matthews-Olson (FMO) complex using an experimentally derived exciton Hamiltonian. The chlorosome antenna and the reaction center play the role of input and output contacts, connected to the FMO complex. We show that there are two channels for which the transmission is almost unity. Our analysis also revealed a dephasing-driven regulation mechanism that maintains the efficiency in the presence of varying dephasing potentials.

  2. Dynamic coherence in excitonic molecular complexes under various excitation conditions

    Energy Technology Data Exchange (ETDEWEB)

    Chenu, Aurélia; Malý, Pavel; Mančal, Tomáš, E-mail: mancal@karlov.mff.cuni.cz

    2014-08-17

    Highlights: • Dynamic coherence does not improve energy transfer efficiency in natural conditions. • Photo-induced quantum jumps are discussed in classical context. • Natural time scale of a light excitation event is identified. • Coherence in FMO complex averages out under excitation by neighboring antenna. • This result is valid even in absence of dissipation. - Abstract: We investigate the relevance of dynamic quantum coherence in the energy transfer efficiency of molecular aggregates. We derive the time evolution of the density matrix for an open quantum system excited by light or by a neighboring antenna. Unlike in the classical case, the quantum description does not allow for a formal decomposition of the dynamics into sudden jumps in an observable quantity – an expectation value. Rather, there is a natural finite time-scale associated with the excitation process. We propose a simple experiment to test the influence of this time scale on the yield of photosynthesis. We demonstrate, using typical parameters of the Fenna–Matthews–Olson (FMO) complex and a typical energy transfer rate from the chlorosome baseplate, that dynamic coherences are averaged out in the complex even when the FMO model is completely free of all dissipation and dephasing.

  3. Pigment organization in the photosynthetic apparatus of Roseiflexus castenholzii.

    Science.gov (United States)

    Collins, Aaron M; Xin, Yueyong; Blankenship, Robert E

    2009-08-01

    The light-harvesting-reaction center (LHRC) complex from the chlorosome-lacking filamentous anoxygenic phototroph (FAP), Roseiflexus castenholzii (R. castenholzii) was purified and characterized for overall pigment organization. The LHRC is a single complex that is comprised of light harvesting (LH) and reaction center (RC) polypeptides as well as an attached c-type cytochrome. The dominant carotenoid found in the LHRC is keto-gamma-carotene, which transfers excitation to the long wavelength antenna band with 35% efficiency. Linear dichroism and fluorescence polarization measurements indicate that the long wavelength antenna pigments absorbing around 880 nm are perpendicular to the membrane plane, with the corresponding Q(y) transition dipoles in the plane of the membrane. The antenna pigments absorbing around 800 nm, as well as the bound carotenoid, are oriented at a large angle with respect to the membrane. The antenna pigments spectroscopically resemble the well-studied LH2 complex from purple bacteria, however the close association with the RC makes the light harvesting component of this complex functionally more like LH1.

  4. A nanoscale bio-inspired light-harvesting system developed from self-assembled alkyl-functionalized metallochlorin nano-aggregates

    KAUST Repository

    Ocakoǧlu, Kasim; Joya, Khurram Saleem; Harputlu, Ersan; Tarnowska, Anna; Gryko, Daniel T.

    2014-01-01

    Self-assembled supramolecular organization of nano-structured biomimetic light-harvesting modules inside solid-state nano-templates can be exploited to develop excellent light-harvesting materials for artificial photosynthetic devices. We present here a hybrid light-harvesting system mimicking the chlorosomal structures of the natural photosynthetic system using synthetic zinc chlorin units (ZnChl-C6, ZnChl-C12 and ZnChl-C 18) that are self-aggregated inside the anodic aluminum oxide (AAO) nano-channel membranes. AAO nano-templates were modified with a TiO2 matrix and functionalized with long hydrophobic chains to facilitate the formation of supramolecular Zn-chlorin aggregates. The transparent Zn-chlorin nano-aggregates inside the alkyl-TiO2 modified AAO nano-channels have a diameter of ∼120 nm in a 60 μm length channel. UV-Vis studies and fluorescence emission spectra further confirm the formation of the supramolecular ZnChl aggregates from monomer molecules inside the alkyl-functionalized nano-channels. Our results prove that the novel and unique method can be used to produce efficient and stable light-harvesting assemblies for effective solar energy capture through transparent and stable nano-channel ceramic materials modified with bio-mimetic molecular self-assembled nano-aggregates. © 2014 the Partner Organisations.

  5. Identifying the quantum correlations in light-harvesting complexes

    International Nuclear Information System (INIS)

    Bradler, Kamil; Wilde, Mark M.; Vinjanampathy, Sai; Uskov, Dmitry B.

    2010-01-01

    One of the major efforts in the quantum biological program is to subject biological systems to standard tests or measures of quantumness. These tests and measures should elucidate whether nontrivial quantum effects may be present in biological systems. Two such measures of quantum correlations are the quantum discord and the relative entropy of entanglement. Here, we show that the relative entropy of entanglement admits a simple analytic form when dynamics and accessible degrees of freedom are restricted to a zero- and single-excitation subspace. We also simulate and calculate the amount of quantum discord that is present in the Fenna-Matthews-Olson protein complex during the transfer of an excitation from a chlorosome antenna to a reaction center. We find that the single-excitation quantum discord and single-excitation relative entropy of entanglement are equal for all of our numerical simulations, but a proof of their general equality for this setting evades us for now. Also, some of our simulations demonstrate that the relative entropy of entanglement without the single-excitation restriction is much lower than the quantum discord. The first picosecond of dynamics is the relevant time scale for the transfer of the excitation, according to some sources in the literature. Our simulation results indicate that quantum correlations contribute a significant fraction of the total correlation during this first picosecond in many cases, at both cryogenic and physiological temperatures.

  6. Using peer-assisted learning to teach and evaluate residents’ musculoskeletal skills

    Directory of Open Access Journals (Sweden)

    Johanna Martinez

    2015-05-01

    Full Text Available Although direct observation and corrective feedback are established methods of increasing select aspects of residents’ musculoskeletal (MSK clinical skills, the evaluation and management of patients with MSK complaints remains an underemphasized part of internal medicine training. This paper reports on the development of an innovative peer-assisted learning (PAL model to teach five MSK areas (back, knee, shoulder, neck, or hip pain. Based on data from 42 participating interns and 44 senior residents from an urban US academic medical center, results from an objective structured clinical exam (OSCE demonstrate gains in both knowledge and self-reported confidence in MSK skills. Moreover, subsequent focus group results reveal a strong preference for the PAL model. In conclusion, an educational module that utilizes the OSCE format holds much promise for teaching MSK skills to both intern and senior residents.

  7. Emotional symptoms among adolescents

    DEFF Research Database (Denmark)

    Meilstrup, Charlotte; Ersbøll, Annette K; Nielsen, Line

    2015-01-01

    level. RESULTS: Schoolchildren from low (odds ratio (OR) 1.70, 95% CI: 1.33-2.17) and medium (OR 1.50, 95% CI: 1.22-1.85) occupational social class (OSC), girls (OR 1.32, 95% CI: 1.13-1.56) and schoolchildren exposed to bullying (OR 3.82, 95% CI: 2.71-5.40), had increased odds for emotional symptoms....... A negative classroom climate was associated with emotional symptoms (OR 1.29, 95% CI: 0.99-1.69) and so was being part of classrooms with a high prevalence of bullying (OR 1.28, 95% CI: 1.0-1.60). CONCLUSION: Female sex, low OSC, single parent family, exposure to bullying and a high prevalence of bullying...

  8. An improbable partnership: Spanish and Kazakh efforts to bring Central Asia to the fore of European politics

    Directory of Open Access Journals (Sweden)

    Licinia Simao

    2010-05-01

    Full Text Available El artículo discute sobre el potencial de la actual Presidencia española del Consejo de la UE y la Presidencia kazaja de la OSCE para coordinar esfuerzos en convertir a Asia Central en un área de interés más prominente para la política europea. Aporta un análisis de los intereses y de las principales áreas de interacción de las dos organizaciones en Asia Central y propone una reflexión sobre el impacto que tan improbable asociación podría tener en cambiar las perspectivas mutuas y en desarrollar una visión a largo plazo para la UE y la OSCE en Asia Central.

  9. Roll-coating fabrication of ITO-free flexible solar cells based on a non-fullerene small molecule acceptor

    DEFF Research Database (Denmark)

    Liu, Wenqing; Shi, Hangqi; Andersen, Thomas Rieks

    2015-01-01

    We report organic solar cells (OSCs) with non-fullerene small molecule acceptors (SMAs) prepared in large area via a roll coating process. We employ all solution-processed indium tin oxide (ITO)-free flexible substrates for inverted solar cells with a new SMA of F(DPP)(2)B-2. By utilizing poly(3......-hexylthiophene) as donor blended with F(DPP)(2)B-2 as acceptor, ITO-free large-area flexible SMA based OSCs were produced under ambient conditions with the use of slot-die coating and flexographic printing methods on a lab-scale compact roll-coater that is readily transferrable to roll-to-roll processing...

  10. The role and place of international organizations in the settlement of armed conflicts in the southeast of Ukraine (legal aspects

    Directory of Open Access Journals (Sweden)

    Ігор Володимирович Євтушенко

    2016-01-01

    Full Text Available Problem setting. Armed conflict in the Donetsk and Lugansk regions led to significant losses as personnel of military units and special law enforcement agencies of Ukraine and civilian casualties Ukraine. Under these conditions, according to most politicians and political scientists to modern standards of international law crisis management in Ukraine is possible only through the mediation of international organizations. International organizations have a tool for early detection, warning and conflict prevention and crisis management and post-conflict rehabilitation, they are engaged in a wide range of security issues, including arms control, preventive diplomacy, confidence-building measures, human rights, monitoring elections, economic and environmental security and so on. Recent research and publications analysis. In the literature of recent years certain issues affecting the regulatory and legal framework of international organizations in the field of security. However, scientific research towards the place and role of international organizations in resolving the internal armed conflict in research paid insufficient attention. Paper objective. The article is to examine the nature of international security organizations, evaluating the effectiveness of their work to resolve the situation in the Donetsk and Lugansk regions and providing relevant proposals. Paper main body. The primary place in the order of settlement of the armed conflict in the South East Ukraine has a key intergovernmental international organizations dealing with peace and security in the world – the United Nations (UN and the Organization for Security and Cooperation in Europe (OSCE. The new National Security Strategy of Ukraine of 05.06.2015 p. Indicated that the aggression of Russia against Ukraine increased the urgency of reforming the Security Council. As part of the UN General Assembly will focus the government of Ukraine will support such initiatives to reform the

  11. THE EFFECT OF COMMUNICATION SKILLS TEACHING IN FINAL-YEAR MEDICAL STUDENTS

    Directory of Open Access Journals (Sweden)

    Chit Soe

    2016-12-01

    In the communication skills station, 290 out of 363 (79.9% passed. For OSLAR, the pass rate was 288 out of 363 (79.3%, and for OSCE it was 279 out of 363 (76.9%. There was a significant association between passing communication skills and OSLAR (χ 2 = 10.2, p = .001. Especially, there was correlation between the history taking part of OSLAR scores and CS scores (r = .257, p = 0.000. To test whether it was because of the phenomenon that good students will pass whatever station it is and poor students will fail, association between communication skills score and OSCE (the station where the students do not need to speak and are tested for manual skills only was analyzed. There was no association between those two skill stations.

  12. Over-Sampling Codebook-Based Hybrid Minimum Sum-Mean-Square-Error Precoding for Millimeter-Wave 3D-MIMO

    KAUST Repository

    Mao, Jiening; Gao, Zhen; Wu, Yongpeng; Alouini, Mohamed-Slim

    2018-01-01

    Hybrid precoding design is challenging for millimeter-wave (mmWave) massive MIMO. Most prior hybrid precoding schemes are designed to maximize the sum spectral efficiency (SSE), while seldom investigate the bit-error-rate (BER). Therefore, this letter designs an over-sampling codebook (OSC)-based hybrid minimum sum-mean-square-error (min-SMSE) precoding to optimize the BER. Specifically, given the effective baseband channel consisting of the real channel and analog precoding, we first design the digital precoder/combiner based on min-SMSE criterion to optimize the BER. To further reduce the SMSE between the transmit and receive signals, we propose an OSC-based joint analog precoder/combiner (JAPC) design. Simulation results show that the proposed scheme can achieve the better performance than its conventional counterparts.

  13. Teaching Effectiveness: Preparing Occupational Therapy Students for Clinical Practice

    Directory of Open Access Journals (Sweden)

    Jane C. OBrien PhD, MS.MEdL, OTR/L

    2013-06-01

    Full Text Available Medical educators must examine the ability of teaching methodologies to prepare students for clinical practice. Two types of assessment methods commonly used in medical education include the Short Objective Structured Clinical Examination (OSCE and the Integrated Performance Procedural Instrument (IPPI. The use of these methods in occupational therapy (OT education is less understood. With the increasing number of students enrolled in programs, faculty face challenges to examine how clinical competence is established using data to determine teaching effectiveness. This study examines two educational methodologies used in OT curriculum: the long written case study (IPPI and short performance-based OSCE. The authors describe the effectiveness of each examination as it relates to student performance in clinical practice (as measured by the Fieldwork Performance Evaluation [FWPE]. The findings obtained from separate focus group sessions with faculty and students further provide insight into the advantages and disadvantages of the educational methodologies.

  14. Influence of High Pressure and High Temperature Hydrogen on Fracture Toughness of Ni-Containing Steels and Alloys

    Directory of Open Access Journals (Sweden)

    Balitskii Alexander

    2014-03-01

    Full Text Available W ramach przeprowadzonych badan okreslono wpływ wodoru na krótkotrwała wytrzymałosc i płasko-naprezeniowa ciagliwosc stali 10Cr15Ni27 oraz stopów niklu 04Cr16Ni56, 05Cr19Ni55 przy wielkosciach cisnienia do 35 MPa i zakresie temperatury od 293 do 773 K. Wpływ wodoru wysokiego cisnienia powoduje, ze wydłuzenie, plastycznosc, wytrzymałosc nisko cyklowa N i parametr odpornosci na pekanie Kc przyjmuja minimalne wartosci dla próbek stopu 04Cr16Ni56 przy cisnieniu wynoszacym 10 MPa, natomiast dla nasyconych wodorem próbek stali 10Cr15Ni27 i stopu 05Cr19Ni55 minimum wartosci tych parametrów wystepuje przy cisnieniu 15 MPa, dla koncentracji wodoru wynoszacej odpowiednio 15 i 19 wppm.

  15. Wave-optics modeling of the optical-transport line for passive optical stochastic cooling

    Science.gov (United States)

    Andorf, M. B.; Lebedev, V. A.; Piot, P.; Ruan, J.

    2018-03-01

    Optical stochastic cooling (OSC) is expected to enable fast cooling of dense particle beams. Transition from microwave to optical frequencies enables an achievement of stochastic cooling rates which are orders of magnitude higher than ones achievable with the classical microwave based stochastic cooling systems. A subsystemcritical to the OSC scheme is the focusing optics used to image radiation from the upstream "pickup" undulator to the downstream "kicker" undulator. In this paper, we present simulation results using wave-optics calculation carried out with the SYNCHROTRON RADIATION WORKSHOP (SRW). Our simulations are performed in support to a proof-of-principle experiment planned at the Integrable Optics Test Accelerator (IOTA) at Fermilab. The calculations provide an estimate of the energy kick received by a 100-MeV electron as it propagates in the kicker undulator and interacts with the electromagnetic pulse it radiated at an earlier time while traveling through the pickup undulator.

  16. Understanding Energy Loss in Organic Solar Cells: Toward a New Efficiency Regime

    KAUST Repository

    Menke, S. Matthew; Ran, Niva A.; Bazan, Guillermo C.; Friend, Richard H.

    2017-01-01

    Reducing energy and voltage loss is an imperative area of improvement for the design of organic solar cells (OSCs). Both in the context of charge generation and charge recombination, significant amounts of energy are lost even in state-of-the-art OSCs compared with their inorganic counterparts. Through a set of recent examples, however, we show that (1) charge generation can proceed with high quantum efficiency even in the absence of an offset energy at the donor-acceptor interface and (2) non-radiative charge recombination may be mitigated by considering systems with distinct properties of the interfacial charge-transfer state. To capitalize on these recent advances in understanding, we provide three actionable paths forward that aim to better identify, process, and characterize low energy loss systems: incorporating consistent and accurate measurements for energy levels, moving away from photoluminescence quenching, and exploring blends with reduced miscibility.

  17. Efficient optical absorption enhancement in organic solar cells by using a 2-dimensional periodic light trapping structure

    Energy Technology Data Exchange (ETDEWEB)

    Zu, Feng-Shuo [Jiangsu Key Laboratory for Carbon-Based Functional Materials and Devices, Institute of Functional Nano and Soft Materials (FUNSOM), Collaborative Innovation Center of Suzhou Nano Science and Technology, Soochow University, Suzhou, Jiangsu 215123 (China); Center of Super-Diamond and Advanced Films (COSDAF) and Department of Physics and Materials Science, City University of Hong Kong, Hong Kong SAR (China); Shi, Xiao-Bo; Liang, Jian; Xu, Mei-Feng; Wang, Zhao-Kui, E-mail: lsliao@suda.edu.cn, E-mail: zkwang@suda.edu.cn, E-mail: apcslee@cityu.edu.hk; Liao, Liang-Sheng, E-mail: lsliao@suda.edu.cn, E-mail: zkwang@suda.edu.cn, E-mail: apcslee@cityu.edu.hk [Jiangsu Key Laboratory for Carbon-Based Functional Materials and Devices, Institute of Functional Nano and Soft Materials (FUNSOM), Collaborative Innovation Center of Suzhou Nano Science and Technology, Soochow University, Suzhou, Jiangsu 215123 (China); Lee, Chun-Sing, E-mail: lsliao@suda.edu.cn, E-mail: zkwang@suda.edu.cn, E-mail: apcslee@cityu.edu.hk [Center of Super-Diamond and Advanced Films (COSDAF) and Department of Physics and Materials Science, City University of Hong Kong, Hong Kong SAR (China)

    2014-06-16

    We have investigated the effects induced by periodic nanosphere arrays on the performance of organic solar cells (OSCs). Two-dimensional periodic arrays of polystyrene nanospheres were formed by using a colloidal lithography method together with plasma etching to trim down the size to various degrees on the substrates of OSCs. It is found that the devices prepared on such substrates can have improved light harvesting, resulting in as high as 35% enhancement in power conversion efficiency over that of the reference devices. The measured external quantum efficiency and finite-difference time-domain simulation reveal that the controlled periodic morphology of the substrate can efficiently increase light scattering in the device and thus enhance the absorption of incident light.

  18. Creation of a Unified Set of Core-Collapse Supernovae for Training of Photometric Classifiers

    Science.gov (United States)

    D'Arcy Kenworthy, William; Scolnic, Daniel; Kessler, Richard

    2017-01-01

    One of the key tasks for future supernova cosmology analyses is to photometrically distinguish type Ia supernovae (SNe) from their core collapse (CC) counterparts. In order to train programs for this purpose, it is necessary to train on a large number of core-collapse SNe. However, there are only a handful used for current programs. We plan to use the large amount of CC lightcurves available on the Open Supernova Catalog (OSC). Since this data is scraped from many different surveys, it is given in a number of photometric systems with different calibration and filters. We therefore created a program to fit smooth lightcurves (as a function of time) to photometric observations of arbitrary SNe. The Supercal method is then used to translate the smoothed lightcurves to a single photometric system. We can thus compile a training set of 782 supernovae, of which 127 are not type Ia. These smoothed lightcurves are also being contributed upstream to the OSC as derived data.

  19. A facile approach to a silver conductive ink with high performance for macroelectronics

    Science.gov (United States)

    Tao, Yu; Tao, Yuxiao; Wang, Biaobing; Wang, Liuyang; Tai, Yanlong

    2013-06-01

    An unusual kind of transparent and high-efficiency organic silver conductive ink (OSC ink) was synthesized with silver acetate as silver carrier, ethanolamine as additive, and different kinds of aldehyde-based materials as reduction agents and was characterized by using a thermogravimetric analyzer, X-ray diffraction, a scanning electron microscope, and a four-point probe. The results show that different reduction agents all have an important influence on the conductive properties of the ink through a series of complex chemical reactions, and especially when formic acid or dimethylformamide was used as the reduction agent and sintered at 120°C for 30 s, the resistivity can be lowered to 6 to 9 μΩ·cm. Furthermore, formula mechanism, conductive properties, temperature, and dynamic fatigue properties were investigated systematically, and the feasibility of the OSC ink was also verified through the preparation of an antenna pattern.

  20. Emerging Semitransparent Solar Cells: Materials and Device Design.

    Science.gov (United States)

    Tai, Qidong; Yan, Feng

    2017-09-01

    Semitransparent solar cells can provide not only efficient power-generation but also appealing images and show promising applications in building integrated photovoltaics, wearable electronics, photovoltaic vehicles and so forth in the future. Such devices have been successfully realized by incorporating transparent electrodes in new generation low-cost solar cells, including organic solar cells (OSCs), dye-sensitized solar cells (DSCs) and organometal halide perovskite solar cells (PSCs). In this review, the advances in the preparation of semitransparent OSCs, DSCs, and PSCs are summarized, focusing on the top transparent electrode materials and device designs, which are all crucial to the performance of these devices. Techniques for optimizing the efficiency, color and transparency of the devices are addressed in detail. Finally, a summary of the research field and an outlook into the future development in this area are provided. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Over-Sampling Codebook-Based Hybrid Minimum Sum-Mean-Square-Error Precoding for Millimeter-Wave 3D-MIMO

    KAUST Repository

    Mao, Jiening

    2018-05-23

    Abstract: Hybrid precoding design is challenging for millimeter-wave (mmWave) massive MIMO. Most prior hybrid precoding schemes are designed to maximize the sum spectral efficiency (SSE), while seldom investigate the bit-error-rate (BER). Therefore, this letter designs an over-sampling codebook (OSC)-based hybrid minimum sum-mean-square-error (min-SMSE) precoding to optimize the BER. Specifically, given the effective baseband channel consisting of the real channel and analog precoding, we first design the digital precoder/combiner based on min-SMSE criterion to optimize the BER. To further reduce the SMSE between the transmit and receive signals, we propose an OSC-based joint analog precoder/combiner (JAPC) design. Simulation results show that the proposed scheme can achieve the better performance than its conventional counterparts.

  2. The Impact of Critical Thinking on Clinical Judgment During Simulation With Senior Nursing Students.

    Science.gov (United States)

    Cazzell, Mary; Anderson, Mindi

    2016-01-01

    The study examined the impact of critical thinking (CT) on clinical judgment (CJ) during a pediatric Objective Structured Clinical Evaluation (OSCE) with 160 pre-licensure nursing students. Educators are called to transform teaching strategies to develop CJ but confusion exists over definitions. A descriptive correlational design was used to examine demographics and Tower of Hanoi (TOH) and Health Science Reasoning Test (HSRT) scores. CJ was measured by scores on the Lasater Clinical Judgment Rubric (LCJR) from videotaped OSCEs. Participants were: 86 percent female, 42 percent Caucasian, median 23 years, with 49 percent having health care experience. Students averaged seven moves over minimum on the TOH. Average scores were: HSRT 25/38 and LCJR 31/44. Statistically significant predictors of CJ were gender, ethnicity, HSRT deduction, and analysis; 11 CT variables accounted for 17 percent of LCJR scores. Educators need to utilize/develop innovative teaching strategies addressing CJ predictors.

  3. New naphtho[1,2-b:5,6-b‧]difuran based two-dimensional conjugated small molecules for photovoltaic application

    Science.gov (United States)

    Peng, Hongjian; Luan, Xiangfeng; Qiu, Lixia; Li, Hang; Liu, Ye; Zou, Yingping

    2017-10-01

    Two new A-D-A small molecules with alkoxyphenyl and alkylthiophenyl-substituted naphtho[1,2-b:5,6-b‧]difuran (NDF) as the central building block named NDFPO-DPP and NDFPS-DPP were synthesized and firstly used as donor materials in organic solar cells (OSCs). The effects of the alkoxyphenyl and alkylthiophenyl side chains on the NDF unit have been investigated. With a single atom variation from O to S, NDFPS-DPP exhibited lower HOMO energy levels than its counterpart NDFPO-DPP, which resulted in enhanced Voc. The device based on NDFPO-DPP with thermal annealing exhibited a better PCE of 3.10% due to the higher and more balanced hole and electron mobilities. The investigations show that NDF could be a promising building block in OSCs via rational molecular structure design and device optimizations.

  4. Dexamethasone and supportive care with or without whole brain radiotherapy in treating patients with non-small cell lung cancer with brain metastases unsuitable for resection or stereotactic radiotherapy (QUARTZ): results from a phase 3, non-inferiority, randomised trial.

    Science.gov (United States)

    Mulvenna, Paula; Nankivell, Matthew; Barton, Rachael; Faivre-Finn, Corinne; Wilson, Paula; McColl, Elaine; Moore, Barbara; Brisbane, Iona; Ardron, David; Holt, Tanya; Morgan, Sally; Lee, Caroline; Waite, Kathryn; Bayman, Neil; Pugh, Cheryl; Sydes, Benjamin; Stephens, Richard; Parmar, Mahesh K; Langley, Ruth E

    2016-10-22

    Whole brain radiotherapy (WBRT) and dexamethasone are widely used to treat brain metastases from non-small cell lung cancer (NSCLC), although there have been no randomised clinical trials showing that WBRT improves either quality of life or overall survival. Even after treatment with WBRT, the prognosis of this patient group is poor. We aimed to establish whether WBRT could be omitted without a significant effect on survival or quality of life. The Quality of Life after Treatment for Brain Metastases (QUARTZ) study is a non-inferiority, phase 3 randomised trial done at 69 UK and three Australian centres. NSCLC patients with brain metastases unsuitable for surgical resection or stereotactic radiotherapy were randomly assigned (1:1) to optimal supportive care (OSC) including dexamethasone plus WBRT (20 Gy in five daily fractions) or OSC alone (including dexamethasone). The dose of dexamethasone was determined by the patients' symptoms and titrated downwards if symptoms improved. Allocation to treatment group was done by a phone call from the hospital to the Medical Research Council Clinical Trials Unit at University College London using a minimisation programme with a random element and stratification by centre, Karnofsky Performance Status (KPS), gender, status of brain metastases, and the status of primary lung cancer. The primary outcome measure was quality-adjusted life-years (QALYs). QALYs were generated from overall survival and patients' weekly completion of the EQ-5D questionnaire. Treatment with OSC alone was considered non-inferior if it was no more than 7 QALY days worse than treatment with WBRT plus OSC, which required 534 patients (80% power, 5% [one-sided] significance level). Analysis was done by intention to treat for all randomly assigned patients. The trial is registered with ISRCTN, number ISRCTN3826061. Between March 2, 2007, and Aug 29, 2014, 538 patients were recruited from 69 UK and three Australian centres, and were randomly assigned to

  5. Augmented reality (AR) and virtual reality (VR) applied in dentistry.

    Science.gov (United States)

    Huang, Ta-Ko; Yang, Chi-Hsun; Hsieh, Yu-Hsin; Wang, Jen-Chyan; Hung, Chun-Cheng

    2018-04-01

    The OSCE is a reliable evaluation method to estimate the preclinical examination of dental students. The most ideal assessment for OSCE is used the augmented reality simulator to evaluate. This literature review investigated a recently developed in virtual reality (VR) and augmented reality (AR) starting of the dental history to the progress of the dental skill. As result of the lacking of technology, it needs to depend on other device increasing the success rate and decreasing the risk of the surgery. The development of tracking unit changed the surgical and educational way. Clinical surgery is based on mature education. VR and AR simultaneously affected the skill of the training lesson and navigation system. Widely, the VR and AR not only applied in the dental training lesson and surgery, but also improved all field in our life. Copyright © 2018. Published by Elsevier Taiwan.

  6. Effects of Ag Nanocubes with Different Corner Shape on the Absorption Enhancement in Organic Solar Cells

    Directory of Open Access Journals (Sweden)

    Feng Shan

    2014-01-01

    Full Text Available The effects of corner shape of silver (Ag nanocubes (NCs on optical absorptions of organic solar cells (OSCs are theoretically investigated by finite element method (FEM calculations. The absorption of sun light in the active layer is calculated. Significant absorption enhancements have been demonstrated in metallic region with different shapes of Ag NCs, among them corner radius (R is zero result in the best light absorption performance of up to 55% enhancement with respect to bare OSCs. The origins of increased absorption are believed to be the effects of the huge electric field enhancement and increased scattering upon the excitation of localized surface plasmon resonance (LSPR. Apart from using R=0, we show that R=3, 6, and 11.29 of Ag NCs in metallic region of active layer may also result in the maximum comparable absorption enhancement of 49%, 41%, and 28%, respectively. In addition, a significant effect of the period of NCs is observed.

  7. Carbon oxidation state as a metric for describing the chemistry of atmospheric organic aerosol

    Energy Technology Data Exchange (ETDEWEB)

    Massachusetts Institute of Technology; Kroll, Jesse H.; Donahue, Neil M.; Jimenez, Jose L.; Kessler, Sean H.; Canagaratna, Manjula R.; Wilson, Kevin R.; Altieri, Katye E.; Mazzoleni, Lynn R.; Wozniak, Andrew S.; Bluhm, Hendrik; Mysak, Erin R.; Smith, Jared D.; Kolb, Charles E.; Worsnop, Douglas R.

    2010-11-05

    A detailed understanding of the sources, transformations, and fates of organic species in the environment is crucial because of the central roles that organics play in human health, biogeochemical cycles, and Earth's climate. However, such an understanding is hindered by the immense chemical complexity of environmental mixtures of organics; for example, atmospheric organic aerosol consists of at least thousands of individual compounds, all of which likely evolve chemically over their atmospheric lifetimes. Here we demonstrate the utility of describing organic aerosol (and other complex organic mixtures) in terms of average carbon oxidation state (OSC), a quantity that always increases with oxidation, and is readily measured using state-of-the-art analytical techniques. Field and laboratory measurements of OSC , using several such techniques, constrain the chemical properties of the organics and demonstrate that the formation and evolution of organic aerosol involves simultaneous changes to both carbon oxidation state and carbon number (nC).

  8. Precursor lesions of high-grade serous ovarian carcinoma: morphological and molecular characteristics.

    Science.gov (United States)

    Gross, Amy L; Kurman, Robert J; Vang, Russell; Shih, Ie-Ming; Visvanathan, Kala

    2010-01-01

    The lack of proven screening tools for early detection and the high mortality of ovarian serous carcinoma (OSC), particularly high grade, have focused attention on identifying putative precursor lesions with distinct morphological and molecular characteristics. The finding of occult invasive and intraepithelial fallopian tube carcinomas in prophylactically removed specimens from asymptomatic high-risk BRCA 1/2-mutation carriers supports the notion of an origin for OSC in the fallopian tube. The intraepithelial carcinomas have been referred to as serous intraepithelial carcinomas (STICs) but our own findings (unpublished data) and recent reports have drawn attention to a spectrum of changes that fall short of STICs that we have designated serous tubal intraepithelial lesions (STILs).

  9. Precursor Lesions of High-Grade Serous Ovarian Carcinoma: Morphological and Molecular Characteristics

    Directory of Open Access Journals (Sweden)

    Amy L. Gross

    2010-01-01

    Full Text Available The lack of proven screening tools for early detection and the high mortality of ovarian serous carcinoma (OSC, particularly high grade, have focused attention on identifying putative precursor lesions with distinct morphological and molecular characteristics. The finding of occult invasive and intraepithelial fallopian tube carcinomas in prophylactically removed specimens from asymptomatic high-risk BRCA 1/2-mutation carriers supports the notion of an origin for OSC in the fallopian tube. The intraepithelial carcinomas have been referred to as serous intraepithelial carcinomas (STICs but our own findings (unpublished data and recent reports have drawn attention to a spectrum of changes that fall short of STICs that we have designated serous tubal intraepithelial lesions (STILs.

  10. Wave-Optics Modeling of the Optical-Transport Line for Passive Optical Stochastic Cooling

    Energy Technology Data Exchange (ETDEWEB)

    Andorf, M. B. [NICADD, DeKalb; Lebedev, V. A. [Fermilab; Piot, P. [Fermilab; Ruan, J. [Fermilab

    2018-03-01

    Optical stochastic cooling (OSC) is expected to enable fast cooling of dense particle beams. Transition from microwave to optical frequencies enables an achievement of stochastic cooling rates which are orders of magnitude higher than ones achievable with the classical microwave based stochastic cooling systems. A subsytem critical to the OSC scheme is the focusing optics used to image radiation from the upstream "pickup" undulator to the downstream "kicker" undulator. In this paper, we present simulation results using wave-optics calculation carried out with the {\\sc Synchrotron Radiation Workshop} (SRW). Our simulations are performed in support to a proof-of-principle experiment planned at the Integrable Optics Test Accelerator (IOTA) at Fermilab. The calculations provide an estimate of the energy kick received by a 100-MeV electron as it propagates in the kicker undulator and interacts with the electromagnetic pulse it radiated at an earlier time while traveling through the pickup undulator.

  11. Comparison of Pharmaceutical Calculations Learning Outcomes Achieved Within a Traditional Lecture or Flipped Classroom Andragogy

    Science.gov (United States)

    Frazier, Lisa; Anderson, Stephanie L.; Stanton, Robert; Gillette, Chris; Broedel-Zaugg, Kim; Yingling, Kevin

    2017-01-01

    Objective. To compare learning outcomes achieved from a pharmaceutical calculations course taught in a traditional lecture (lecture model) and a flipped classroom (flipped model). Methods. Students were randomly assigned to the lecture model and the flipped model. Course instructors, content, assessments, and instructional time for both models were equivalent. Overall group performance and pass rates on a standardized assessment (Pcalc OSCE) were compared at six weeks and at six months post-course completion. Results. Student mean exam scores in the flipped model were higher than those in the lecture model at six weeks and six months later. Significantly more students passed the OSCE the first time in the flipped model at six weeks; however, this effect was not maintained at six months. Conclusion. Within a 6 week course of study, use of a flipped classroom improves student pharmacy calculation skill achievement relative to a traditional lecture andragogy. Further study is needed to determine if the effect is maintained over time. PMID:28630511

  12. Understanding Energy Loss in Organic Solar Cells: Toward a New Efficiency Regime

    KAUST Repository

    Menke, S. Matthew

    2017-10-19

    Reducing energy and voltage loss is an imperative area of improvement for the design of organic solar cells (OSCs). Both in the context of charge generation and charge recombination, significant amounts of energy are lost even in state-of-the-art OSCs compared with their inorganic counterparts. Through a set of recent examples, however, we show that (1) charge generation can proceed with high quantum efficiency even in the absence of an offset energy at the donor-acceptor interface and (2) non-radiative charge recombination may be mitigated by considering systems with distinct properties of the interfacial charge-transfer state. To capitalize on these recent advances in understanding, we provide three actionable paths forward that aim to better identify, process, and characterize low energy loss systems: incorporating consistent and accurate measurements for energy levels, moving away from photoluminescence quenching, and exploring blends with reduced miscibility.

  13. Comparison of Pharmaceutical Calculations Learning Outcomes Achieved Within a Traditional Lecture or Flipped Classroom Andragogy.

    Science.gov (United States)

    Anderson, H Glenn; Frazier, Lisa; Anderson, Stephanie L; Stanton, Robert; Gillette, Chris; Broedel-Zaugg, Kim; Yingling, Kevin

    2017-05-01

    Objective. To compare learning outcomes achieved from a pharmaceutical calculations course taught in a traditional lecture (lecture model) and a flipped classroom (flipped model). Methods. Students were randomly assigned to the lecture model and the flipped model. Course instructors, content, assessments, and instructional time for both models were equivalent. Overall group performance and pass rates on a standardized assessment (Pcalc OSCE) were compared at six weeks and at six months post-course completion. Results. Student mean exam scores in the flipped model were higher than those in the lecture model at six weeks and six months later. Significantly more students passed the OSCE the first time in the flipped model at six weeks; however, this effect was not maintained at six months. Conclusion. Within a 6 week course of study, use of a flipped classroom improves student pharmacy calculation skill achievement relative to a traditional lecture andragogy. Further study is needed to determine if the effect is maintained over time.

  14. The role of polymer dots on efficiency enhancement of organic solar cells: Improving charge transport property

    Science.gov (United States)

    Li, Jinfeng; Zhang, Xinyuan; Liu, Chunyu; Li, Zhiqi; He, Yeyuan; Zhang, Zhihui; Shen, Liang; Guo, Wenbin; Ruan, Shengping

    2017-07-01

    In this work, poly(9,9-dioctylfluorene)-co-(4,7-di-2-thienyl-2,1,3-benzothiadiazole) (PF-5DTBT) and copolymer poly(styrene-co-maleic anhydride) (PSMA) dots were prepared as additive for active layer doping to enhance the power conversion efficiency (PCE) of organic solar cells (OSCs), which based on poly[N-9″-hepta-decanyl-2,7-carbazole-alt-5,5-(4‧,7‧-di-2-thienyl-2‧,1‧,3‧-benzothiadiazole) (PCDTBT) and [6,6]-phenyl C71 butyric acid methyl-ester (PC71BM). A high efficiency of 7.40% was achieved due to increase of short-circuit current (Jsc) and fill factor (FF). The operation mechanism of OSCs doping with polymer dots was investigated, which demonstrated that the efficiency enhancement ascribes to improvement of electrical properties, such as exciton generation, exction dissociation, charge transport, and charge collection.

  15. Using mixed solvent and changing spin-coating parameters to increase the efficiency and lifetime of organic solar cells.

    Science.gov (United States)

    Tsai, Yu Sheng; Chu, Wei-Ping; Tang, Rong-Ming; Juang, Fuh-Shyang; Chang, Ming-Hua; Liu, Mark O; Hsieh, Tsung-Eong

    2008-10-01

    The derivative of C60, i.e., PCBM, and P3HT (3-hexylthiophene) were dissolved in chloroform:dichlorobenzene mixed solvent, then spin-coated as the active layer for organic solar cells (OSC). The experimental parameters were studied carefully to obtain the optimum power conversion efficiency (PCE), including the solvent mixing ratio, spin-coating speed, annealing conditions for the active layer, etc. The OSC devices were packaged with glass and a newly developed UV-glue to improve the lifetime and PCE. Dichlorobenzene solvent has great effect upon the PCE. Changing the spin-coating speed and increasing the number of steps increased the PCE apparently to 1.4%.

  16. Analysis and characterization of heparin impurities.

    Science.gov (United States)

    Beni, Szabolcs; Limtiaco, John F K; Larive, Cynthia K

    2011-01-01

    This review discusses recent developments in analytical methods available for the sensitive separation, detection and structural characterization of heparin contaminants. The adulteration of raw heparin with oversulfated chondroitin sulfate (OSCS) in 2007-2008 spawned a global crisis resulting in extensive revisions to the pharmacopeia monographs on heparin and prompting the FDA to recommend the development of additional physicochemical methods for the analysis of heparin purity. The analytical chemistry community quickly responded to this challenge, developing a wide variety of innovative approaches, several of which are reported in this special issue. This review provides an overview of methods of heparin isolation and digestion, discusses known heparin contaminants, including OSCS, and summarizes recent publications on heparin impurity analysis using sensors, near-IR, Raman, and NMR spectroscopy, as well as electrophoretic and chromatographic separations.

  17. Effect of novel patient interaction on students’ performance of pregnancy options counseling

    Directory of Open Access Journals (Sweden)

    Angela Shaddeau

    2015-12-01

    Full Text Available Background: Although options counseling is a fundamental skill for medical providers, previous research has identified gaps in medical school reproductive health education. Purpose: To determine if a 1-h novel patient interaction (NPI improves student performance when caring for a standardized patient with an unintended pregnancy. Methods: From September 2012 to June 2013 we randomized third-year medical students at the University of Colorado School of Medicine to the standard curriculum plus an NPI, or the standard curriculum only. The NPI consisted of a 1-h small-group session with a patient who discussed her experiences with options counseling and her decision to terminate her pregnancy. Students completed an Objective Structured Clinical Examination (OSCE at the rotation's end, which included options counseling. The primary outcome was the proportion of participants achieving ‘excellence’ on the OSCE checklist. ‘Excellence’ was defined as a score ≥90%. Examinations were flagged as ‘unsatisfactory encounters’ if core competencies were not addressed. OSCE standardized patients and evaluators were blinded to group assignment. Results: In total, 135 students were eligible and randomized: 75 to NPI; 60 to control. During the OSCE, few students achieved ‘excellence’ (24% NPI vs. 28% control, p=0.57.There were no differences between scores for components of options counseling. More students in the control group ‘appeared somewhat uncomfortable’ delivering the pregnancy test results (5% NPI vs. 18% control, p=0.006. More than half (54% of the intervention group and 67% of controls had ‘unsatisfactory encounters’ (p=0.16, almost exclusively due to omission of adoption. Most students addressed abortion (96% NPI vs. 92% control, p=0.29. Conclusions: A 1-h NPI does not improve medical students’ performance of pregnancy options counseling and the option of adoption is routinely omitted. Adoption is clearly an area that needs

  18. Organisering af basal uddannelse i laparoskopisk kirurgi

    DEFF Research Database (Denmark)

    Lund, Lars; Høj, Lars; Poulsen, Johan

    2010-01-01

    evalueringsmetode er anvendt objective structured clinical examination (OSCE-test) og objective structured assessment of technical skills (OSATS-test). Resultater: Af de 106 læger er der færdigtrænet 80 læger på modul 1 og 2. Deltagernes fordeling på specialer var ved modul 1: kirurgi 47 læger, urologi 14 læger og...

  19. Evaluation of the Operational Stress Control and Readiness (OSCAR) Program

    Science.gov (United States)

    2015-01-01

    should receive training to fill the role of OSCAR team member. The divisions can be attributed to different ways that com- manders balance three...potential advantages have to be balanced against the suggestion by participants in the focus groups and the interviews that Marines are unlikely to...www.uscg.mil/ worklife /docs/pdf/Navy_and_Marine_Corps_OSC_Doctrine_Dec_2010%5b1%5d.pdf Dawson, Deborah A., Bridget F. Grant, Frederick S. Stinson

  20. Lifestyle medicine curriculum for a preventive medicine residency program: implementation and outcomes.

    Science.gov (United States)

    Nawaz, Haq; Petraro, Paul V; Via, Christina; Ullah, Saif; Lim, Lionel; Wild, Dorothea; Kennedy, Mary; Phillips, Edward M

    2016-01-01

    The vast majority of the healthcare problems burdening our society today are caused by disease-promoting lifestyles (e.g., physical inactivity and unhealthy eating). Physicians report poor training and lack of confidence in counseling patients on lifestyle changes. To evaluate a new curriculum and rotation in lifestyle medicine for preventive medicine residents. Training included didactics (six sessions/year), distance learning, educational conferences, and newly developed lifestyle medicine rotations at the Institute of Lifestyle Medicine, the Yale-Griffin Prevention Research Center, and the Integrative Medicine Center. We used a number of tools to assess residents' progress including Objective Structured Clinical Examinations (OSCEs), self-assessments, and logs of personal health habits. A total of 20 residents participated in the lifestyle medicine training between 2010 and 2013. There was a 15% increase in residents' discussions of lifestyle issues with their patients based on their baseline and follow-up surveys. The performance of preventive medicine residents on OSCEs increased each year they were in the program (average OSCE score: PGY1 73%, PGY2 83%, PGY3 87%, and PGY4 91%, p=0.01). Our internal medicine and preliminary residents served as a control, since they did participate in didactics but not in lifestyle medicine rotations. Internal medicine and preliminary residents who completed the same OSCEs had a slightly lower average score (76%) compared with plural for resident, preventive medicine residents (80%). However, this difference did not reach statistical significance (p=0.11). Incorporating the lifestyle medicine curriculum is feasible for preventive medicine training allowing residents to improve their health behavior change discussions with patients as well as their own personal health habits.