Origin of Oryza sativa in China inferred by nucleotide polymorphisms of organelle DNA.

Directory of Open Access Journals (Sweden)

Xin Wei

Full Text Available China is rich of germplasm resources of common wild rice (Oryza rufipogon Griff. and Asian cultivated rice (O. sativa L. which consists of two subspecies, indica and japonica. Previous studies have shown that China is one of the domestication centers of O. sativa. However, the geographic origin and the domestication times of O. sativa in China are still under debate. To settle these disputes, six chloroplast loci and four mitochondrial loci were selected to examine the relationships between 50 accessions of Asian cultivated rice and 119 accessions of common wild rice from China based on DNA sequence analysis in the present study. The results indicated that Southern China is the genetic diversity center of O. rufipogon and it might be the primary domestication region of O. sativa. Molecular dating suggested that the two subspecies had diverged 0.1 million years ago, much earlier than the beginning of rice domestication. Genetic differentiations and phylogeography analyses indicated that indica was domesticated from tropical O. rufipogon while japonica was domesticated from O. rufipogon which located in higher latitude. These results provided molecular evidences for the hypotheses of (i Southern China is the origin center of O. sativa in China and (ii the two subspecies of O. sativa were domesticated multiple times.

EKSPLORASI CENDAWAN ENDOFIT DARI TANAMAN PADI SEBAGAI AGENS PEMACU PERTUMBUHAN TANAMAN (The Exploration of Endophytic Fungi from Oryza sativa as Plant Growth Promoting Agents)

OpenAIRE

Wilia, Weni; Hayati, Islah; Ristyadi, Dwi

2013-01-01

Endophityc fungi have been successfully isolated from Oryza sativa atLaboratory of Plant Disease, Agriculture Faculty University of Jambi. Theaim of this research was to get endophityc fungi from Oryza sativa. Therewere three (3) candidates of endophityc fungi that have been successfullyisolated. Pathogenosity test which was done showed that all of fungi wereendophityc fungi. Those fungi were identified as endophityc fungi due to theseed of paddy could growth normally in pure culture of endop...

Genetic Architecture of Cold Tolerance in Rice (Oryza sativa) Determined through High Resolution Genome-Wide Analysis

Science.gov (United States)

Cold temperature is an important abiotic stress which negatively affects morphological development and seed production in rice (Oryza sativa L.). At the seedling stage, cold stress causes poor germination, seedling injury and poor stand establishment; and at the reproductive stage cold decreases se...

Development and Identification of Introgression Lines from Cross of Oryza sativa and Oryza minuta

Institute of Scientific and Technical Information of China (English)

GUO Si-bin; WEI Yu; LI Xiao-qiong; LIU Kai-qiang; HUANG Feng-kuan; CHEN Cai-hong; GAO Guo-qing

2013-01-01

Introgression line population is effectively used in mapping quantitative trait loci (QTLs),identifying favorable genes,discovering hidden genetic variation,evaluating the action or interaction of QTLs in multiple conditions and providing the favorable experimental materials for plant breeding and genetic research.In this study,an advanced backcross and consecutive selfing strategy was used to develop introgression lines (ILs),which derived from an accession of Oryza minuta (accession No.101133) with BBCC genome,as the donor,and an elite indica cultivar IR24 (O.sativa),as the recipient.Introgression segments from O.minuta were screened using 164 polymorphic simple sequence repeat (SSR) markers in the genome of each IL.Introgressed segments carried by 131 ILs covered the whole O.sativa genome.The average number of homozygous O.minuta segments per introgression line was about 9.99.The average length of introgressed segments was approximate 14.78 cM,and about 79.64％of these segments had sizes less than 20 cM.In the genome of each introgression line,the O.minuta chromosomal segments harbored chromosomal fragments of O.sativa ranging from 1.15％ to 27.6％,with an overall average of 8.57％.At each locus,the ratio of substitution of O.minuta alleles had a range of 1.5％-25.2％,with an average of 8.3％ Based on the evaluation of the phenotype of these ILs,a wide range of alterations in morphological and yield-related traits were found.After inoculation,ILs 41,11 and 7 showed high resistance to bacterial blight,brown planthopper and whitebacked planthopper,respectively.These O.minuta-O.sativa ILs will serve as genetic materials for identifying and using favorable genes from O.minuta.

A Hypersensitivity-Like Response to Meloidogyne graminicola in Rice (Oryza sativa).

Science.gov (United States)

Phan, Ngan Thi; De Waele, Dirk; Lorieux, Mathias; Xiong, Lizhong; Bellafiore, Stephane

2018-04-01

Meloidogyne graminicola is a major plant-parasitic nematode affecting rice cultivation in Asia. Resistance to this nematode was found in the African rice genotypes Oryza glaberrima and O. longistaminata; however, due to interspecific hybrid sterility, the introgression of resistance genes in the widely consumed O. sativa varieties remains challenging. Recently, resistance was found in O. sativa and, here, we report for the first time the histological and genetic characterization of the resistance to M. graminicola in Zhonghua 11, an O. sativa variety. Bright-light microscopy and fluorescence observations of the root tissue of this variety revealed that the root cells surrounding the nematode displayed a hypersensitivity-like reaction with necrotic cells at early stages of infection when nematodes are migrating in the root's mesoderm. An accumulation of presumably phenolic compounds in the nematodes' neighboring root cells was also observed. In addition, at a later stage of infection, not only were few feeding sites observed but also the giant cells were underdeveloped, underlining an incompatible interaction. Furthermore, we generated a hybrid O. sativa population by crossing Zhonghua 11 with the susceptible O. sativa variety IR64 in order to describe the genetic background of this resistance. Our data suggested that the resistance to M. graminicola infection was qualitative rather than quantitative and, therefore, major resistance genes must be involved in this infection process. The full characterization of the defense mechanism and the preliminary study of the genetic inheritance of novel sources of resistance to Meloidogyne spp. in rice constitute a major step toward their use in crop breeding.

Association analysis of three diverse rice (Oryza sativa L.) germplasm collections for loci regulating grain quality traits

Science.gov (United States)

In rice (Oryza sativa L.), end-use/cooking quality is vital for producers and millions of consumers worldwide. Grain quality is a complex trait with interacting genetic and environmental factors. Deciphering the complex genetic architecture associated with grain quality, will provide vital informati...

Transfer of bacterial blight resistance from Oryza meyeriana to O.Sativa L.by asymmetric somatic hybridization

Institute of Scientific and Technical Information of China (English)

ZHU Yongsheng; CHEN Baotang; YU Shunwu; ZHANG Duanpin; ZHANG Xueqin; YAN Qiusheng

2004-01-01

Asymmetric somatic hybrid plants were produced between cultivated rice (Oryza sativa L.) and wild species [O. Meyeriana (Zoll. etMor, exSteud.)] with high resistance to rice bacterial blight. X-ray-irradiated protoplasts of the wild species were used as donor and chemically fused with iodoacetamide-inactivated protoplasts of rice cv. 02428to produce hybrids. Seventy-two plants were regenerated from 623 calli based on metabolic complementation. The morphological characters of the plants closely resembled that of the rice. Simple sequence repeats were employed to identify their hybridity. Cytological analysis of root-tips revealed that their chromosome number varied in the range of 27-38. The somatic hybrids were inoculated with strains of Xanthamonas oryzae pv. Oryzae at adult growth stage and demonstrated the resistance to bacterial blight introgression from the O. Meyeriana.

Tanggap Pertumbuhan dan Produksi Padi (Oryza sativa L.) Varietas Ciherang Terhadap Pemberian Pupuk Organik

OpenAIRE

Sari, Vira Irma

2011-01-01

VIRA IRMA SARI. Response of Growth and Production of Rice (Oryza sativa L.) Variety Ciherang to The Application of Organic Fertilizer. Scarcity of inorganic fertilizer and the negative effect caused by inorganic fertilizer continuing to make organic fertilizer as a solution to overcome these problems. The availability of organic fertilizers is expected that the farmers can get the optimal production and profit, because the organic fertilizer is cheaper and easy ...

X-ray diffraction analysis and in vitro characterization of the UAM2 protein from Oryza sativa

DEFF Research Database (Denmark)

Welner, Ditte Hededam; Tsai, Alex Yi-Lin; DeGiovanni, Andy M.

2017-01-01

protein from Oryza sativa (OsUAM2) were undertaken. Here, X-ray diffraction data are reported, as well as analysis of the oligomeric state in the crystal and in solution. OsUAM2 crystallizes readily but forms highly radiation-sensitive crystals with limited diffraction power, requiring careful low......, a requirement for a structural metal ion....

Effect of bioaugmentation to enhance phytoremediation for removal of phenanthrene and pyrene from soil with Sorghum and Onobrychis sativa

Science.gov (United States)

2014-01-01

The use of plants to remove Poly-aromatic-hydrocarbons (PAHs) from soil (phytoremediation) is emerging as a cost-effective method. Phytoremediation of contaminated soils can be promoted by the use of adding microorganisms with the potential of pollution biodegradation (bioaugmentation). In the present work, the effect of bacterial consortium was studied on the capability of Sorghum and Onobrychis sativa for the phytoremediation of soils contaminated with phenanthrene and pyrene. 1.5 kg of the contaminated soil in the ratio of 100 and 300 mg phenanthrene and/or pyrene per kg of dry soil was then transferred into each pot (nine modes). The removal efficiency of natural, phytoremediation and bioaugmentation, separately and combined, were evaluated. The samples were kept under field conditions, and the remaining concentrations of pyrene and phenanthrene were determined after 120 days. The rhizosphere as well as the microbial population of the soil was also determined. Results indicated that both plants were able to significantly remove pyrene and phenanthrene from the contaminated soil samples. Phytoremediation alone had the removal efficiency of about 63% and 74.5% for pyrene and phenanthrene respectively. In the combined mode, the removal efficiency dramatically increased, leading to pyrene and phenanthrene removal efficiencies of 74.1% and 85.02% for Onobrychis sativa and 73.84% and 85.2% for sorghum, respectively. According to the results from the present work, it can be concluded that Onobrychis sativa and sorghum are both efficient in removing pyrene and phenanthrene from contamination and bioaugmentation can significantly enhance the phytoremediation of soils contaminated with pyrene and phenanthrene by 22% and 16% respectively. PMID:24406158

Analysis of the temporal variation of radiation balance components in arid rice (Oryza sativa L.) culture

International Nuclear Information System (INIS)

Prates, J.E.; Coelho, D.T.; Steinmetz, S.

1988-01-01

The time variation of measured radiation balance components in a cultived rice area (Oryza sativa L.) under arid conditions in the Brazil central-west region was analysed. The relation between global solar radiation, radiation balance, reflected radiation and terrestrial effective radiation in three different stages of the culture development: vegetative stage; blooming and maturation, was determined. (M.C.K.) [pt

Fine mapping of S37, a locus responsible for pollen and embryo sac sterility in hybrids between Oryza sativa L. and O. glaberrima Steud.

Science.gov (United States)

Shen, Yumin; Zhao, Zhigang; Ma, Hongyang; Bian, Xiaofeng; Yu, Yang; Yu, Xiaowen; Chen, Haiyuan; Liu, Linglong; Zhang, Wenwei; Jiang, Ling; Zhou, Jiawu; Tao, Dayun; Wan, Jianmin

2015-11-01

Hybrid sterility locus S37 between Oryza glaberrima and Oryza sativa results in both pollen and embryo sac sterility. Interspecific crossing between African cultivated rice Oryza glaberrima and Oryza sativa cultivars is hindered by hybrid sterility. To dissect the mechanism of interspecific hybrid sterility, we developed a near-isogenic line (NIL)-S37 using Dianjingyou1 (DJY1) as the recipient parent and an African cultivated rice variety as the donor parent. Empty pollen and embryo sac sterility were observed in F1 hybrids between DJY1 and NIL-S37. Cytological analyses showed that pollen abortion in the F1 hybrids occurred at the late binucleate stage due to a failure of starch accumulation in pollen grains. In addition, partial abortion of the embryo sac in the F1 hybrid was observed during function megaspore developing into mature embryo sac. Molecular analysis revealed that the semi-sterility was largely caused by the abortion of male and female gametophytes carrying the S37 allele from DJY1. A population of 25,600 plants derived from the hybrid DJY1/NIL-S37 was developed to fine map S37. Based on the physical location of molecular markers, S37 locus was finally delimited to a region of 205 kb on the short arm of chromosome 1 in terms of reference sequences of cv. Nipponbare. Interestingly, an about 97-kb DNA segment was deleted in the NIL-S37 based on BAC clone information of O. glaberrima. Fifty-four open reading frames (ORF) were predicted in this 205-kb region of DJY1, whereas only 31 ORFs were in that of NIL-S37. These results are valuable for cloning of S37 gene and further breaking reproductive isolation between Oryza glaberrima and Oryza sativa cultivars, as well as marker-assisted transferring of the corresponding neutral allele in rice breeding programs.

Oxygen dynamics in submerged rice (Oryza sativa L.)

DEFF Research Database (Denmark)

Colmer, Timothy D.; Pedersen, Ole

2008-01-01

Complete submergence of plants prevents direct O2 and CO2 exchange with air. Underwater photosynthesis can result in marked diurnal changes in O2 supply to submerged plants. Dynamics in pO2 had not been measured directly for submerged rice (Oryza sativa), but in an earlier study, radial O2 loss...... from roots showed an initial peak following shoot illumination.  O2 dynamics in shoots and roots of submerged rice were monitored during light and dark periods, using O2 microelectrodes. Tissue sugar concentrations were also measured.  On illumination of shoots of submerged rice, pO2 increased rapidly...... of magnitude higher than in darkness, enhancing also pO2 in roots.The initial peak in pO2 following illumination of submerged rice was likely to result from high initial rates of net photosynthesis, fuelled by CO2 accumulated during the dark period. Nevertheless, since sugars decline with time in submerged...

Association analysis using USDA diverse rice (Oryza sativa L.) germplasm collections to identify loci influencing grain quality traits

Science.gov (United States)

he USDA rice (Oryza sativa L.) core subset (RCS) was assembled to represent the genetic diversity of the entire USDA-ARS National Small Grains Collection and consists of 1,794 accessions from 114 countries. The USDA rice mini-core (MC) is a subset of 217 accessions from the RCS and was selected to ...

In-silico identification and phylogenetic analysis of auxin efflux ...

African Journals Online (AJOL)

The phytohormone auxin is crucial for plant growth and development. ... genome, which are similar in number with that of monocotyledonous plant Oryza sativa. ... are much closer to Sorghum bicolor and O. sativa PIN genes of the grass family.

Efecto de la cobertura de rastrojos en la germinación del arroz (Oryza sativa L. y principales malezas asociadas

Directory of Open Access Journals (Sweden)

Yemel M. Ortega

2005-01-01

Full Text Available Efecto de la cobertura de rastrojos en la germinacióndel arroz (Oryza sativaL. y principales malezas asociadas. Para determinar el grado de interferencia causado por distintas cantidades de rastrojos de arroz (Oryza sativaL. sobrela emergencia de arroz y malezas asociadas al cultivo, en el2003 se realizaron tres experimentos simultáneos en la hacienda el Pelón de la Bajura, Guanacaste, Costa Rica. Se aplicaron nueve tratamientos (0 a 9 t/ha de coberturas con rastrojosde la variedad de arroz CR 1113 para medir los efectos en laemergencia del arroz y malezas. Las malezas asociadas incluyen las más frecuentes en agroecosistemas arroceros inundados: Oryza sativa, Echinochloa colona, Cyperusspp., Fim-bristylisspp., Ludwigiaspp. y Heteranthera limosa. En losprimeros dos experimentos se determinaron relaciones inversas entre el grado de cobertura y la densidad de plántulas demalezas emergidas (R2>0,89, y entre el grado de cobertura yel porcentaje de germinación del arroz (R2=0,86, respectivamente. Usando coberturas con rastrojos de frijol (Phaseolusvulgaris en el tercer experimento, no se observó efecto supresor en la germinación del arroz, probablemente debido a supronta descomposición. Aunque la germinación del arroz nose afectó aún a las intensidades más altas de rastrojos evaluadas, conviene realizar pruebas similares a largo plazo para determinar posibles efectos debidos a la descomposición de residuos, alelopatía y acarreo de herbicidas después de variosciclos consecutivos del cultivo de arroz.

Macromolecular Traits in the African Rice Oryza glaberrima and in Glaberrima/Sativa Crosses, and Their Relevance to Processing.

Science.gov (United States)

Marengo, Mauro; Barbiroli, Alberto; Bonomi, Francesco; Casiraghi, Maria Cristina; Marti, Alessandra; Pagani, Maria Ambrogina; Manful, John; Graham-Acquaah, Seth; Ragg, Enzio; Fessas, Dimitrios; Hogenboom, Johannes A; Iametti, Stefania

2017-10-01

Molecular properties of proteins and starch were investigated in 2 accessions of Oryza glaberrima and Oryza sativa, and in one NERICA cross between the 2 species, to assess traits that could be relevant to transformation into specific foods. Protein nature and organization in O. glaberrima were different from those in O. sativa and in NERICA. Despite the similar cysteine content in all samples, thiol accessibility in O. glaberrima proteins was higher than in NERICA or in O. sativa. Inter-protein disulphide bonds were important for the formation of protein aggregates in O. glaberrima, whereas non-covalent protein-protein interactions were relevant in NERICA and O. sativa. DSC and NMR studies indicated only minor differences in the structure of starch in these species, as also made evident by their microstructural features. Nevertheless, starch gelatinization in O. glaberrima was very different from what was observed in O. sativa and NERICA. The content of soluble species in gelatinized starch from the various species in the presence/absence of treatments with specific enzymes indicated that release of small starch breakdown products was lowest in O. glaberrima, in particular from the amylopectin component. These findings may explain the low glycemic index of O. glaberrima, and provide a rationale for extending the use of O. glaberrima in the production of specific rice-based products, thus improving the economic value and the market appeal of African crops. The structural features of proteins and starch in O. glaberrima are very different from those in O. sativa and in the NERICA cross. These results appear useful as for extending the use of O. glaberrima cultivars in the design and production of specific rice-based products (for example, pasta), that might, in turn, improve the economic value and the market appeal of locally sourced raw materials, by introducing added-value products on the African market. © 2017 Institute of Food Technologists®.

Phytoextraction of cadmium by rice (Oryza sativa L.), soybean (Glycine max (L.) Merr.), and maize (Zea mays L.)

Energy Technology Data Exchange (ETDEWEB)

Murakami, M. [Department of Environmental Chemistry, National Institute for Agro-Environmental Sciences, 3-1-3 Kannondai, Tsukuba, Ibaraki 305-0856 (Japan)]. E-mail: simple@affrc.go.jp; Ae, N. [Department of Environmental Chemistry, National Institute for Agro-Environmental Sciences, 3-1-3 Kannondai, Tsukuba, Ibaraki 305-0856 (Japan)]. E-mail: aenoriha@kobe-u.ac.jp; Ishikawa, S. [Department of Environmental Chemistry, National Institute for Agro-Environmental Sciences, 3-1-3 Kannondai, Tsukuba, Ibaraki 305-0856 (Japan)]. E-mail: isatoru@niaes.affrc.go.jp

2007-01-15

Selecting a phytoextraction plant with high Cd-accumulating ability based on the plant's compatibility with mechanized cultivation techniques may yield more immediately practical results than selection based on high tolerance to Cd. Rice (Oryza sativa L., cv. Nipponbare and Milyang 23), soybean (Glycine max [L.] Merr., cv. Enrei and Suzuyutaka), and maize (Zea mays L., cv. Gold Dent) were grown on one Andosol and two Fluvisols with low concentration of Cd contamination ranging from 0.83 to 4.29 mg Cd kg{sup -1}, during 60 days in pots (550 mL) placed in a greenhouse. Shoot Cd uptake was as follows: Gold Dent < Enrei and Nipponbare < Suzuyutaka and Milyang 23. Several soil Cd fractions after Milyang 23 harvesting decreased most. Milyang 23 accumulated 10-15% of the total soil Cd in its shoot. The Milyang 23 rice is thus promising for phytoextraction of Cd from paddy soils with low contamination level. - Milyang 23 rice (Oryza sativa L.) accumulated 10-15% of the total soil Cd in its shoot.

Phytoextraction of cadmium by rice (Oryza sativa L.), soybean (Glycine max (L.) Merr.), and maize (Zea mays L.)

International Nuclear Information System (INIS)

Murakami, M.; Ae, N.; Ishikawa, S.

2007-01-01

Selecting a phytoextraction plant with high Cd-accumulating ability based on the plant's compatibility with mechanized cultivation techniques may yield more immediately practical results than selection based on high tolerance to Cd. Rice (Oryza sativa L., cv. Nipponbare and Milyang 23), soybean (Glycine max [L.] Merr., cv. Enrei and Suzuyutaka), and maize (Zea mays L., cv. Gold Dent) were grown on one Andosol and two Fluvisols with low concentration of Cd contamination ranging from 0.83 to 4.29 mg Cd kg -1 , during 60 days in pots (550 mL) placed in a greenhouse. Shoot Cd uptake was as follows: Gold Dent < Enrei and Nipponbare < Suzuyutaka and Milyang 23. Several soil Cd fractions after Milyang 23 harvesting decreased most. Milyang 23 accumulated 10-15% of the total soil Cd in its shoot. The Milyang 23 rice is thus promising for phytoextraction of Cd from paddy soils with low contamination level. - Milyang 23 rice (Oryza sativa L.) accumulated 10-15% of the total soil Cd in its shoot

Yield QTL analysis of Oryza sativa x O. glumaepatula introgression lines

Directory of Open Access Journals (Sweden)

Priscila Nascimento Rangel

2013-03-01

Full Text Available The objective of this work was to evaluate the yield performance of two generations (BC2F2 and BC2F9 of introgression lines developed from the interspecific cross between Oryza sativa and O. glumaepatula, and to identify the SSR markers associated to yield. The wild accession RS‑16 (O. glumaepatula was used as donor parent in the backcross with the high yielding cultivar Cica‑8 (O. sativa. A set of 114 BC2F1 introgression lines was genotyped with 141 polymorphic SSR loci distributed across the whole rice genome. Molecular analysis showed that in average 22% of the O. glumaepatula genome was introgressed into BC2F1 generation. Nine BC2F9 introgression lines had a significantly higher yield than the genitor Cica‑8, thus showing a positive genome interaction among cultivated rice and the wild O. glumaepatula. Seven QTL were identified in the overall BC2F2, with one marker interval (4879‑EST20 of great effect on yield. The alleles with positive effect on yield came from the cultivated parent Cica‑8.

Differences in the Sensitivity to UVB Radiation of Two Cultivars of Rice (Oryza sativa L.)

OpenAIRE

Jun, Hidema; Hye-Sook, Kang; Tadashi, Kumagai; Institute of Genetic Ecology, Tohoku University; Institute of Genetic Ecology, Tohoku University; Institute of Genetic Ecology, Tohoku University

1996-01-01

The effects of UVB radiation on the growth of two cultivars of Japanese lowland rice (Oryza sativa L.), Sasanishiki and Norin 1, were examined in a phytotron. Supplementation of visible radiation with UVB radiation reduced plant length, tiller number, the fresh and dry weights of the aboveground parts of plants, and the amounts of total leaf nitrogen, chlorophyll, soluble protein and ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) in the eighth leaf, the youngest fully expanded leaf...

Fine mapping and introgressing qFIS1-2, a major QTL for kernel fissure resistance in rice (Oryza sativa L.)

Science.gov (United States)

Rice (Oryza sativa L.) kernel fissuring increases breakage during milling and decreases the value of processed rice. This study employed molecular gene tagging methods to fine-map a fissure resistance (FR) locus in ‘Cybonnet’, a semidwarf tropical japonica cultivar, as well as transfer this trait to...

Vinegar rice (Oryza sativa L.) produced by a submerged fermentation process from alcoholic fermented rice

OpenAIRE

Spinosa,Wilma Aparecida; Santos Júnior,Vitório dos; Galvan,Diego; Fiorio,Jhonatan Luiz; Gomez,Raul Jorge Hernan Castro

2015-01-01

Considering the limited availability of technology for the production of rice vinegar and also due to the potential consumer product market, this study aimed to use alcoholic fermented rice (rice wine (Oryza sativa L.)) for vinegar production. An alcoholic solution with 6.28% (w/v) ethanol was oxidized by a submerged fermentation process to produce vinegar. The process of acetic acid fermentation occurred at 30 ± 0.3°C in a FRINGS® Acetator (Germany) for the production of vineg...

Molecular cloning, functional characterization and expression analysis of a novel monosaccharide transporter gene OsMST6 from rice (Oryza sativa L.)

NARCIS (Netherlands)

Wang, Y.; Xiao, Y.; Zhang, Y.; Chai, C.; Wei, G.; Wei, X.; Xu, H.; Wang, M.; Ouwerkerk, P.B.F.; Zhu, Z.

2008-01-01

Monosaccharides transporters play important roles in assimilate supply for sink tissue development. In this study, a new monosaccharide transporter gene OsMST6 was identified from rice (Oryza sativa L.). The predicted OsMST6 protein shows typical features of sugar transporters and shares 79.6%

Complete chloroplast genome sequences of Hordeum vulgare, Sorghum bicolor and Agrostis stolonifera, and comparative analyses with other grass genomes

Science.gov (United States)

Saski, Christopher; Lee, Seung-Bum; Fjellheim, Siri; Guda, Chittibabu; Jansen, Robert K.; Luo, Hong; Tomkins, Jeffrey; Rognli, Odd Arne; Clarke, Jihong Liu

2009-01-01

Comparisons of complete chloroplast genome sequences of Hordeum vulgare, Sorghum bicolor and Agrostis stolonifera to six published grass chloroplast genomes reveal that gene content and order are similar but two microstructural changes have occurred. First, the expansion of the IR at the SSC/IRa boundary that duplicates a portion of the 5′ end of ndhH is restricted to the three genera of the subfamily Pooideae (Agrostis, Hordeum and Triticum). Second, a 6 bp deletion in ndhK is shared by Agrostis, Hordeum, Oryza and Triticum, and this event supports the sister relationship between the subfamilies Erhartoideae and Pooideae. Repeat analysis identified 19–37 direct and inverted repeats 30 bp or longer with a sequence identity of at least 90%. Seventeen of the 26 shared repeats are found in all the grass chloroplast genomes examined and are located in the same genes or intergenic spacer (IGS) regions. Examination of simple sequence repeats (SSRs) identified 16–21 potential polymorphic SSRs. Five IGS regions have 100% sequence identity among Zea mays, Saccharum officinarum and Sorghum bicolor, whereas no spacer regions were identical among Oryza sativa, Triticum aestivum, H. vulgare and A. stolonifera despite their close phylogenetic relationship. Alignment of EST sequences and DNA coding sequences identified six C–U conversions in both Sorghum bicolor and H. vulgare but only one in A. stolonifera. Phylogenetic trees based on DNA sequences of 61 protein-coding genes of 38 taxa using both maximum parsimony and likelihood methods provide moderate support for a sister relationship between the subfamilies Erhartoideae and Pooideae. PMID:17534593

Efeito da irradiação gama nas características físico-químicas e sensoriais do arroz (Oryza sativa L. e no desenvolvimento de Sitophilus oryzae L. Effect of gamma irradiation on physico-chemical and sensorial characteristics of rice (Oryza sativa L. and on the development of Sitophilus oryzae L.

Directory of Open Access Journals (Sweden)

Cíntia Fernanda Pedroso Zanão

2009-03-01

Full Text Available A pesquisa teve como objetivo verificar a viabilidade da radiação gama como método de conservação do arroz polido (Oryza sativa L.. As amostras foram irradiadas com doses 0,5; 1,0; 3,0; e 5,0 kGy. Foram realizadas análises da quebra do grão no beneficiamento, da longevidade e reprodução do Sitophilus oryzae L., a composição centesimal, o conteúdo de amilose aparente e propriedades de pasta dos amidos, e análises para cor (instrumental e análise sensorial do arroz cru e cozido. Foi utilizado teste de Tukey (p The objective of this research was to verify the viability of the gamma radiation as polished rice (Oryza sativa L. conservation method. The samples were irradiated with doses of 0.5; 1.0; 3.0; and 5.0 kGy. Analysis of the grain breakage during the enriching process, longevity and reproduction of the Sitophilus oryzae L., centesimal composition, apparent amylose content, starch paste properties, color (instrumental, and the sensorial evaluation of raw and cooked rice were performed. It was verified that the irradiation did not change the percentage of grain breakage during the enrichment process, and it caused a negative effect on the development of insects. The irradiation did not change significantly the centesimal composition and the apparent amylase content. The Tukey test (p < 0.05 was conducted to verify the differences between the treatments. Gamma irradiation affected the pasting properties of the rice flour. Pasting parameters as temperature, peak, final viscosity, and setback values showed decreasing values with irradiation doses. Differences were detected in the sensorial aspect among the samples, and the sample irradiated with the dose of 1.0 kGy presented greater averages. Regarding the instrumental color parameter, it was observed the difference in the values b* indicating that the rice changed the white color for yellowish with the increase in the irradiation dose. The irradiation dose of 1.0 kGy proved the best

Formulasi Sediaan Lipstik Menggunakan Ekstrak Beras Ketan Hitam (Oryza sativa L var forma glutinosa) Sebagai Pewarna

OpenAIRE

Utami, Rini

2011-01-01

Black sticky rice (Oryza sativa L.) belongs to Poaceae family which is used by people as food stuffs such as tape and porridge. Black sticky rice is red/purple and its dye stuff is strong enough. In cosmetic, dye stuff is one of the causes of irritation and allergy on skin so that the researcher has made the formulation of lipstick component using natural dye stuff made of black sticky rice. The formulation of lipstick component consisted of some components such as cera alba, lanolin,...

Effects of gamma irradiation on long-storage seeds of Oryza sativa (cv. 2233) and their surface infecting fungal diversity

International Nuclear Information System (INIS)

Maity, J.P.; Kar, S.; Banerjee, S.; Chakraborty, A.; Santra, S.C.

2009-01-01

We have reported an effective 60 Co gamma irradiation method for the removal and long-time prevention of contaminating fungi of Oryza sativa cv-2233, without the losses of seed viabilities. The fungal growth and their population on gamma treated seeds was found to decrease significantly (p 50%) at 2 kGy, whereas total inhibition was noticed at 3 kGy after 1.5 month.

Oryza sativa Chloroplast Signal Recognition Particle 43 (OscpSRP43 Is Required for Chloroplast Development and Photosynthesis.

Directory of Open Access Journals (Sweden)

Xiang-guang Lv

Full Text Available A rice chlorophyll-deficient mutant w67 was isolated from an ethyl methane sulfonate (EMS-induced IR64 (Oryza sativa L. ssp. indica mutant bank. The mutant exhibited a distinct yellow-green leaf phenotype in the whole plant growth duration with significantly reduced levels of chlorophyll and carotenoid, impaired chloroplast development and lowered capacity of photosynthesis compared with the wild-type IR64. Expression of a number of genes associated with chlorophyll metabolism, chloroplast biogenesis and photosynthesis was significantly altered in the mutant. Genetic analysis indicated that the yellow-green phenotype was controlled by a single recessive nuclear gene located on the short arm of chromosome 3. Using map-based strategy, the mutation was isolated and predicted to encode a chloroplast signal recognition particle 43 KD protein (cpSRP43 with 388 amino acid residuals. A single base substitution from A to T at position 160 resulted in a premature stop codon. OscpSRP43 was constitutively expressed in various organs with the highest level in the leaf. Functional complementation could rescue the mutant phenotype and subcellular localization showed that the cpSRP43:GFP fusion protein was targeted to the chloroplast. The data suggested that Oryza sativa cpSRP43 (OscpSRP43 was required for the normal development of chloroplasts and photosynthesis in rice.

Control of gibberellin A(l) levels by 2, beta-hydroxylation during growth of dwarf Oryza sativa L. var. Tan-ginbozu

International Nuclear Information System (INIS)

Railton, I.D.

1978-01-01

Seedlings of dwarf rice (Oryza sativa L. var. Tan-ginbozu) exhibit a marked growth response to applied gibberellin A(1) and convert this compound into gibberellin A(8). In this study attempts were made to correlate the metabolism of 1,2[ 3 H] gibberellin A(1) and in particular the production of gibberellin A(8) with rice leaf sheath growth

Comparative analysis of the small RNA transcriptomes of Pinus contorta and Oryza sativa.

Science.gov (United States)

Morin, Ryan D; Aksay, Gozde; Dolgosheina, Elena; Ebhardt, H Alexander; Magrini, Vincent; Mardis, Elaine R; Sahinalp, S Cenk; Unrau, Peter J

2008-04-01

The diversity of microRNAs and small-interfering RNAs has been extensively explored within angiosperms by focusing on a few key organisms such as Oryza sativa and Arabidopsis thaliana. A deeper division of the plants is defined by the radiation of the angiosperms and gymnosperms, with the latter comprising the commercially important conifers. The conifers are expected to provide important information regarding the evolution of highly conserved small regulatory RNAs. Deep sequencing provides the means to characterize and quantitatively profile small RNAs in understudied organisms such as these. Pyrosequencing of small RNAs from O. sativa revealed, as expected, approximately 21- and approximately 24-nt RNAs. The former contained known microRNAs, and the latter largely comprised intergenic-derived sequences likely representing heterochromatin siRNAs. In contrast, sequences from Pinus contorta were dominated by 21-nt small RNAs. Using a novel sequence-based clustering algorithm, we identified sequences belonging to 18 highly conserved microRNA families in P. contorta as well as numerous clusters of conserved small RNAs of unknown function. Using multiple methods, including expressed sequence folding and machine learning algorithms, we found a further 53 candidate novel microRNA families, 51 appearing specific to the P. contorta library. In addition, alignment of small RNA sequences to the O. sativa genome revealed six perfectly conserved classes of small RNA that included chloroplast transcripts and specific types of genomic repeats. The conservation of microRNAs and other small RNAs between the conifers and the angiosperms indicates that important RNA silencing processes were highly developed in the earliest spermatophytes. Genomic mapping of all sequences to the O. sativa genome can be viewed at http://microrna.bcgsc.ca/cgi-bin/gbrowse/rice_build_3/.

The biosynthesis, structure and gelatinization properties of starches from wild and cultivated African rice species (Oryza barthii and Oryza glaberrima).

Science.gov (United States)

Wang, Kai; Wambugu, Peterson W; Zhang, Bin; Wu, Alex Chi; Henry, Robert J; Gilbert, Robert G

2015-09-20

The molecular structure and gelatinization properties of starches from domesticated African rice (Oryza glaberrima) and its wild progenitor (Oryza barthii) are determined and comparison made with Asian domesticated rice (Oryza sativa), the commonest commercial rice. This suggests possible enzymatic processes contributing to the unique traits of the African varieties. These have similar starch structures, including smaller amylose molecules, but larger amounts of amylose chains across the whole amylose chain-length distribution, and higher amylose contents, than O. sativa. They also show a higher proportion of two- and three-lamellae spanning amylopectin branch chains (degree of polymerization 34-100) than O. sativa, which contributes to their higher gelatinization temperatures. Fitting amylopectin chain-length distribution with a biosynthesis-based mathematical model suggests that the reason for this difference might be because O. glaberrima and O. barthii have more active SSIIIa and/or less active SBEIIb enzymes. Copyright © 2015 Elsevier Ltd. All rights reserved.

Duplication and diversification of the LEAFY HULL STERILE1 and Oryza sativa MADS5 SEPALLATA lineages in graminoid Poales

Directory of Open Access Journals (Sweden)

Christensen Ashley R

2012-02-01

Full Text Available Abstract Background Gene duplication and the subsequent divergence in function of the resulting paralogs via subfunctionalization and/or neofunctionalization is hypothesized to have played a major role in the evolution of plant form. The LEAFY HULL STERILE1 (LHS1 SEPALLATA (SEP genes have been linked with the origin and diversification of the grass spikelet, but it is uncertain 1 when the duplication event that produced the LHS1 clade and its paralogous lineage Oryza sativa MADS5 (OSM5 occurred, and 2 how changes in gene structure and/or expression might have contributed to subfunctionalization and/or neofunctionalization in the two lineages. Methods Phylogenetic relationships among 84 SEP genes were estimated using Bayesian methods. RNA expression patterns were inferred using in situ hybridization. The patterns of protein sequence and RNA expression evolution were reconstructed using maximum parsimony (MP and maximum likelihood (ML methods, respectively. Results Phylogenetic analyses mapped the LHS1/OSM5 duplication event to the base of the grass family. MP character reconstructions estimated a change from cytosine to thymine in the first codon position of the first amino acid after the Zea mays MADS3 (ZMM3 domain converted a glutamine to a stop codon in the OSM5 ancestor following the LHS1/OSM5 duplication event. RNA expression analyses of OSM5 co-orthologs in Avena sativa, Chasmanthium latifolium, Hordeum vulgare, Pennisetum glaucum, and Sorghum bicolor followed by ML reconstructions of these data and previously published analyses estimated a complex pattern of gain and loss of LHS1 and OSM5 expression in different floral organs and different flowers within the spikelet or inflorescence. Conclusions Previous authors have reported that rice OSM5 and LHS1 proteins have different interaction partners indicating that the truncation of OSM5 following the LHS1/OSM5 duplication event has resulted in both partitioned and potentially novel gene

Genome Sequences of Oryza Species

KAUST Repository

Kumagai, Masahiko

2018-02-14

This chapter summarizes recent data obtained from genome sequencing, annotation projects, and studies on the genome diversity of Oryza sativa and related Oryza species. O. sativa, commonly known as Asian rice, is the first monocot species whose complete genome sequence was deciphered based on physical mapping by an international collaborative effort. This genome, along with its accurate and comprehensive annotation, has become an indispensable foundation for crop genomics and breeding. With the development of innovative sequencing technologies, genomic studies of O. sativa have dramatically increased; in particular, a large number of cultivars and wild accessions have been sequenced and compared with the reference rice genome. Since de novo genome sequencing has become cost-effective, the genome of African cultivated rice, O. glaberrima, has also been determined. Comparative genomic studies have highlighted the independent domestication processes of different rice species, but it also turned out that Asian and African rice share a common gene set that has experienced similar artificial selection. An international project aimed at constructing reference genomes and examining the genome diversity of wild Oryza species is currently underway, and the genomes of some species are publicly available. This project provides a platform for investigations such as the evolution, development, polyploidization, and improvement of crops. Studies on the genomic diversity of Oryza species, including wild species, should provide new insights to solve the problem of growing food demands in the face of rapid climatic changes.

Genome Sequences of Oryza Species

KAUST Repository

Kumagai, Masahiko; Tanaka, Tsuyoshi; Ohyanagi, Hajime; Hsing, Yue-Ie C.; Itoh, Takeshi

2018-01-01

This chapter summarizes recent data obtained from genome sequencing, annotation projects, and studies on the genome diversity of Oryza sativa and related Oryza species. O. sativa, commonly known as Asian rice, is the first monocot species whose complete genome sequence was deciphered based on physical mapping by an international collaborative effort. This genome, along with its accurate and comprehensive annotation, has become an indispensable foundation for crop genomics and breeding. With the development of innovative sequencing technologies, genomic studies of O. sativa have dramatically increased; in particular, a large number of cultivars and wild accessions have been sequenced and compared with the reference rice genome. Since de novo genome sequencing has become cost-effective, the genome of African cultivated rice, O. glaberrima, has also been determined. Comparative genomic studies have highlighted the independent domestication processes of different rice species, but it also turned out that Asian and African rice share a common gene set that has experienced similar artificial selection. An international project aimed at constructing reference genomes and examining the genome diversity of wild Oryza species is currently underway, and the genomes of some species are publicly available. This project provides a platform for investigations such as the evolution, development, polyploidization, and improvement of crops. Studies on the genomic diversity of Oryza species, including wild species, should provide new insights to solve the problem of growing food demands in the face of rapid climatic changes.

Genetic variation for traits associated with domestication identified in a cultivated rice, Nipponbare (Oryza sativa ssp. japonica) x ancestral rice, O. nivara, mapping population

Science.gov (United States)

Oryza nivara, the progenitor of cultivated rice, O. sativa, has been the source of novel alleles for resistance to biotic and abiotic stresses, as well as for yield improvement. Many of these alleles were lost during the domestication process. To determine the molecular changes that occurred during ...

Proximate Nutritional Evaluation of Gamma Irradiated Black Rice (Oryza sativa L. cv. Cempo ireng)

Science.gov (United States)

Riyatun; Suharyana; Ramelan, A. H.; Sutarno; Saputra, O. A.; Suryanti, V.

2018-03-01

Black rice is a type of pigmented rice with black bran covering the endosperm of the rice kernel. The main objective of the present study was to provide details information on the proximate composition of third generation of gamma irradiated black rice (Oryza sativa L. cv. Cempo ireng). In respect to the control, generally speaking, there were no significant changes of moisture, lipids, proteins, carbohydrates and fibers contents have been observed for the both gamma irradiated black rice. However, the 200-BR has slightly better nutritional value than that of 300-BR and the control. The mineral contents of 200-BR increased significantly of about 35% than the non-gamma irradiated black rice.

Bekatul (Oryza sativa L. Menghambat Peningkatan Kadar Kolesterol Darah

Directory of Open Access Journals (Sweden)

Astri Kania

2014-02-01

Full Text Available Abstrak Penyakit kardiovaskuler merupakan penyebab utama kematian dan kecacatan di seluruh dunia, termasuk Indonesia. Penyakit kardiovaskuler disebabkan oleh pembentukan aterosklerosis pada pembuluh darah. Konsumsi larutan tepung bekatul (Oryza sativa L. dapat digunakan sebagai salah satu upaya untuk mencegah terjadinya aterosklerosis dengan cara menghambat peningkatan kadar kolesterol darah. Penelitian ini untuk menilai efek larutan tepung bejatul terhadap penghambatan peningkatan kadar kolesterol darah. Penelitian eksperimental laboratorik dengan rancangan acak lengkap telah dilakukan pada 20 ekor tikus putih jantan galur Wistar yang dibagi menjadi lima kelompok. Kelompok I adalah kontrol negatif yang diberikan diet tinggi lemak dan propiltiurasil (PTU 0,01%, kelompok II merupakan kontrol positif yang hanya diberi pelet. Kelompok III, IV, dan V adalah kelompok perlakuan yang diberikan sediaan uji 0,27 gram/200 gram BB, 0,54 gram/200 gram BB, dan 1,08 gram/200 gram BB, DTL dan PTU 0,01% secara bersamaan. Pengukuran kadar kolesterol darah dilakukan sebelum diberikan perlakuan (hari ke-7 dan setelah diberikan perlakuan (hari ke-21 dengan menggunakan metode kolorimetrik enzimatik. Hasil penelitian ini menunjukkan bahwa larutan tepung bekatul memiliki efek penghambatan terhadap peningkatan kadar kolesterol darah dengan dosis 0,54 gram/200 gram BB. Efek penghambatan tersebut diakibatkan oleh mekanisme interaksi  dari orizanol, fitosterol, dan omega-3 yang terdapat dalam larutan tepung bekatul. Kata kunci: Bekatul, efek penghambatan, kolesterol darah   Rice Bran (Oryza sativa L. Inhibit the Increase of Blood Cholesterol Level Abstract Cardiovascular disease is the major cause of mortality and morbidity in the world, including Indonesia. This disease caused by atherosclerosis formation in blood vessel. Consumption of rice bran is one alternative to prevent atherosclerosis by inhibiting the increase of blood cholesterol level. The Aim of study was to

Extraction of anthocyanins and polyphenols from black rice (Oryza sativa L.) by modeling and assessing their reversibility and stability.

Science.gov (United States)

Pedro, Alessandra Cristina; Granato, Daniel; Rosso, Neiva Deliberali

2016-01-15

This study was aimed the extraction of total flavonoids, anthocyanins and phenolics, as well as the antioxidant activity of black rice (Oryza sativa) and to study the stability in relation to pH, light and copigmentation. Variations in temperature (10-50°C), time (20-80min), and solid-solvent ratio (1:15-1:45) were studied using a Box-Behnken design. The regression models were significant (Pblack rice was cyanidin-3-glucoside. Copyright © 2015 Elsevier Ltd. All rights reserved.

Isolation of stress responsive Psb A gene from rice (Oryza sativa l.) using differential display.

Science.gov (United States)

Tyagi, Aruna; Chandra, Arti

2006-08-01

Differential display (DD) experiments were performed on drought-tolerant rice (Oryza sativa L.) genotype N22 to identify both upregulated and downregulated partial cDNAs with respect to moisture stress. DNA polymorphism was detected between drought-stressed and control leaf tissues on the DD gels. A partial cDNA showing differential expression, with respect to moisture stress was isolated from the gel. Northern blotting analysis was performed using this cDNA as a probe and it was observed that mRNA corresponding to this transcript was accumulated to high level in rice leaves under water deficit stress. At the DNA sequence level, the partial cDNA showed homology with psb A gene encoding for Dl protein.

Genetic studies and a search for molecular markers that are linked ...

African Journals Online (AJOL)

SERVER

White sorghum is ground into flour and used ... Eleusine coracana (L.) Gaertn], maize (Zea mays L.), rice. (Oryza sativa L.) and sugar cane (Saccharum species). (Stroud .... ng/ul solutions were prepared and were used in the construction of.

Genetic analysis and gene fine mapping of aroma in rice (Oryza sativa L. Cyperales, Poaceae

Directory of Open Access Journals (Sweden)

Shu Xia Sun

2008-01-01

Full Text Available We investigated inheritance and carried out gene fine mapping of aroma in crosses between the aromatic elite hybrid rice Oryza sativa indica variety Chuanxiang-29B (Ch-29B and the non-aromatic rice O. sativa indica variety R2 and O. sativa japonica Lemont (Le. The F1 grains and leaves were non-aromatic while the F2 non-aroma to aroma segregation pattern was 3:1. The F3 segregation ratio was consistent with the expected 1:2:1 for a single recessive aroma gene in Ch-29B. Linkage analysis between simple sequence repeat (SSR markers and the aroma locus for the aromatic F2 plants mapped the Ch-29B aroma gene to a chromosome 8 region flanked by SSR markers RM23120 at 0.52 cM and RM3459 at 1.23 cM, a replicate F2 population confirming these results. Three bacterial artificial chromosome (BAC clones cover chromosome 8 markers RM23120 and RM3459. Our molecular mapping data from the two populations indicated that the aroma locus occurs in a 142.85 kb interval on BAC clones AP005301 or AP005537, implying that it might be the same gene reported by Bradbury et al (2005a; Plant Biotec J. 3:363-370. The flanking markers Aro7, RM23120 and RM3459 identified by us could greatly accelerate the efficiency and precision of aromatic rice breeding programs.

Comparative physical mapping of rice BAC clones linked to resistance genes Glh,Bph-3 and xa-5 in Oryza sativa L.and O.granulata Nees et Am.ex Watt.

Institute of Scientific and Technical Information of China (English)

XIONG Zhiyong; TAN Guangxuan; YOU Aiqing; HE Guangyuan; SHE Chaowen; LI Lijia; SONG Yunchun

2004-01-01

Oryza granulata Nees et Arn. ex Watt. is one of the three wild relatives of rice, which are the most valuable for study and utilization in China. In this study, the homology and physical locations of three rice resistance genes, Glh,Bph-3 and xa-5 are comparatively analyzed between O. sativa and O. granulata by Southern blotting and fluorescence in situ hybridization (FISH). The results of Southern blotting indicate that there exist homologous sequences of the tested RFLP markers in O. granulata. By using three bacterial artificial chromosome (BAC) clones scanned by the tested RFLP as probes, FISH signals are detected on both mitotic and pachytene chromosomes in O. sativa and O. granulata.Dual-color FISH demonstrates that two of the three BAC clones (14E16 and 38J9) are located on the short arm of the same chromosome pair in O. granulata. Additionally, colinearity is shown for the two clones between O. sativa and O.granulata. Another BAC clone 44B4 is located on the end of the short arm of other chromosome pair in these two species.Although the phylogenetic relationship between O. sativa and O. granulata is the most distinct in Oryza and these two species have evidently different biological features and ecological habits, the relative lengths and arm ratios of the detected chromosomes and the relative positions of the tested clone signals on chromosomes in O. granulata are quite similar to those in O. sativa.

Assessing hybrid sterility in Oryza glaberrima x O. sativa hybrid progenies by PCR marker analysis and crossing with wide compatibility varieties.

Science.gov (United States)

Heuer, Sigrid; Miézan, Kouamé M

2003-09-01

Interspecific crossing of the African indigenous rice Oryza glaberrima with Oryza sativa cultivars is hindered by crossing barriers causing 100% spikelet sterility in F(1) hybrids. Since hybrids are partially female fertile, fertility can be restored by back crossing (BC) to a recurrent male parent. Distinct genetic models on spikelet sterility have been developed predicting, e.g., the existence of a gamete eliminator and/or a pollen killer. Linkage of sterility to the waxy starch synthase gene and the chromogen gene C, both located on chromosome 6, have been demonstrated. We selected a segregating BC(2)F(3) population of semi-sterile O. glaberrima x O. sativa indica hybrid progenies for analyses with PCR markers located at the respective chromosome-6 region. These analyses revealed that semi-sterile plants were heterozygous for a marker (OSR25) located in the waxy promoter, whereas fertile progenies were homozygous for the O. glaberrima allele. Adjacent markers showed no linkage to spikelet sterility. Semi-sterility of hybrid progenies was maintained at least until the F(4) progeny generation, suggesting the existence of a pollen killer in this plant material. Monitoring of reproductive plant development showed that spikelet sterility was at least partially due to an arrest of pollen development at the microspore stage. In order to address the question whether genes responsible for F(1) sterility in intraspecific hybrids ( O. sativa indica x japonica) also cause spikelet sterility in interspecific hybrids, crossings with wide compatibility varieties (WCV) were performed. WCV accessions possess "neutral" S-loci ( S(n)) improving fertility in intraspecific hybrids. This experiment showed that the tested S(n)-loci had no fertility restoring effect in F(1) interspecific hybrids. Pollen development was completely arrested at the microspore stage and grains were never obtained after selfing. This suggests that distinct or additional S-loci are responsible for sterility

Effect of atmospheric plasma treatment on seed germination of rice (Oryza sativa L.)

Science.gov (United States)

Penado, Keith Nealson M.; Mahinay, Christian Lorenz S.; Culaba, Ivan B.

2018-01-01

Multiple methods of improving plant development have been utilized over the past decades. Despite these improvements, there still exists a need for better planting methods due to the increasing population of a global community. Studies have reported that plasma treatment affects the growth and germination of a variety of plant species, including a multitude of grains which often takes the bulk in the diet of the average human being. This study explores the effect of atmospheric air plasma jet treatment on the seed germination of rice (Oryza sativa L.). The seeds were treated using an atmospheric air plasma jet for 1, 2, and 3 s. The effect of plasma exposure shows a reduction of trichomes on the surface of the seed. This caused a possible increase in wettability which significantly affected the seed germ length but did not affect the seed germination count after the germination period of 72 h.

Variations in characters of diploid-like plants derived from gamma-irradiated tetraploids in rice (Oryza sativa L.)

International Nuclear Information System (INIS)

Yamamoto, K.; Fukuoka, H.; Kageyama, Y.; Takeda, G.

1990-01-01

Full text: Populations of artificial autotetraploids of rice (Oryza sativa L. cvs. 'Nipponbare' and 'Fukunishiki') were repeatedly irradiated with gamma-rays through several generations. Plants which did not differ in appearance from the original diploid plants occurred occasionally in the populations. Nine diploid-like plants were obtained so far, and their generations were advanced without irradiation in order to examine the mode of segregation of characters in their progeny. The results indicate that diploid-like plants with multiple mutant characters could be obtained and that dominant characters, i.e. awned spikelet and coloured apiculus, were included in the mutant characters. The diploid-like plants had 2n=24 chromosomes. (author)

Cyanobacteria-mediated phenylpropanoids and phytohormones in rice (Oryza sativa) enhance plant growth and stress tolerance.

Science.gov (United States)

Singh, Dhananjaya P; Prabha, Ratna; Yandigeri, Mahesh S; Arora, Dilip K

2011-11-01

Phenylpropanoids, flavonoids and plant growth regulators in rice (Oryza sativa) variety (UPR 1823) inoculated with different cyanobacterial strains namely Anabaena oryzae, Anabaena doliolum, Phormidium fragile, Calothrix geitonos, Hapalosiphon intricatus, Aulosira fertilissima, Tolypothrix tenuis, Oscillatoria acuta and Plectonema boryanum were quantified using HPLC in pot conditions after 15 and 30 days. Qualitative analysis of the induced compounds using reverse phase HPLC and further confirmation with LC-MS/MS showed consistent accumulation of phenolic acids (gallic, gentisic, caffeic, chlorogenic and ferulic acids), flavonoids (rutin and quercetin) and phytohormones (indole acetic acid and indole butyric acid) in rice leaves. Plant growth promotion (shoot, root length and biomass) was positively correlated with total protein and chlorophyll content of leaves. Enzyme activity of peroxidase and phenylalanine ammonia lyase and total phenolic content was fairly high in rice leaves inoculated with O. acuta and P. boryanum after 30 days. Differential systemic accumulation of phenylpropanoids in plant leaves led us to conclude that cyanobacterial inoculation correlates positively with plant growth promotion and stress tolerance in rice. Furthermore, the study helped in deciphering possible mechanisms underlying plant growth promotion and stress tolerance in rice following cyanobacterial inoculation and indicated the less explored avenue of cyanobacterial colonization in stress tolerance against abiotic stress.

Genome-wide analysis of potential cross-reactive endogenous allergens in rice (Oryza sativa L.

Directory of Open Access Journals (Sweden)

Fang Chao Zhu

2015-01-01

Full Text Available The proteins in the food are the source of common allergic components to certain patients. Current lists of plant endogenous allergens were based on the medical/clinical reports as well as laboratory results. Plant genome sequences made it possible to predict and characterize the genome-wide of putative endogenous allergens in rice (Oryza sativa L.. In this work, we identified and characterized 122 candidate rice allergens including the 22 allergens in present databases. Conserved domain analysis also revealed 37 domains among rice allergens including one novel domain (histidine kinase-, DNA gyrase B-, and HSP90-like ATPase, PF13589 adding to the allergen protein database. Phylogenetic analysis of the allergens revealed the diversity among the Prolamin superfamily and DnaK protein family, respectively. Additionally, some allergens proteins clustered on the rice chromosome might suggest the molecular function during the evolution.

Systematic analysis of rice (Oryza sativa) metabolic responses to herbivory.

Science.gov (United States)

Alamgir, Kabir Md; Hojo, Yuko; Christeller, John T; Fukumoto, Kaori; Isshiki, Ryutaro; Shinya, Tomonori; Baldwin, Ian T; Galis, Ivan

2016-02-01

Plants defend against attack from herbivores by direct and indirect defence mechanisms mediated by the accumulation of phytoalexins and release of volatile signals, respectively. While the defensive arsenals of some plants, such as tobacco and Arabidopsis are well known, most of rice's (Oryza sativa) defence metabolites and their effectiveness against herbivores remain uncharacterized. Here, we used a non-biassed metabolomics approach to identify many novel herbivory-regulated metabolic signatures in rice. Most were up-regulated by herbivore attack while only a few were suppressed. Two of the most prominent up-regulated signatures were characterized as phenolamides (PAs), p-coumaroylputrescine and feruloylputrescine. PAs accumulated in response to attack by both chewing insects, i.e. feeding of the lawn armyworm (Spodoptera mauritia) and the rice skipper (Parnara guttata) larvae, and the attack of the sucking insect, the brown planthopper (Nilaparvata lugens, BPH). In bioassays, BPH insects feeding on 15% sugar solution containing p-coumaroylputrescine or feruloylputrescine, at concentrations similar to those elicited by heavy BPH attack in rice, had a higher mortality compared to those feeding on sugar diet alone. Our results highlight PAs as a rapidly expanding new group of plant defence metabolites that are elicited by herbivore attack, and deter herbivores in rice and other plants. © 2015 John Wiley & Sons Ltd.

Fe deficiency induced changes in rice (Oryza sativa L.) thylakoids.

Science.gov (United States)

Wang, Yuwen; Xu, Chao; Li, Kang; Cai, Xiaojie; Wu, Min; Chen, Guoxiang

2017-01-01

Iron deficiency is an important abiotic stress that limits productivity of crops all over the world. We selected a hybrid rice (Oryza sativa L.), LYPJ, which is super high-yield and widely cultured in China, to investigate changes in the components and structure of thylakoid membranes and photosynthetic performance in response to iron deficiency. Our results demonstrated that photosystem I (PSI) is the primary target for iron deficiency, while the changes in photosystem II (PSII) are important for rebuilding a balance in disrupted energy utilization and dissipation caused by differential degradation of photosynthetic components. The result of immunoblot analysis suggested that the core subunit PsaA declined drastically, while PsbA remained relatively stable. Furthermore, several organizational changes of the photosynthetic apparatus were found by BN-PAGE, including a marked decrease in the PSI core complexes, the Cytb 6 /f complex, and the trimeric form of the LHCII antenna, consistent with the observed unstacking grana. The fluorescence induction analysis indicated a descending PSII activity with energy dissipation enhanced markedly. In addition, we proposed that the crippled CO 2 assimilation could be compensated by the enhanced of phosphoenolpyruvate carboxylase (PEPC), which is suggested by the decreased ribulose-1,5-bisphosphate carboxylase/oxygenase (RuBisCO) and photosynthetic efficiency.

Nuclear and original DNA application in Oryza taxonomy and phylogeny

International Nuclear Information System (INIS)

Romero, Gabriel O.

1998-01-01

Conventional taxonomy and phylogeny of germplasm are based on the tedious characterization of morphological variation. The ability to assay DNA variation that underlies morphological variation offers great promise as a convenient alternative for the genetic characterization of germplasm. Restriction fragment length polymorphism (RFLP) was used to survey DNA variation in 22 species of the genus Oryza. At the ribosomal DNA (rDNA) multigene family, 15 rDNA spacer length (sl) variants were identified using restriction enzyme Sst1 and wheatrDNA unit as probe. Particular sl variants predominated in certain isozyme groups of O. sativa, indicating a potential of sl ploymorphism in varietal classification. The distribution of sl variants supports the origin of O. sativa and O. nivara from O. rufipogon, and that O. spontanea arose from introgressions among O. sativa, O. nivara, and O. rufipogon. The distribution also suggests that the CCgenome, of all the genomes in the Officinalis complex, may be closest to the Sativa complex genomes, and it affirms the genetic position of the Officinalis complex intermediate between the Sativa and Ridleyi complexes. Variation at the Oryza organelle genomes was probed with a maize mitochondrial gene, atpA, a wheat chloroplast inverted repeat segment, p6. Results indicated that the complexes can be differentiated by their mitochondrial genome, but not their chloroplast genome when digested by Sst1 or BamH1. Therefore, the natural DNA variation in the nuclear and mitochondrial genomes has demonstrated great potential in complementing the conventional basis of taxa classification and phylogeny in the genus Oryza. (Author)

A walk on the wild side: Oryza species as source for rice abiotic stress tolerance.

Science.gov (United States)

Menguer, Paloma Koprovski; Sperotto, Raul Antonio; Ricachenevsky, Felipe Klein

2017-01-01

Oryza sativa, the common cultivated rice, is one of the most important crops for human consumption, but production is increasingly threatened by abiotic stresses. Although many efforts have resulted in breeding rice cultivars that are relatively tolerant to their local environments, climate changes and population increase are expected to soon call for new, fast generation of stress tolerant rice germplasm, and current within-species rice diversity might not be enough to overcome such needs. The Oryza genus contains other 23 wild species, with only Oryza glaberrima being also domesticated. Rice domestication was performed with a narrow genetic diversity, and the other Oryza species are a virtually untapped genetic resource for rice stress tolerance improvement. Here we review the origin of domesticated Oryza sativa from wild progenitors, the ecological and genomic diversity of the Oryza genus, and the stress tolerance variation observed for wild Oryza species, including the genetic basis underlying the tolerance mechanisms found. The summary provided here is important to indicate how we should move forward to unlock the full potential of these germplasms for rice improvement.

Assessment of genomic relationship between Oryza sativa and ...

African Journals Online (AJOL)

The hybrid was produced between these two species at the International Rice Research Institute using embryo rescue technique. The chromosome pairing was examined in pollen mother cells of O. australinesis, O. sativa and the hybrid between O. sativa and O. australinesis. The hybrid was highly sterile with pollen stain ...

Hybridization study of wild rice Oryza glumaepatula with varieties of cultivated rice (O. sativa) and wild (O. grandiglumis)

International Nuclear Information System (INIS)

Villalobos Cascante, Eddier

2015-01-01

The process of interspecific hybridization of the wild species O. glumaepatula is studied with commercial varieties of the species O. sativa and O. grandiglumis, by morphological evaluation and hybrid flow cytometry. Hybrid plants were evaluated of cross between O. glumaepatula, located in the wetlands of Rio Medio Queso and two varieties of O. sativa, Puita Inta and CFX 18 resistant to a herbicide. The technique of Polymerase Chain Reaction Allele Specifies Oligonucleotide (PCR-ASO) was used to detect allelic mutations in the ALS gene conferring herbicide resistance, and it is confirmed the hybrid nature of the plants obtained at crossings. 68 hybrids were obtained: O. glumaepatula x P. Inta, 21 hybrids P. Inta x O. glumaepatula, 4 hybrids O. glumaepatula x CFX-18 and 15 hybrids CFX-18 x O. glumaepatula. 10 morphological descriptors of the genus Oryza were evaluated and determined that are indifferent to the direction and type of crossing, the hybrids resemble to the wild species O. glumaepatula for characters: height, panicle length and ligule length. All hybrids have showed similarity to commercial varieties in flag leaf length. Other characters evaluated in the hybrids have presented maternal effect, heterosis and intermediate values. The protocol of flow cytometry (FCM) is standardized species for Oryza genus analyzing nuclear DNA content of 106 samples of leaf tissue of wild species O. glumaepatula, O. grandiglumis; whose average has been of 0.73 picograms, and natural hybrids product of the cross of these species. The result has been intermediate compared with O. grandiglumis and O. glumaepatula that have made available to 1.0 picograms and 0.50 of DNA respectively. The molecular nature of the hybrids was confirmed in this way. (author) [es

Influence of cooking on anthocyanins in black rice (Oryza sativa L. japonica var. SBR).

Science.gov (United States)

Hiemori, Miki; Koh, Eunmi; Mitchell, Alyson E

2009-03-11

The composition and thermal stability of anthocyanins in black rice (Oryza sativa L. japonica var. SBR) produced in California were investigated. Six anthocyanin pigments were identified and quantified by high performance liquid chromatography using photo diode-array detection (HPLC-PDA) and electrospray ionization mass spectrometry [LC-(ESI)MS/MS]. The predominant anthocyanins are cyanidin-3-glucoside (572.47 microg/g; 91.13% of total) and peonidin-3-glucoside (29.78 microg/g; 4.74% of total). Minor constituents included three cyanidin-dihexoside isomers and one cyanidin hexoside. Thermal stability of anthocyanins was assessed in rice cooked using a rice cooker, pressure cooker, or on a gas range. All cooking methods caused significant (P rice cooker (74.2%) and gas range (65.4%). Conversely, levels of protocatechuic acid increased 2.7 to 3.4 times in response to all cooking methods. These findings indicate that cooking black rice results in the thermal degradation of cyanidin-3-glucoside and concomitant production of protocatechuic acid.

Why develop O. sativa x O. rufipogon chromosome segment substitution line libraries?

Science.gov (United States)

Transgressive variation has been observed in rice (Oryza sativa) as an increase in grain yield in advanced backcross mapping populations derived from crosses between several adapted O. sativa varieties and a single accession (IRGC105491) of the ancestral parent, O. rufipogon. The phenomena of hybrid...

Can Rice (Oryza sativa) Mitigate Pesticides and Nutrients in Agricultural Runoff?

Science.gov (United States)

Moore, M T; Locke, M A

2018-01-01

Phytoremediation of nutrients and pesticides in runoff is a growing conservation effort, particularly in agriculturally intensive areas such as the lower Mississippi River Valley. In the current study, rice (Oryza sativa) was examined for its mitigation capacity of nitrogen, phosphorus, diazinon, and permethrin. Twenty-two high density polyethylene circular containers (56 cm x 45 cm) were used as mesocosms, with 12 mesocosms planted with rice and 10 mesocosms remaining unvegetated. Mesocosms were hydraulically connected and arranged in a series of two, with each system providing a 4 h hydraulic retention time (HRT) for a total system retention time of 8 h. Two treatments (RICE/RICE and RICE/BARE) of four replicates each were utilized, with three replicates of controls (BARE/BARE). Systems with RICE/RICE (8 h HRT) significantly reduced diazinon (p = 0.0126), cis-permethrin (p = 0.0442), filtered orthophosphate (p = 0.0058), and total orthophosphate (p = 0.0123) compared to control systems. No significant differences were noted for trans-permethrin, nitrate, or ammonium. Results indicate promise in phytoremediation of agricultural runoff by rice. If further studies reveal contaminants are not transferred into seeds, then rice could potentially serve as both a remediation tool and food source in countries facing agricultural pollution challenges.

Toxic action of zinc on growth and enzyme activities of rice Oryza sativa L. seedlings

Energy Technology Data Exchange (ETDEWEB)

Nag, P.; Nag, P.; Paul, A.K.; Mukherji, S.

1984-01-01

This paper provides information on the effects of toxic concentrations of zinc sulfate (ZnSO/sub 4/.7H/sub 2/O) on the growth and metabolism of rice Oryza sativa L. seedlings. Root growth inhibition was always more pronounced than was shoot growth inhibition. Root growth was completely inhibited at 40 m M concentration, whereas the magnitude of reduction of shoot length was only 56% at this concentration. Gibberellic acid (GA/sub 3/) was partially capable of relieving zinc inhibition. The activities of peroxidase, IAA oxidase and ascorbic acid oxidase of seedlings increased in response to zinc addition, whereas catalase and IAA synthetase decreased. All the hydrolyzing enzymes, viz., ..cap alpha..-amylase and phytase of endosperm together with RNase and ATPase of the embryo, showed distinct inhibition from the control, the exception being endosperm RNase which was stimulated under zinc treatment. 50 references, 6 figures.

Mapping of a Cellulose-Deficient Mutant Named dwarf1-1 in Sorghum bicolor to the Green Revolution Gene gibberellin20-oxidase Reveals a Positive Regulatory Association between Gibberellin and Cellulose Biosynthesis.

Science.gov (United States)

Petti, Carloalberto; Hirano, Ko; Stork, Jozsef; DeBolt, Seth

2015-09-01

Here, we show a mechanism for expansion regulation through mutations in the green revolution gene gibberellin20 (GA20)-oxidase and show that GAs control biosynthesis of the plants main structural polymer cellulose. Within a 12,000 mutagenized Sorghum bicolor plant population, we identified a single cellulose-deficient and male gametophyte-dysfunctional mutant named dwarf1-1 (dwf1-1). Through the Sorghum propinquum male/dwf1-1 female F2 population, we mapped dwf1-1 to a frameshift in GA20-oxidase. Assessment of GAs in dwf1-1 revealed ablation of GA. GA ablation was antagonistic to the expression of three specific cellulose synthase genes resulting in cellulose deficiency and growth dwarfism, which were complemented by exogenous bioactive gibberellic acid application. Using quantitative polymerase chain reaction, we found that GA was positively regulating the expression of a subset of specific cellulose synthase genes. To cross reference data from our mapped Sorghum sp. allele with another monocotyledonous plant, a series of rice (Oryza sativa) mutants involved in GA biosynthesis and signaling were isolated, and these too displayed cellulose deficit. Taken together, data support a model whereby suppressed expansion in green revolution GA genes involves regulation of cellulose biosynthesis. © 2015 American Society of Plant Biologists. All Rights Reserved.

Reconstruction of Oryza sativa indica Genome Scale Metabolic Model and Its Responses to Varying RuBisCO Activity, Light Intensity, and Enzymatic Cost Conditions

Directory of Open Access Journals (Sweden)

Ankita Chatterjee

2017-11-01

Full Text Available To combat decrease in rice productivity under different stresses, an understanding of rice metabolism is needed. Though there are different genome scale metabolic models (GSMs of Oryza sativa japonica, no GSM with gene-protein-reaction association exist for Oryza sativa indica. Here, we report a GSM, OSI1136 of O.s. indica, which includes 3602 genes and 1136 metabolic reactions and transporters distributed across the cytosol, mitochondrion, peroxisome, and chloroplast compartments. Flux balance analysis of the model showed that for varying RuBisCO activity (Vc/Vo (i the activity of the chloroplastic malate valve increases to transport reducing equivalents out of the chloroplast under increased photorespiratory conditions and (ii glyceraldehyde-3-phosphate dehydrogenase and phosphoglycerate kinase can act as source of cytosolic ATP under decreased photorespiration. Under increasing light conditions we observed metabolic flexibility, involving photorespiration, chloroplastic triose phosphate and the dicarboxylate transporters of the chloroplast and mitochondrion for redox and ATP exchanges across the intracellular compartments. Simulations under different enzymatic cost conditions revealed (i participation of peroxisomal glutathione-ascorbate cycle in photorespiratory H2O2 metabolism (ii different modes of the chloroplastic triose phosphate transporters and malate valve, and (iii two possible modes of chloroplastic Glu–Gln transporter which were related with the activity of chloroplastic and cytosolic isoforms of glutamine synthetase. Altogether, our results provide new insights into plant metabolism.

Production of aerial biomass and equivalent land use in alfalfa (Medicago sativa L.) intercropping

International Nuclear Information System (INIS)

Pereyra, T. W.; Pagliaricci, H. R.; Ohanian, A. E.; Bonvillani, M. J.

2013-01-01

Productivity increase has traditionally been associated to yield increase through breeding and crop management practices. Nevertheless, if production is considered per area and time unit, the intercropping system may be another way to improve cost-effectiveness. The objective of the experiment was to determine the produced biomass and the equivalent land use in alfalfa (Medicago sativa L.) monocrop and intercrops with sorghum Sudan (Sorghum sudanense L.) and oat (Avena sativa L.). The aerial biomass of all the treatments (expressed per surface unit) and the equivalent land use were determined. The design was completely randomized, arranged in blocks with two repetitions. The results were subject to an ANAVA and the means were compared through Duncan's test, by means of the statistical pack INFOSTAT. The alfalfa-sorghum intercrop triplicated the alfalfa production with regards to the monocrop, while alfalfa-oat did not exceed the production of pure alfalfa in the winter months. The alfalfa-sorghum intercrop was 57 % more efficient in land use than the respective monocrops, while alfalfa-oat did not surpass the unit. (author)

Comprehensive phenotypic analysis of rice (Oryza sativa) response to salinity stress

KAUST Repository

Pires, Inês S.

2015-07-22

Increase in soil salinity levels is becoming a major cause of crop yield losses worldwide. Rice (Oryza sativa) is the most salt-sensitive cereal crop, and many studies have focused on rice salinity tolerance, but a global understanding of this crop\\'s response to salinity is still lacking. We systematically analyzed phenotypic data previously collected for 56 rice genotypes to assess the extent to which rice uses three known salinity tolerance mechanisms: shoot-ion independent tolerance (or osmotic tolerance), ion exclusion, and tissue tolerance. In general, our analyses of different phenotypic traits agree with results of previous rice salinity tolerance studies. However, we also established that the three salinity tolerance mechanisms mentioned earlier appear among rice genotypes and that none of them is predominant. Against the pervasive view in the literature that the K+/Na+ ratio is the most important trait in salinity tolerance, we found that the K+ concentration was not significantly affected by salt stress in rice, which puts in question the importance of K+/Na+ when analyzing rice salt stress response. Not only do our results contribute to improve our global understanding of salt stress response in an important crop, but we also use our results together with an extensive literature research to highlight some issues commonly observed in salinity stress tolerance studies and to propose solutions for future experiments.

Quantitative phosphoproteomic analysis of early seed development in rice (Oryza sativa L.).

Science.gov (United States)

Qiu, Jiehua; Hou, Yuxuan; Tong, Xiaohong; Wang, Yifeng; Lin, Haiyan; Liu, Qing; Zhang, Wen; Li, Zhiyong; Nallamilli, Babi R; Zhang, Jian

2016-02-01

Rice (Oryza sativa L.) seed serves as a major food source for over half of the global population. Though it has been long recognized that phosphorylation plays an essential role in rice seed development, the phosphorylation events and dynamics in this process remain largely unknown so far. Here, we report the first large scale identification of rice seed phosphoproteins and phosphosites by using a quantitative phosphoproteomic approach. Thorough proteomic studies in pistils and seeds at 3, 7 days after pollination resulted in the successful identification of 3885, 4313 and 4135 phosphopeptides respectively. A total of 2487 proteins were differentially phosphorylated among the three stages, including Kip related protein 1, Rice basic leucine zipper factor 1, Rice prolamin box binding factor and numerous other master regulators of rice seed development. Moreover, differentially phosphorylated proteins may be extensively involved in the biosynthesis and signaling pathways of phytohormones such as auxin, gibberellin, abscisic acid and brassinosteroid. Our results strongly indicated that protein phosphorylation is a key mechanism regulating cell proliferation and enlargement, phytohormone biosynthesis and signaling, grain filling and grain quality during rice seed development. Overall, the current study enhanced our understanding of the rice phosphoproteome and shed novel insight into the regulatory mechanism of rice seed development.

Role of hydroperoxide lyase in white-backed planthopper (Sogatella furcifera Horváth)-induced resistance to bacterial blight in rice, Oryza sativa L.

Science.gov (United States)

Gomi, Kenji; Satoh, Masaru; Ozawa, Rika; Shinonaga, Yumi; Sanada, Sachiyo; Sasaki, Katsutomo; Matsumura, Masaya; Ohashi, Yuko; Kanno, Hiroo; Akimitsu, Kazuya; Takabayashi, Junji

2010-01-01

A pre-infestation of the white-backed planthopper (WBPH), Sogatella furcifera Horváth, conferred resistance to bacterial blight caused by Xanthomonas oryzae pv. oryzae (Xoo) in rice (Oryza sativa L.) under both laboratory and field conditions. The infestation of another planthopper species, the brown planthopper (BPH) Nilaparvata lugens Stål, did not significantly reduce the incidence of bacterial blight symptoms. A large-scale screening using a rice DNA microarray and quantitative RT-PCR revealed that WBPH infestation caused the upregulation of more defence-related genes than did BPH infestation. Hydroperoxide lyase 2 (OsHPL2), an enzyme for producing C(6) volatiles, was upregulated by WBPH infestation, but not by BPH infestation. One C(6) volatile, (E)-2-hexenal, accumulated in rice after WBPH infestation, but not after BPH infestation. A direct application of (E)-2-hexenal to a liquid culture of Xoo inhibited the growth of the bacterium. Furthermore, a vapour treatment of rice plants with (E)-2-hexenal induced resistance to bacterial blight. OsHPL2-overexpressing transgenic rice plants exhibited increased resistance to bacterial blight. Based on these data, we conclude that OsHPL2 and its derived (E)-2-hexenal play some role in WBPH-induced resistance in rice.

Screening of gamma radiation-induced pathogen resistance rice lines against Xanthomonas oryzae pv. oryzae

Energy Technology Data Exchange (ETDEWEB)

Lim, Chan Ju; Lee, Ha Yeon; Kim, Woong Bom; Ahmad, Raza; Moon, Jae Sun; Kwon, Suk Yoon [Korea Research Institute of Beoscience and Biotechnology, Daejeon (Korea, Republic of); Kim, Dong Sub [Korea Atomic Energy Research Institute, Jeongeup (Korea, Republic of)

2010-09-15

Bacterial blight is one of the most serious diseases of rice (Oryza sativa L.), and it has been known that Xanthomonas oryzae pv. oryzae (Xoo) causes this disease symptom. To develop resistance rice cultivars against Xoo, 3,000 lines of M{sub 3}, which were irradiated with gamma ray, were tested by 'scissor-dip method' primarily, and 191 putative resistant lines were selected. In M{sub 4} generation, these lines were screened again with various ways such as measuring of symptom of bacterial blight in leaf, number of tiller, fresh weight, and phenotypic segregation ratio in next generation. Finally, six resistance lines were selected. RT-PCR analysis revealed that these lines displayed high level of R-genes such as Xa21, Pi36, and Pi-ta. These results indicate that mutations by gamma ray cause disruptions of regulatory signal transduction systems of these R-genes. Furthermore, these selected mutants could be useful for the development of rice cultivar resistant to Xoo.

Vinegar rice (Oryza sativa L. produced by a submerged fermentation process from alcoholic fermented rice

Directory of Open Access Journals (Sweden)

Wilma Aparecida Spinosa

2015-03-01

Full Text Available Considering the limited availability of technology for the production of rice vinegar and also due to the potential consumer product market, this study aimed to use alcoholic fermented rice (rice wine (Oryza sativa L. for vinegar production. An alcoholic solution with 6.28% (w/v ethanol was oxidized by a submerged fermentation process to produce vinegar. The process of acetic acid fermentation occurred at 30 ± 0.3°C in a FRINGS® Acetator (Germany for the production of vinegar and was followed through 10 cycles. The vinegar had a total acidity of 6.85% (w/v, 0.17% alcohol (w/v, 1.26% (w/v minerals and 1.78% (w/v dry extract. The composition of organic acids present in rice vinegar was: cis-aconitic acid (6 mg/L, maleic acid (3 mg/L, trans-aconitic acid (3 mg/L, shikimic + succinic acid (4 mg/L, lactic acid (300 mg/L, formic acid (180 mg/L, oxalic acid (3 mg/L, fumaric acid (3 mg/L and itaconic acid (1 mg/L.

Pengaruh Pemberian Kompos Jerami Dan Pupuk Sp-36 Pada Tanah Sulfat Masam Potensial Terhadap Perubahan Sifat Kimia Serta Pertumbuhan Dan Produksi Padi (Oryza Sativa L.)

OpenAIRE

Bhakari, Herlina Eka

2013-01-01

The objective of this research is to study the effect of rice straw compost and the application of phosphorus fertilizer of SP-36 on chemical characteristic of acid sulphate soils, rice growth and production (Oryza sativa L). This study used a randomized block design factorial, with 2 factors : factor 1 : rice straw compost treatment (J) wich consist of : J0 = 0 ton ha-1 (0 g straw/pot) ; J1 = 10 ton ha-1 (40 g straw/pot); J2 = 20 ton ha-1 (80 g straw /pot); J3 = 30 ton ha-1 ...

Effect of gamma-irradiated sludge on the growth and yield of rice (Oryza sativa L. var. GR-3)

International Nuclear Information System (INIS)

Pandya, G.A.; Prakash, L.; Devasia, Preston; Modi, V.V.

1988-01-01

The effects of gamma-irradiated sludge on the growth and yield of rice (Oryza sativa L. var. GR-3) in pot cultures have been studied. Compared to plants grown only in soil, shoot length, root length, fresh weight, dry weight, total proteins, total soluble sugars, starch and chlorophyll content of plants grown in soil supplemented with unirradiated or gamma-irradiated sludge were found to be significantly increased. Irradiation of sludge significantly stimulated the linear growth of shoot and root systems as well as fresh and dry weights of plants, compared to those grown in soil containing unirradiated sludge. There was also an improvement in the grain yield (weight of seed) when plants were grown in soil supplemented with irradiated sludge. The results obtained suggest that the gamma-irradiated sewage sludge can be beneficially recycled for agricultural uses. (author)

High Levels of Phytophenolics and Antioxidant Activities in Oryza ...

African Journals Online (AJOL)

Purpose: To investigate phenolic levels, phytophenolic profiles and total antioxidant activities of Oryza sativa, unpolished Thai rice. Methods: Unpolished Thai rice strains of Leum Phua, Klam, Hawm Nil and Black Rose were measured for antioxidant activity using 1,1-diphenyl-2-picrylhydrazyl (DPPH), ...

Gamma ray, EMS and sodium azide induced effectiveness and efficiency of chlorophyll mutations in basmati rice (Oryza sativa L.)

International Nuclear Information System (INIS)

Singh, Sanjeev; Singh, J.; Singh, R.K.

2001-01-01

The effectiveness and efficiency of gamma ray, EMS, sodium azide alone or in combination in relation to chlorophyll mutations in two varieties of Basmati rice (Oryza sativa L.) in M 2 generation were studied. The chlorophyll mutations were induced by all the doses of mutagens alone or in combination relatively at a fair frequency in both the varieties in M 2 generation. In general, it was found that combination treatments of gamma rays and EMS were observed to be more efficient in Taraori Basmati, while EMS alone and combination treatment of gamma rays and EMS were more efficient in Pusa Basmati 1 on sterility and growth injury basis both. Sodium azide at 0.5 mM was found as the most effective dose in both Taraori Basmati and Pusa Basmati 1 cultivars. (author)

Biochemical and structural properties of cyanases from Arabidopsis thaliana and Oryza sativa.

Directory of Open Access Journals (Sweden)

Dan Qian

Full Text Available Cyanate is toxic to all organisms. Cyanase converts cyanate to CO₂ and NH₃ in a bicarbonate-dependent reaction. The biophysical functions and biochemical characteristics of plant cyanases are poorly studied, although it has been investigated in a variety of proteobacteria, cyanobacteria and fungi. In this study, we characterised plant cyanases from Arabidopsis thaliana and Oryza sativa (AtCYN and OsCYN. Prokaryotic-expressed AtCYN and OsCYN both showed cyanase activity in vitro. Temperature had a similar influence on the activity of both cyanases, but pH had a differential impact on AtCYN and OsCYN activity. Homology modelling provided models of monomers of AtCYN and OsCYN, and a coimmunoprecipitation assay and gel filtration indicated that AtCYN and OsCYN formed homodecamers. The analysis of single-residue mutants of AtCYN indicated that the conserved catalytic residues also contributed to the stability of the homodecamer. KCNO treatment inhibited Arabidopsis germination and early seedling growth. Plants containing AtCYN or OsCYN exhibited resistance to KCNO stress, which demonstrated that one role of cyanases in plants is detoxification. Transcription level of AtCYN was higher in the flower than in other organs of Arabidopsis. AtCYN transcription was not significantly affected by KCNO treatment in Arabidopsis, but was induced by salt stress. This research broadens our knowledge on plant detoxification of cyanate via cyanase.

A study of technetium 99 uptake by irrigated rice (Oryza sativa L.)

International Nuclear Information System (INIS)

Vandecasteele, C.M.; De Becker, R.; Tang Van Hai; Myttenaere, C.

1983-01-01

The absorption of technetium 99 (an important fission product which can be released in the environment at different steps of the nuclear fuel cycle) by rice (Oryza sativa L.) was studied in nutrient solutions and in flooded soils with contaminated water. The absorption kinetics established in water culture (continuous flowing system) for 99 Tc concentrations ranging from 0.017 to 17 μCi.I - 1 revealed two phases: the former corresponds to the diffusion in the apparent free spaces and the second, which is linear, represents the transfer of 99 Tc from the external medium into the root cells as well as its translocation to the leaves. The study of the desorption mechanism confirmed the existence of these compartments, the second one containing more than 95% of the total activity of the plant. The biological half-life of 99 Tc of the second compartment is so high that decontamination of the plant may not be expected. In soils, toxicity symptoms were observed for a 99 Tc water concentration of 17 μCi.I - 1 . The transfer factors calculated in irrigated soils are very high (>10 3 for the leafy shoots) and the distribution of 99 Tc between the different organs waries with the concentration used. More than 90% of 99 Tc is found in the leafy shoots meanwhile 1% of the plant total activity is only found in the caryopses [fr

Genetic diversity in Oryza glumaepatula wild rice populations in Costa Rica and possible gene flow from O. sativa.

Science.gov (United States)

Fuchs, Eric J; Meneses Martínez, Allan; Calvo, Amanda; Muñoz, Melania; Arrieta-Espinoza, Griselda

2016-01-01

Wild crop relatives are an important source of genetic diversity for crop improvement. Diversity estimates are generally lacking for many wild crop relatives. The objective of the present study was to analyze how genetic diversity is distributed within and among populations of the wild rice species Oryza glumaepatula in Costa Rica. We also evaluated the likelihood of gene flow between wild and commercial rice species because the latter is commonly sympatric with wild rice populations. Introgression may change wild species by incorporating alleles from domesticated species, increasing the risk of losing original variation. Specimens from all known O. glumaepatula populations in Costa Rica were analyzed with 444 AFLP markers to characterize genetic diversity and structure. We also compared genetic diversity estimates between O. glumaepatula specimens and O. sativa commercial rice. Our results showed that O. glumaepatula populations in Costa Rica have moderately high levels of genetic diversity, comparable to those found in South American populations. Despite the restricted distribution of this species in Costa Rica, populations are fairly large, reducing the effects of drift on genetic diversity. We found a dismissible but significant structure (θ = 0.02 ± 0.001) among populations. A Bayesian structure analysis suggested that some individuals share a significant proportion of their genomes with O. sativa. These results suggest that gene flow from cultivated O. sativa populations may have occurred in the recent past. These results expose an important biohazard: recurrent hybridization may reduce the genetic diversity of this wild rice species. Introgression may transfer commercial traits into O. glumaepatula, which in turn could alter genetic diversity and increase the likelihood of local extinction. These results have important implications for in situ conservation strategies of the only wild populations of O. glumaepatula in Costa Rica.

Ectopic expression of a vesicle trafficking gene, OsRab7, from Oryza ...

African Journals Online (AJOL)

Jane

2011-07-18

Jul 18, 2011 ... OsRab7, from Oryza sativa, confers tolerance to several ... Key Laboratory of Molecular Biology and Gene Engineering, College of Life Science, Nanchang University, ... The reverse transcription was performed using MMLV.

In-silico analysis of cis-acting regulatory elements of pathogenesis-related proteins of Arabidopsis thaliana and Oryza sativa.

Science.gov (United States)

Kaur, Amritpreet; Pati, Pratap Kumar; Pati, Aparna Maitra; Nagpal, Avinash Kaur

2017-01-01

Pathogenesis related (PR) proteins are low molecular weight family of proteins induced in plants under various biotic and abiotic stresses. They play an important role in plant-defense mechanism. PRs have wide range of functions, acting as hydrolases, peroxidases, chitinases, anti-fungal, protease inhibitors etc. In the present study, an attempt has been made to analyze promoter regions of PR1, PR2, PR5, PR9, PR10 and PR12 of Arabidopsis thaliana and Oryza sativa. Analysis of cis-element distribution revealed the functional multiplicity of PRs and provides insight into the gene regulation. CpG islands are observed only in rice PRs, which indicates that monocot genome contains more GC rich motifs than dicots. Tandem repeats were also observed in 5' UTR of PR genes. Thus, the present study provides an understanding of regulation of PR genes and their versatile roles in plants.

The buffering capacity of stems: genetic architecture of nonstructural carbohydrates in cultivated Asian rice, Oryza sativa.

Science.gov (United States)

Wang, Diane R; Han, Rongkui; Wolfrum, Edward J; McCouch, Susan R

2017-07-01

Harnessing stem carbohydrate dynamics in grasses offers an opportunity to help meet future demands for plant-based food, fiber and fuel production, but requires a greater understanding of the genetic controls that govern the synthesis, interconversion and transport of such energy reserves. We map out a blueprint of the genetic architecture of rice (Oryza sativa) stem nonstructural carbohydrates (NSC) at two critical developmental time-points using a subpopulation-specific genome-wide association approach on two diverse germplasm panels followed by quantitative trait loci (QTL) mapping in a biparental population. Overall, 26 QTL are identified; three are detected in multiple panels and are associated with starch-at-maturity, sucrose-at-maturity and NSC-at-heading. They tag OsHXK6 (rice hexokinase), ISA2 (rice isoamylase) and a tandem array of sugar transporters. This study provides the foundation for more in-depth molecular investigation to validate candidate genes underlying rice stem NSC and informs future comparative studies in other agronomically vital grass species. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.

Genetic analysis of a hybrid sterility gene that causes both pollen and embryo sac sterility in hybrids between Oryza sativa L. and Oryza longistaminata.

Science.gov (United States)

Chen, H; Zhao, Z; Liu, L; Kong, W; Lin, Y; You, S; Bai, W; Xiao, Y; Zheng, H; Jiang, L; Li, J; Zhou, J; Tao, D; Wan, J

2017-09-01

Oryza longistaminata originates from African wild rice and contains valuable traits conferring tolerance to biotic and abiotic stress. However, interspecific crosses between O. longistaminata and Oryza sativa cultivars are hindered by reproductive barriers. To dissect the mechanism of interspecific hybrid sterility, we developed a near-isogenic line (NIL) using indica variety RD23 as the recipient parent and O. longistaminata as the donor parent. Both pollen and embryo sac semi-sterility were observed in F 1 hybrids between RD23 and NIL. Cytological analysis demonstrated that pollen abortion in F 1 hybrids occurred at the early bi-nucleate stage due to a failure of the first mitosis in microspores. Partial embryo sacs in the F 1 hybrids were defective during the functional megaspore formation stage. Most notably, nearly half of the male or female gametes were aborted in heterozygotes S40 i S40 l , regardless of their genotypes. Thus, S40 was indicated as a one-locus sporophytic sterility gene controlling both male and female fertility in hybrids between RD23 and O. longistaminata. A population of 16 802 plants derived from the hybrid RD23/NIL-S40 was developed to fine-map S40. Finally, the S40 locus was delimited to an 80-kb region on the short arm of chromosome 1 in terms with reference sequences of cv. 93-11. Eight open reading frames (ORFs) were localized in this region. On the basis of gene expression and genomic sequence analysis, ORF5 and ORF8 were identified as candidate genes for the S40 locus. These results are helpful in cloning the S40 gene and marker-assisted transferring of the corresponding neutral allele in rice breeding programs.

Minerales, Ácido Fítico y γ-Oryzanol en harinas integrales y salvados de tres variedades de arroz (Oryza Sativa L) cultivadas en Venezuela

OpenAIRE

Aguilar-García, Carlos; Hevia, Patricio; Núnez, Máryuri

2014-01-01

El propósito de esta investigación fue determinar el contenido de algunos minerales, de ácido fítico y de γ-oryzanol en harinas integrales y salvados de tres cultivares (Cimarrón, Fonaiap 1 y Zeta 15) de arroz (Oryza sativa L) cosechados en Venezuela. Los minerales (Ca, Mg, Fe y Zn) fueron cuantificados por espectrofotometría de absorción atómica, mientras que el fósforo (P) y el ácido fítico fueron estimados a través de un método colorimétrico. El γ-oryzanol se cuantificó por HPLC. En genera...

Genetic diversity analysis of Cuban traditional rice (Oryza sativa L. varieties based on microsatellite markers

Directory of Open Access Journals (Sweden)

Alba Alvarez

2007-01-01

Full Text Available Microsatellite polymorphism was studied in a sample of 39 traditional rice (Oryza sativa L. varieties and 11 improved varieties widely planted in Cuba. The study was aimed at assessing the extent of genetic variation in traditional and improved varieties and to establish their genetic relationship for breeding purposes. Heterozygosity was analyzed at each microsatellite loci and for each genotype using 10 microsatellite primer pairs. Between varieties genetic relationship was estimated. The number of alleles per microsatellite loci was 4 to 8, averaging 6.6 alleles per locus. Higher heterozygosity (H was found in traditional varieties (H TV = 0.72 than in improved varieties (H IV = 0.42, and 68% of the total microsatellite alleles were found exclusively in the traditional varieties. Genetic diversity, represented by cluster analysis, indicated three different genetic groups based on their origin. Genetic relationship estimates based on the proportion of microsatellite loci with shared alleles indicated that the majority of traditional varieties were poorly related to the improved varieties. We also discuss the more efficient use of the available genetic diversity in future programs involving genetic crosses.

Arsenic uptake and accumulation in rice (Oryza sativa L.) with selenite fertilization and water management.

Science.gov (United States)

Wan, Yanan; Camara, Aboubacar Younoussa; Huang, Qingqing; Yu, Yao; Wang, Qi; Li, Huafen

2018-07-30

The accumulation of arsenic (As) in rice grain is a potential threat to human health. Our study investigated the possible mediatory role of selenite fertilization on As uptake and accumulation by rice (Oryza sativa L.) under different water management regimes (aerobic or flooded) in a pot experiment. Soil solutions were also extracted during the growing season to monitor As dynamics. Results showed that As contents in the soil solutions, seedlings, and mature rice were higher under flooded than under aerobic water management. Under aerobic conditions, selenite additions slightly increased As concentrations in soil solutions (in the last two samplings), but decreased As levels in rice plants. Relative to the control, 0.5 mg kg -1 selenite decreased rice grain As by 27.5%. Under flooded conditions, however, selenite additions decreased As in soil solutions, while increased As in rice grain. Tendencies also showed that selenite additions decreased the proportion of As in rice shoots both at the seedling stage and maturity, and were more effective in aerobic soil. Our results demonstrate that the effect of selenite fertilizer on As accumulation by rice is related to water management. Copyright © 2018 Elsevier Inc. All rights reserved.

QTL detection and elite alleles mining for stigma traits in Oryza sativa by association mapping

Directory of Open Access Journals (Sweden)

Xiaojing Dang

2016-08-01

Full Text Available Stigma traits are very important for hybrid seed production in Oryza sativa, which is a self-pollinated crop; however, the genetic mechanism controlling the traits is poorly understood. In this study, we investigated the phenotypic data of 227 accessions across two years and assessed their genotypic variation with 249 simple sequence repeat (SSR markers. By combining phenotypic and genotypic data, a genome-wide association (GWA map was generated. Large phenotypic variations in stigma length (STL, stigma brush-shaped part length (SBPL and stigma non-brush-shaped part length (SNBPL were found. Significant positive correlations were identified among stigma traits. In total, 2,072 alleles were detected among 227 accessions, with an average of 8.3 alleles per SSR locus. GWA mapping detected 6 quantitative trait loci (QTLs for the STL, 2 QTLs for the SBPL and 7 QTLs for the SNBPL. Eleven, 5, and 12 elite alleles were found for the STL, SBPL and SNBPL, respectively. Optimal cross designs were predicted for improving the target traits. The detected genetic variation in stigma traits and QTLs provides helpful information for cloning candidate STL genes and breeding rice cultivars with longer STLs in the future.

An improved Agrobacterium-mediated transformation of recalcitrant indica rice (Oryza sativa L.) cultivars.

Science.gov (United States)

Shri, Manju; Rai, Arti; Verma, Pankaj Kumar; Misra, Prashant; Dubey, Sonali; Kumar, Smita; Verma, Sikha; Gautam, Neelam; Tripathi, Rudra Deo; Trivedi, Prabodh Kumar; Chakrabarty, Debasis

2013-04-01

Agrobacterium-mediated transformation of indica rice varieties has been quite difficult as these are recalcitrant to in vitro responses. In the present study, we established a high-efficiency Agrobacterium tumefaciens-mediated transformation system of rice (Oryza sativa L. ssp. indica) cv. IR-64, Lalat, and IET-4786. Agrobacterium strain EHA-101 harboring binary vector pIG121-Hm, containing a gene encoding for β-glucuronidase (GUS) and hygromycin resistance, was used in the transformation experiments. Manipulation of different concentrations of acetosyringone, days of co-culture period, bacterial suspension of different optical densities (ODs), and the concentrations of L-cysteine in liquid followed by solid co-culture medium was done for establishing the protocol. Among the different co-culture periods, 5 days of co-culture with bacterial cells (OD600 nm = 0.5-0.8) promoted the highest frequency of transformation (83.04 %) in medium containing L-cysteine (400 mg l(-1)). Putative transformed plants were analyzed for the presence of a transgene through genomic PCR and GUS histochemical analyses. Our results also suggest that different cultural conditions and the addition of L-cysteine in the co-culture medium improve the Agrobacterium-mediated transformation frequencies from an average of 12.82 % to 33.33 % in different indica rice cultivars.

The relationship between vacuolation and initiation of PCD in rice (Oryza sativa) aleurone cells

Science.gov (United States)

Zheng, Yan; Zhang, Heting; Deng, Xiaojiang; Liu, Jing; Chen, Huiping

2017-01-01

Vacuole fusion is a necessary process for the establishment of a large central vacuole, which is the central location of various hydrolytic enzymes and other factors involved in death at the beginning of plant programmed cell death (PCD). In our report, the fusion of vacuoles has been presented in two ways: i) small vacuoles coalesce to form larger vacuoles through membrane fusion, and ii) larger vacuoles combine with small vacuoles when small vacuoles embed into larger vacuoles. Regardless of how fusion occurs, a large central vacuole is formed in rice (Oryza sativa) aleurone cells. Along with the development of vacuolation, the rupture of the large central vacuole leads to the loss of the intact plasma membrane and the degradation of the nucleus, resulting in cell death. Stabilizing or disrupting the structure of actin filaments (AFs) inhibits or promotes the fusion of vacuoles, which delays or induces PCD. In addition, the inhibitors of the vacuolar processing enzyme (VPE) and cathepsin B (CathB) block the occurrence of the large central vacuole and delay the progression of PCD in rice aleurone layers. Overall, our findings provide further evidence for the rupture of the large central vacuole triggering the PCD in aleruone layers.

Cis-regulatory signatures of orthologous stress-associated bZIP transcription factors from rice, sorghum and Arabidopsis based on phylogenetic footprints

Directory of Open Access Journals (Sweden)

Xu Fuyu

2012-09-01

Full Text Available Abstract Background The potential contribution of upstream sequence variation to the unique features of orthologous genes is just beginning to be unraveled. A core subset of stress-associated bZIP transcription factors from rice (Oryza sativa formed ten clusters of orthologous groups (COG with genes from the monocot sorghum (Sorghum bicolor and dicot Arabidopsis (Arabidopsis thaliana. The total cis-regulatory information content of each stress-associated COG was examined by phylogenetic footprinting to reveal ortholog-specific, lineage-specific and species-specific conservation patterns. Results The most apparent pattern observed was the occurrence of spatially conserved ‘core modules’ among the COGs but not among paralogs. These core modules are comprised of various combinations of two to four putative transcription factor binding site (TFBS classes associated with either developmental or stress-related functions. Outside the core modules are specific stress (ABA, oxidative, abiotic, biotic or organ-associated signals, which may be functioning as ‘regulatory fine-tuners’ and further define lineage-specific and species-specific cis-regulatory signatures. Orthologous monocot and dicot promoters have distinct TFBS classes involved in disease and oxidative-regulated expression, while the orthologous rice and sorghum promoters have distinct combinations of root-specific signals, a pattern that is not particularly conserved in Arabidopsis. Conclusions Patterns of cis-regulatory conservation imply that each ortholog has distinct signatures, further suggesting that they are potentially unique in a regulatory context despite the presumed conservation of broad biological function during speciation. Based on the observed patterns of conservation, we postulate that core modules are likely primary determinants of basal developmental programming, which may be integrated with and further elaborated by additional intrinsic or extrinsic signals in

Arsenic accumulation and phosphorus status in two rice (Oryza sativa L.) cultivars surveyed from fields in South China

International Nuclear Information System (INIS)

Lu Ying; Dong, Fei; Deacon, Claire; Chen Huojun; Raab, Andrea; Meharg, Andrew A.

2010-01-01

The consumption of paddy rice (Oryza sativa L.) is a major inorganic arsenic exposure pathway in S.E. Asia. A multi-location survey was undertaken in Guangdong Province, South China to assess arsenic accumulation and speciation in 2 rice cultivars, one an Indica and the other a hybrid Indica. The results showed that arsenic concentrations in rice tissue increased in the order grain < husk < straw < root. Rice grain arsenic content of 2 rice cultivars was significant different and correlated with phosphorus concentration and molar ratio of P/As in shoot, being higher for the Indica cultivar than for the hybrid Indica, which suggests altering shoot phosphorus status as a promising route for breeding rice cultivars with reduced grain arsenic. Speciation of grain arsenic, performed using HPLC-ICP-MS, identified inorganic arsenic as the dominant arsenic species present in the rice grain. - Altering rice shoot phosphorus status is a promising route for breeding rice cultivars with reduced grain arsenic.

OPTIMASI SUHU REAKSI TRANSESTERIFIKASI PADA MINYAK JERAMI PADI (ORYZA SATIVA L. MENJADI BIODIESEL DENGAN MENGGUNAKAN KATALIS CAO DARI KULIT TELUR AYAM

Directory of Open Access Journals (Sweden)

Tasik Sinta

2016-11-01

Full Text Available The research on optimization of transesterification temperature for production of biodiesel from rice straw oil (Oryza sativa L. using CaO catalyst derived from the chicken egg skin has been conducted. Production of biodiesel was conducted at varied temperatures, namely 30oC, 40oC, 50oC, 60oC and 70oC. The fatty acid compositions of the transesterification products were determined by using GC-MS and the physical and chemical characteristics were determined using SNI Methods 04-7182-2006. The AAS result suggested that the chicken egg skin contained 91.41% CaO. The optimum transesterification temperature was 60oC producing 90,8405% methyl ester. The results of GC-MS showed that the highest percentage of fatty acid was methyl oleic (44.56%.

Xanthomonas oryzae pv oryzae the Causal Agent of Bacterial Leaf Blight of rice: Isolation, Characterization, and Study of Transposon Mutagenesis

Directory of Open Access Journals (Sweden)

Abdjad Asih Nawangsih

2011-04-01

Full Text Available Xanthomonas oryzae pv oryzae the Causal Agent of Bacterial Leaf Blight of rice: Isolation, Characterization, and Study of Transposon Mutagenesis. X. oryzae pv. oryzae (Xoo causes bacterial leaf blight (BLB of rice (Oryza sativa L., a major disease that constrains production of the staple crop in many countries of the world. Identification of X. oryzae pv. oryzae (Xoo was conducted based on the disease symptoms, pathogenicity, morphological, physiological, and genetic characteristics of bacterial cultures isolated from the infected plants. Fifty bacterial isolates predicted as Xoo have been successfully isolated. They are aerobic, rod shaped, and Gram negative bacteria. The isolates were evaluated for their hypersensitivity in tobacco and pathogenicity in rice plant. Fifty isolates induced hypersensitive reaction in tobacco and showed pathogenicity symptom in rice in different length. Based on physiological test, hypersensitivity and pathogenicity reactions, three bacterial isolates strongly predicted as Xoo, i.e. STG21, STG42, and STG46, were non indole formation, non pigment fluorescent, hydrolyzed casein, catalase activity positive, but negative oxidase. Partial sequencing of 16S rRNA genes of STG21 and STG42 showed 80% and 82% homology with X. oryzae, respectively, while STG46 showed 84% homology with X. campestris. Mini-Tn5 transposon mutagenesis of STG21 generated one of the mutants (M5 lossed it’s ability to induce hypersensitive reaction in tobacco plant and deficient in pathogenicity on rice. The lesion length of rice leaf caused by the mutant M5 decreased up to 80%.

Two solanesyl diphosphate synthases with different subcellular localizations and their respective physiological roles in Oryza sativa.

Science.gov (United States)

Ohara, Kazuaki; Sasaki, Kanako; Yazaki, Kazufumi

2010-06-01

Long chain prenyl diphosphates are crucial biosynthetic precursors of ubiquinone (UQ) in many organisms, ranging from bacteria to humans, as well as precursors of plastoquinone in photosynthetic organisms. The cloning and characterization of two solanesyl diphosphate synthase genes, OsSPS1 and OsSPS2, in Oryza sativa is reported here. OsSPS1 was highly expressed in root tissue whereas OsSPS2 was found to be high in both leaves and roots. Enzymatic characterization using recombinant proteins showed that both OsSPS1 and OsSPS2 could produce solanesyl diphosphates as their final product, while OsSPS1 showed stronger activity than OsSPS2. However, an important biological difference was observed between the two genes: OsSPS1 complemented the yeast coq1 disruptant, which does not form UQ, whereas OsSPS2 only very weakly complemented the growth defect of the coq1 mutant. HPLC analyses showed that both OsSPS1 and OsSPS2 yeast transformants produced UQ9 instead of UQ6, which is the native yeast UQ. According to the complementation study, the UQ9 levels in OsSPS2 transformants were much lower than that of OsSPS1. Green fluorescent protein fusion analyses showed that OsSPS1 localized to mitochondria, while OsSPS2 localized to plastids. This suggests that OsSPS1 is involved in the supply of solanesyl diphosphate for ubiquinone-9 biosynthesis in mitochondria, whereas OsSPS2 is involved in providing solanesyl diphosphate for plastoquinone-9 formation. These findings indicate that O. sativa has a different mechanism for the supply of isoprenoid precursors in UQ biosynthesis from Arabidopsis thaliana, in which SPS1 provides a prenyl moiety for UQ9 at the endoplasmic reticulum.

Mapping of Novel QTL Regulating Grain Shattering Using Doubled Haploid Population in Rice (Oryza sativa L.

Directory of Open Access Journals (Sweden)

Gyu-Ho Lee

2016-01-01

Full Text Available The critical evolutionary step during domestication of major cereals was elimination of seed shattering because the easy-to-shatter trait in wild relatives results in a severe reduction in yield. In this study, we analyzed the QTLs associated with shattering employing a high-density genetic map in doubled haploid (DH population of rice (Oryza sativa L.. A genetic linkage map was generated with 217 microsatellite markers spanning 2082.4 cM and covering 12 rice chromosomes with an average interval of 9.6 cM between markers based on 120 DHLs derived from a cross between Cheongcheong indica type cultivar and Nagdong japonica type cultivar. In the QTL analysis, five QTLs pertaining to the breaking tensile strength (BTS were detected in 2013 and 2015. Two regions of the QTLs related to BTS on chromosome 1 and chromosome 6 were detected. Several important genes are distributed in 1 Mbp region of the QTL on chromosome 6 and they are related to the formation of abscission layer. We decide to name this QTL qSh6 and the candidate genes in the qSh6 region can be employed usefully in further research for cloning.

Geographic authentication of Asian rice (Oryza sativa L.) using multi-elemental and stable isotopic data combined with multivariate analysis.

Science.gov (United States)

Chung, Ill-Min; Kim, Jae-Kwang; Lee, Kyoung-Jin; Park, Sung-Kyu; Lee, Ji-Hee; Son, Na-Young; Jin, Yong-Ik; Kim, Seung-Hyun

2018-02-01

Rice (Oryza sativa L.) is the world's third largest food crop after wheat and corn. Geographic authentication of rice has recently emerged asan important issue for enhancing human health via food safety and quality assurance. Here, we aimed to discriminate rice of six Asian countries through geographic authentication using combinations of elemental/isotopic composition analysis and chemometric techniques. Principal components analysis could distinguish samples cultivated from most countries, except for those cultivated in the Philippines and Japan. Furthermore, orthogonal projection to latent structure-discriminant analysis provided clear discrimination between rice cultivated in Korea and other countries. The major common variables responsible for differentiation in these models were δ 34 S, Mn, and Mg. Our findings contribute to understanding the variations of elemental and isotopic compositions in rice depending on geographic origins, and offer valuable insight into the control of fraudulent labeling regarding the geographic origins of rice traded among Asian countries. Copyright © 2017 Elsevier Ltd. All rights reserved.

Refino de óleo de farelo de arroz (Oryza sativa L. em condições brandas para preservação do γ-orizanol Refining of rice bran oil (Oryza sativa L. to preserve γ-orizanol

Directory of Open Access Journals (Sweden)

Luz Maria Paucar-Menacho

2007-08-01

Full Text Available O γ-orizanol é um antioxidante presente no óleo de farelo de arroz, mas ausente em outros óleos vegetais, ao qual têm sido atribuídos efeitos antioxidante e hipocolesterolêmico. O conteúdo de γ-orizanol no óleo de farelo de arroz bruto varia entre 1-2%, mas durante a etapa de neutralização do refino químico, este composto fica retido na borra. O presente trabalho teve por objetivo propor uma técnica alternativa de refino físico em condições brandas para o óleo de farelo de arroz com a finalidade de preservar o γ-orizanol. Utilizou-se farelo de arroz inativado e extrusado obtido a partir do processo de produção do arroz parboilizado, sendo o óleo bruto (Oryza sativa extraído pelo método de expeller. O processo de refino do óleo bruto consistiu nas etapas de degomagem ácida (com H3PO4 85%, centrifugação, clarificação, desodorização a 180 ºC e winterização. Foram realizadas análises para caracterização e comparação do óleo bruto e refinado, seguindo metodologias oficiais da AOCS. Concluiu-se que o processo de refino físico preservou 97% do γ-orizanol, o qual potencializou a estabilidade oxidativa do óleo refinado pelo método alternativo, que apresentou uma melhoria de 33% (13,3 horas a 110 ºC do período de indução da oxidação em relação ao óleo comercial.γ-orizanol is an antioxidant present in rice bran oil, but absent in other vegetable oils, which were attributed to antioxidant and hypocholesterolemic effects. The content of γ-orizanol in crude rice bran oil varies between 1-2%, but during neutralization in chemical refining this substance is transferred to soapstock. The aim of this research is to study an alternative technique of physical refining in light conditions with the purpose of preserving γ-orizanol. Inativacted and extrused rice bran obtained by the production of parboilizated rice was used to extract crude rice bran oil (Oryza sativa by the expeller method. The process of

The Role of Node Restriction on Cadmium Accumulation in the Brown Rice of 12 Chinese Rice (Oryza sativa L.) Cultivars.

Science.gov (United States)

Huang, Gaoxiang; Ding, Changfeng; Guo, Fuyu; Li, Xiaogang; Zhou, Zhigao; Zhang, Taolin; Wang, Xingxiang

2017-11-29

For selection or breeding of rice (Oryza sativa L.) cultivars with low Cd affinity, the role of node Cd restriction on Cd accumulation in brown rice was studied. A pot experiment was conducted to investigate the concentration of Cd in different sections of 12 Chinese rice cultivars. The results indicated that the Cd accumulation in the brown rice was mainly dependent on the root or shoot Cd concentration. Among the cultivars with nearly equal shoot Cd concentrations, Cd accumulation in brown rice was mainly dependent on the transport of Cd in the shoot. However, the Cd transport in the shoot was significantly restricted by the nodes, especially by the first node. Furthermore, the area of the diffuse vascular bundle in the junctional region of the flag leaf and the first node was a key contributor to the variations in Cd restriction by the nodes.

Influence of Rapeseed Cake on Iron Plaque Formation and Cd Uptake by Rice (Oryza sativa L.) Seedlings Exposed to Excess Cd.

Science.gov (United States)

Yang, Wen-Tao; Zhou, Hang; Gu, Jiao-Feng; Zeng, Qing-Ru; Liao, Bo-Han

2017-11-01

A soil spiking experiment at two Cd levels (0.72 and 5.20 mg kg -1 ) was conducted to investigate the effects of rapeseed cake (RSC) at application rates of 0%, 0.75%, 1.5%, and 3.0% (w/w) on iron plaque formation and Cd uptake by rice (Oryza sativa L.) seedlings. The use of RSC did result in a sharp decrease in soil bioavailability of Cd and a significant increase in rice growth, soil pH and organic matter. Application of RSC increased the amount of iron plaque formation and this effectively inhibited the uptake and translocation of Cd into the rice seedlings. RSC was an effective organic additive for increasing rice growth and reducing Cd uptake by rice plant, simultaneously. These results could be used as a reference for the safety use of Cd polluted paddy soil.

Potential of Anti Breast Cancer Black Ethanol Rice Extract (Oryza sativa L. indica In Decreasing Levels of CA 15-3 Serum in the White Mice Sprague dawley in Induction 7.12-Dimethylbenz (α Antracene (DMBA and Estrogen

Directory of Open Access Journals (Sweden)

Zanuar Abidin

2017-01-01

Full Text Available Breast cancer is cancer that has the high incidence in Indonesia. Black rice (Oryza sativa L. indica is a plant that has an anticancer potency. This research aim is to prove black rice as a potential anticancer by using experimental animals, 20 Sprague Dawley female rats aged 7-8 weeks induced breast cancer by using the combination of 7,12-dimethylbenz (α anthracene (DMBA and estrogen. Rats were divided into two groups, namely the K-induced breast cancer and a group of P-induced cancer and treated with black rice. Black rice is given in the form of ethanol extract at a dose of 75 mg / kg / day for six weeks. Levels of CA 15-3 serum are used as a parameter. The result showed that the differences in levels of serum CA 15-3 are significant (p <0.05. Serum CA 15-3 level in P group is lower than in K group. This study proved that the ethanol extract of black rice (Oryza sativa L. indica has potential as an anticancer breast as indicated by decreased level of serum CA 15-3

Hybrid Weakness Found in the Backcross Progeny of an Inter-Specific Cross of Oryza Sativa / O. Glumaepatula

Directory of Open Access Journals (Sweden)

Sobrizal

2009-01-01

Full Text Available Hybrid breakdown expressed as sterility or weakness or both in F2 or later generations is considered to be a reproductive barrier between two distantly related taxa. Hybrid breakdown that showed poor growth habit with fertile seeds was found in the backcross progenies (BC4F2 which were derived from a cross between a cultivated rice Oryza sativa L. cv. Taichung 65 and a wild rice Oryza glumaepatula Steud (Acc. IRGC 105668 where Taichung 65 was used as a recurrent parent. Through segregation analysis of BC4F2 population, a novel gene for weakness was identified, and this gene was designated as hwf1 (hybrid weakness f-1. RFLP (Restriction Fragment Length Polymorphism analysis was employed to determine the chromosomal location of hwf1 gene. The result revealed that hwf1 was located between G3006 and C933 RFLP markers, with map distances of 0.5 cM and 1.9 cM, respectively, and co-segregated with C708, C820, and R288 on the short arm of chromosome 4. Since both O. glumaepatula (Acc. IRGC 105668 and Taichung 65 that was used as parents showed normal growth habit, the weakness in this study was assumed to be controlled by a set of complementary recessive genes. One of the complementary genes is hwf1 from O. glumaepatula, and another gene should be from Taichung 65, because the genetic background of the BC4F2 populations that were used for analysis is Taichung 65. The gene from Taichung 65 has not been identified yet, therefore, it is necessary to conduct the experiment for finding out the complement of hwf1 gene in near future.

Hybrid Weakness Found In the Backcross Progeny of an Inter-Specific Cross of Oryza Sativa / O. Glumaepatula

International Nuclear Information System (INIS)

Sobrizal; Yoshimura, A

2009-01-01

Hybrid breakdown expressed as sterility or weakness or both in F 2 or later generations is considered to be a reproductive barrier between two distantly related taxa. Hybrid breakdown that showed poor growth habit with fertile seeds was found in the backcross progenies (BC 4 F 2 ) which were derived from a cross between a cultivated rice Oryza sativa L. cv. Taichung 65 and a wild rice Oryza glumaepatula Steud (Acc. IRGC 105668) where Taichung 65 was used as a recurrent parent. Through segregation analysis of BC 4 F 2 population, a novel gene for weakness was identified, and this gene was designated as hwf1 (hybrid weakness f-1). RFLP (Restriction Fragment Length Polymorphism) analysis was employed to determine the chromosomal location of hwf1 gene. The result revealed that hwf1 was located between G3006 and C933 RFLP markers, with map distances of 0.5 cM and 1.9 cM, respectively, and co-segregated with C708, C820, and R288 on the short arm of chromosome 4. Since both O. glumaepatula (Acc. IRGC 105668) and Taichung 65 that was used as parents showed normal growth habit, the weakness in this study was assumed to be controlled by a set of complementary recessive genes. One of the complementary genes is hwf1 from O. glumaepatula, and another gene should be from Taichung 65, because the genetic background of the BC 4 F 2 populations that were used for analysis is Taichung 65. The gene from Taichung 65 has not been identified yet, therefore, it is necessary to conduct the experiment for finding out the complement of hwf1 gene in near future. (author)

Genetic diversity associated with conservation of endangered Dongxiang wild rice (Oryza rufipogon)

Science.gov (United States)

The wild progenitor species (Oryza rufipogon) of Asian cultivated rice (O. sativa) is located in Dongxiang county, China where it is considered the northernmost range worldwide. Nine ex situ and three in situ populations of the Dongxiang wild rice (DXWR) and four groups of modern cultivars were geno...

Silicon alleviates simulated acid rain stress of Oryza sativa L. seedlings by adjusting physiology activity and mineral nutrients.

Science.gov (United States)

Ju, Shuming; Wang, Liping; Yin, Ningning; Li, Dan; Wang, Yukun; Zhang, Cuiying

2017-11-01

Silicon (Si) has been a modulator in plants under abiotic stresses, such as acid rain. To understand how silicon made an effect on rice (Oryza sativa L.) exposed to simulated acid rain (SAR) stress, the growth, physiologic activity, and mineral nutrient content in leaves of rice were investigated. The results showed that combined treatments with Si (1.0, 2.0, or 4.0 mM) and SAR (pH 4.0, 3.0, or 2.0) obviously improved the rice growth compared with the single treatment with SAR. Incorporation of Si into SAR treatment decreased malondialdehyde (MDA) content; increased soluble protein and proline contents; promoted CAT, POD, SOD, and APX activity; and maintained the K, Ca, Mg, Fe, Zn, Cu content balance in leaves of rice seedlings under SAR stress. The moderate concentration of Si (2.0 mM) was better than the low and high concentration of Si (1.0 and 4.0 mM). Therefore, application of Si could be a better strategy for maintaining the crop productivity in acid rain regions.

Mapping and marker-assisted selection of a brown planthopper resistance gene bph2 in rice (Oryza sativa L.).

Science.gov (United States)

Sun, Li-Hong; Wang, Chun-Ming; Su, Chang-Chao; Liu, Yu-Qiang; Zhai, Hu-Qu; Wan, Jian-Min

2006-08-01

Nilaparvata lugens Stål (brown planthopper, BPH), is one of the major insect pests of rice (Oryza sativa L.) in the temperate rice-growing region. In this study, ASD7 harboring a BPH resistance gene bph2 was crossed to a susceptible cultivar C418, a japonica restorer line. BPH resistance was evaluated using 134 F2:3 lines derived from the cross between "ASD7" and "C418". SSR assay and linkage analysis were carried out to detect bph2. As a result, the resistant gene bph2 in ASD7 was successfully mapped between RM7102 and RM463 on the long arm of chromosome 12, with distances of 7.6 cM and 7.2 cM, respectively. Meanwhile, both phenotypic selection and marker-assisted selection (MAS) were conducted in the BC1F1 and BC2F1 populations. Selection efficiencies of RM7102 and RM463 were determined to be 89.9% and 91.2%, respectively. It would be very beneficial for BPH resistance improvement by using MAS of this gene.

Patogenicidade de Helminthosporium oryzae a algumas espécies de gramíneas Pathogenicity of Helminthosporium oryzae against some grass species

Directory of Open Access Journals (Sweden)

V.H. Artigiani Filho

1995-04-01

Full Text Available O fungo Helminthosporium oryzae é um patógeno do arroz. Devido a sua variabilidade patogênica, foi investigada a possibilidade deste fungo infectar outras gramíneas. Através de inoculação artificial, ficou demonstrada a capacidade deste patógeno provocar infecção em aveia, cana, centeio, sorgo, trigo, Brachiaria decumbens e Panicum maximum. Assim, estas espécies vegetais podem ser consideradas potenciais hospedeiros do fungo na natureza.Helminthosporium oryzae is a rice pathogen. Due to its variability in pathogenicity, the possibility of this fungus Infecting other grasses was investigated. The capacity of this pathogen was demonstrated to be able to infect oat, sugar-cane, rye, sorghum, wheat, Brachiaria decumbens and Panicum maximum through artificial inoculations. Therefore, those plant species can be considered potencial hosts for the fungus in nature.

Physico-chemical and sensorial characteristics of rice (Oryza sativa L.) irradiated and the effect in Sitophilus oryzae L. development

International Nuclear Information System (INIS)

Zanao, Cintia Fernanda Pedroso

2007-01-01

Rice is exposed to injuries especially due to the attack of insects, which represent great qualitative and quantitative losses. The aim of the present research was to verify the viability of the gamma irradiation as rice (Oryza sativa L.) conservation method; its efficiency in the control of an important pest for stored grains Sitophilus oryzae L. and the effects that irradiation may present in irradiated grains in relation to the sensory aspect and starch alterations. Samples were composed of polished rice and the gamma irradiation dosages used were 0.5; 1.0; 3.0; and 5.0 kGy, and kept at room temperature. Analyses of the grain breakage percentages during processing and the longevity and reproduction of the rice weevil were performed. Analyses of the centesimal composition, phytic acid, apparent amylose content and starch paste properties were also conducted, as well as analyses of the rice color (instrumental) and acceptability (hedonic test), aimed at the determination of the raw and cooked rice sensory quality. It was verified that the gamma irradiation did not change the grain breakage percentage significantly and caused a negative effect on the insect development. Irradiation did not change the centesimal composition significantly. No significant values of phytic acid were found because during rice processing, the outer part (bran) containing 85-92% of total phytates was removed. Values from 17.33 to 18.44% for the apparent amylose content were found, and irradiation did not affect the rice starch amylose content significantly. The paste properties results were significantly changed, where reduction on the paste temperature, decrease on the time for the occurrence of the peak viscosity, reduction on the final viscosity values were observed. The retrogradation tendency became less intense in starches with increasing irradiation dosages. Statistical differences (p<0.05) were detected in the sensory aspect between irradiated and non-irradiated samples, and the

Genotype × environment interactions of yield traits in backcross introgression lines derived from Oryza sativa cv. Swarna /Oryza nivara

Directory of Open Access Journals (Sweden)

Divya Balakrishnan

2016-10-01

Full Text Available Advanced backcross introgression lines (BILs developed from crosses of Oryza sativa var. Swarna/O. nivara accessions were grown and evaluated for yield and related traits. Trials were conducted for consecutive three seasons in field conditions in a randomized complete block design with three replications. Data on yield traits under irrigated conditions were analyzed using the Additive Main Effect and Multiplicative Interaction (AMMI, Genotype and Genotype × Environment Interaction (GGE and modified rank-sum statistic (YSi for yield stability. BILs viz., G3 (14S and G6 (166S showed yield stability across the seasons along with high mean yield performance. G3 is early in flowering with high yield and has good grain quality and medium height, hence could be recommended for most of the irrigated locations. G6 is a late duration genotype, with strong culm strength, high grain number and panicle weight. G6 has higher yield and stability than Swarna but has Swarna grain type. Among the varieties tested DRRDhan 40 and recurrent parent Swarna showed stability for yield traits across the seasons. The component traits thousand grain weight, panicle weight, panicle length, grain number and plant height explained highest genotypic percentage over environment and interaction factors and can be prioritized to dissect stable QTLs/ genes. These lines were genotyped using microsatellite markers covering the entire rice genome and also using a set of markers linked to previously reported yield QTLs. It was observed that wild derived lines with more than 70% of recurrent parent genome were stable and showed enhanced yield levels compared to genotypes with higher donor genome introgressions.

Effect of selenium application on arsenic uptake in rice (Oryza sativa L.).

Science.gov (United States)

Kaur, Sumandeep; Singh, Dhanwinder; Singh, Kuldip

2017-09-01

Alluvial aquifers of the agrarian state of Punjab of southwestern arid zone used for irrigation of rice crops are rich in arsenic concentration. In the present study, rice (Oryza sativa L.) crops were raised in pots in a greenhouse with a purpose to study whether selenium (Se) application was effective in ameliorating As uptake. The rice crop was irrigated with arsenic laced water (0, 2.5, 5.0, 10.0 μM As L -1 ) throughout the growing period, without and with selenium (0.05 and 0.10 mg kg -1 ) added through mustard biomass, grown ex situ in seleniferous soil. Arsenic uptake and dry matter yield in different parts of the rice crop were assayed after application of As alone and simultaneous supplementations (As + Se). An antagonistic interaction between Se and As was observed. Addition of As through irrigation water significantly reduced yield of rice grain, straw and root. However, subsequent addition of Se helped in mitigating the harmful effect of As and countered the yield reduction caused due to As toxicity. The effect of Se on dry matter yield was more pronounced at its higher dose (0.10 mg kg -1 ) as compared to its lower dose (0.05 mg kg -1 ). The presence of Se either alone or added along with As significantly reduced the As concentration and its uptake by different parts of rice and higher reduction in As concentration was observed with addition of the highest level of applied Se (0.10 mg kg -1 ). Our observations indicated that Se supplementation might be favourable to reduce As accumulation and toxicity in rice crops.

Alternate wetting and drying decreases methylmercury in flooded rice (Oryza sativa) systems

Science.gov (United States)

Tanner, K. Christy; Windham-Myers, Lisamarie; Marvin-DiPasquale, Mark C.; Fleck, Jacob; Linquist, Bruce A.

2018-01-01

In flooded soils, including those found in rice (Oryza sativa L.) fields, microbes convert inorganic Hg to more toxic methylmercury (MeHg). Methylmercury is accumulated in rice grain, potentially affecting health. Methylmercury in rice field surface water can bioaccumulate in wildlife. We evaluated how introducing aerobic periods into an otherwise continuously flooded rice growing season affects MeHg dynamics. Conventional continuously flooded (CF) rice field water management was compared with alternate wetting and drying, where irrigation was stopped twice during the growing season, allowing soil to dry to 35% volumetric moisture content, at which point plots were reflooded (AWD-35). Methylmercury studies began at harvest in Year 3 and throughout Year 4 of a 4-yr replicated field experiment. Bulk soil, water, and plant samples were analyzed for MeHg and total Hg (THg), and iron (Fe) speciation was measured in soil samples. Rice grain yield over 4 yr did not differ between treatments. Soil chemistry responded quickly to AWD-35 dry-downs, showing significant oxidation of Fe(II) accompanied by a significant reduction of MeHg concentration (76% reduction at harvest) compared with CF. Surface water MeHg decreased by 68 and 39% in the growing and fallow seasons, respectively, suggesting that the effects of AWD-35 management can last through to the fallow season. The AWD-35 treatment reduced rice grain MeHg and THg by 60 and 32%, respectively. These results suggest that the more aerobic conditions caused by AWD-35 limited the activity of Hg(II)-methylating microbes and may be an effective way to reduce MeHg concentrations in rice ecosystems.

Black rice (Oryza sativa L.) extracts induce osteoblast differentiation and protect against bone loss in ovariectomized rats.

Science.gov (United States)

Jang, Woo-Seok; Seo, Cho-Rong; Jang, Hwan Hee; Song, No-Joon; Kim, Jong-Keun; Ahn, Jee-Yin; Han, Jaejoon; Seo, Woo Duck; Lee, Young Min; Park, Kye Won

2015-01-01

Osteoporosis, an age associated skeletal disease, exhibits increased adipogenesis at the expense of osteogenesis from common osteoporotic bone marrow cells. In this study, black rice (Oryza sativa L.) extracts (BRE) were identified as osteogenic inducers. BRE stimulated the alkaline phosphatase (ALP) activity in both C3H10T1/2 and primary bone marrow cells. Similarly, BRE increased mRNA expression of ALP and osterix. Oral administration of BRE in OVX rats prevented decreases in bone density and strength. By contrast, BRE inhibited adipocyte differentiation of mesenchymal C3H10T1/2 cells and prevented increases in body weight and fat mass in high fat diet fed obese mice, further suggesting the dual effects of BRE on anti-adipogenesis and pro-osteogenesis. UPLC analysis identified cyanidin-3-O-glucoside and peonidin-3-O-glucoside as main anti-adipogenic effectors but not for pro-osteogenic induction. In mechanism studies, BRE selectively stimulated Wnt-driven luciferase activities. BRE treatment also induced Wnt-specific target genes such as Axin2, WISP2, and Cyclin D1. Taken together, these data suggest that BRE is a potentially useful ingredient to protect against age related osteoporosis and diet induced obesity.

Role of salicylic acid in alleviating oxidative damage in rice roots (Oryza sativa) subjected to cadmium stress

International Nuclear Information System (INIS)

Guo, B.; Liang, Y.C.; Zhu, Y.G.; Zhao, F.J.

2007-01-01

Time-dependent changes in enzymatic and non-enzymatic antioxidants, and lipid peroxidation were investigated in roots of rice (Oryza sativa) grown hydroponically with Cd, with or without pretreatment of salicylic acid (SA). Exposure to 50 μM Cd significantly decreased root growth, and activities of superoxide dismutase (SOD), catalase (CAT) and peroxidase (POD), but increased the concentrations of H 2 O 2 , malondialdehyde (MDA), ascorbic acid (AsA), glutathione (GSH) and non-protein thiols (NPT). However, pretreatment with 10 μM SA enhanced the activities of antioxidant enzymes and the concentrations of non-enzymatic antioxidants, but lowered the concentrations of H 2 O 2 and MDA in the Cd-stressed rice compared with the Cd treatment alone. Pretreatment with SA alleviated the Cd-induced inhibition of root growth. The results showed that pretreatment with SA enhanced the antioxidant defense activities in Cd-stressed rice, thus alleviating Cd-induced oxidative damage and enhancing Cd tolerance. The possible mechanism of SA-induced H 2 O 2 signaling in mediating Cd tolerance was discussed. - Pretreatment with SA enhanced the antioxidant defense activities in Cd-stressed rice, thus alleviating Cd-induced oxidative damage and enhancing Cd tolerance

Zinco, chumbo e cádmio em plantas de arroz (Oryza Sativa L. cultivadas em solo após adição de resíduo siderúrgico Zinc, lead and cadmium influence in rice plants (Oryza Sativa L. cultivated in soil with addition of siderurgical residue

Directory of Open Access Journals (Sweden)

André Fernão Martins de Andrade

2008-10-01

Full Text Available Os efeitos da aplicação de resíduo siderúrgico, proveniente da concentração de zinco em lama de altos-fornos siderúrgicos, como fonte de zinco para plantas de arroz (Oryza Sativa L. BRS Curinga e a toxicidade devida ao cádmio e ao chumbo no resíduo, foram estudados em experimento de casa de vegetação. O material de solo usado foi proveniente do horizonte A e B de um Latossolo Vermelho-Amarelo e do horizonte A de um Neossolo Flúvico, coletados no município de Pinheiral, Estado do Rio de Janeiro. Foram aplicadas quatro doses de resíduo (94; 281; 844 e 2531kg ha-1. Foi determinado o teor de zinco, cádmio e chumbo na raiz e na parte aérea das plantas de arroz. As plantas crescidas no horizonte A do Neossolo Flúvico apresentaram a maior produção de matéria seca e a maior acumulação de zinco e a menor de cádmio. As plantas de arroz desenvolvidas no horizonte B do Latossolo apresentaram a menor produção de matéria seca, menor acumulação de zinco e a maior de chumbo, enquanto que as cultivadas no horizonte A do Latossolo apresentaram a mais elevada produção de matéria seca dos três substratos utilizados. O zinco e o chumbo concentraram-se, principalmente, nas raízes das plantas, e o cádmio se concentrou na parte aérea. Pelas características apresentadas nos solos estudados e pelas concentrações fitotóxicas do chumbo e do cádmio encontradas nas plantas desenvolvidas sobre o horizonte B do Latossolo, não é recomendável a utilização desse resíduo como fonte de zinco para a cultura do arroz.The effects of application of siderurgical residue, originated from the zinc concentration in siderurgical high-ovens mud, as supply of zinc for rice plants (Oryza Sativa L. and the toxicity due to cadmium and lead from the residue, were studied in a greenhouse experiment.The period of the experiment was from April of 2005 to March of 2006. The soil materials were from the A and B horizons of a Yellow - Red Oxisol, and the A

Germination and plantlet regeneration of encapsulated microshoots of aromatic rice (Oryza sativa L. Cv. MRQ 74).

Science.gov (United States)

Taha, Rosna Mat; Saleh, Azani; Mahmad, Noraini; Hasbullah, Nor Azlina; Mohajer, Sadegh

2012-01-01

Plant tissues such as somatic embryos, apical shoot tips, axillary shoot buds, embryogenic calli, and protocom-like bodies are potential micropropagules that have been considered for creating synthetic seeds. In the present study, 3-5 mm microshoots of Oryza sativa L. Cv. MRQ 74 were used as explant sources for obtaining synthetic seeds. Microshoots were induced from stem explants on Murashige and Skoog (MS) medium supplemented with 1.5 mg/L benzylaminopurine (BAP). They were encapsulated in 3% (w/v) sodium alginate, 3% sucrose, 0.1 mg/L BAP, and 0.1 mg/L α-Naphthalene acetic acid (NAA). Germination and plantlet regeneration of the encapsulated seeds were tested by culturing them on various germination media. The effect of storage period (15-30 days) was also investigated. The maximum germination and plantlet regeneration (100.0%) were recorded on MS media containing 3% sucrose and 0.8% agar with and without 0.1 mg/L BAP. However, a low germination rate (6.67%) was obtained using top soil as a sowing substrate. The germination rate of the encapsulated microshoots decreased from 93.33% to 3.33% after 30 days of storage at 4°C in the dark. Therefore, further research is being done to improve the germination rate of the synthetic seeds.

Characterization and genetic mapping of a Photoperiod-sensitive dwarf 1 locus in rice (Oryza sativa L.).

Science.gov (United States)

Li, Riqing; Xia, Jixing; Xu, Yiwei; Zhao, Xiucai; Liu, Yao-Guang; Chen, Yuanling

2014-01-01

Plant height is an important agronomic trait for crop architecture and yield. Most known factors determining plant height function in gibberellin or brassinosteroid biosynthesis or signal transduction. Here, we report a japonica rice (Oryza sativa ssp. japonica) dominant dwarf mutant, Photoperiod-sensitive dwarf 1 (Psd1). The Psd1 mutant showed impaired cell division and elongation, and a severe dwarf phenotype under long-day conditions, but nearly normal growth in short-day. The plant height of Psd1 mutant could not be rescued by gibberellin or brassinosteroid treatment. Genetic analysis with R1 and F2 populations determined that Psd1 phenotype was controlled by a single dominant locus. Linkage analysis with 101 tall F2 plants grown in a long-day season, which were derived from a cross between Psd1 and an indica cultivar, located Psd1 locus on chromosome 1. Further fine-mapping with 1017 tall F2 plants determined this locus on an 11.5-kb region. Sequencing analysis of this region detected a mutation site in a gene encoding a putative lipid transfer protein; the mutation produces a truncated C-terminus of the protein. This study establishes the genetic foundation for understanding the molecular mechanisms regulating plant cell division and elongation mediated by interaction between genetic and environmental factors.

The humic acids from vermicompost protect rice (Oryza sativa L.) plants against a posterior hidric stress

International Nuclear Information System (INIS)

Guridi-Izquierdo, Fernando; Martínez-Balmori, Dariellys; Rosquete-Bassó, Mayelín; Calderín-García, Andrés; Louro-Berbara, Ricardo L.

2017-01-01

The humic acids (HA) from two different vermicompost were extracted, isolated, purified and partially characterized, to evaluate their possible protection in rice (Oryza sativa L.) plants against an hydric stress. Differences in elemental composition, as the coagulation threshold value and E4/E6 relation in their UV-Vis spectra were found. Two concentrations (40 and 60 mg L-1) of both HA were included in the nutritive solutions for rice plants in controlled conditions. It was verified that the previous treatment with the HA during six days stimulated the root biomass production. Later the HA were excluded and was an hydric deficit induced by adding polietilenglicol (PEG-6000) in the initially treated plants and in a group of those used as control. After 96 hours of this final condition the net radical biomass, the photosynthetic pigments content and the root membrane permeability were evaluated. In the plants previously treated with HA (at the concentration 60 mg HA L-1), the root membrane permeability, the net radical biomass production and the “a” chlorophyll content had no differences when compared with those without stress. It was concluded that the previous treatment with the HA protected the rice plants against a posterior hydric stress that was induced. (author)

Molecular characterization and genetic diversity of different genotypes of Oryza sativa and Oryza glaberrima

Directory of Open Access Journals (Sweden)

Caijin Chen

2017-11-01

Conclusions: Genetic diversity studies revealed that 50 rice types were clustered into different subpopulations whereas three genotypes were admixtures. Molecular fingerprinting and 10 specific markers were obtained to identify the 53 rice genotypes. These results can facilitate the potential utilization of sibling species in rice breeding and molecular classification of O. sativa and O. glaberrima germplasms.

Quantitative Classification of Rice (Oryza sativa L.) Root Length and Diameter Using Image Analysis.

Science.gov (United States)

Gu, Dongxiang; Zhen, Fengxian; Hannaway, David B; Zhu, Yan; Liu, Leilei; Cao, Weixing; Tang, Liang

2017-01-01

Quantitative study of root morphological characteristics of plants is helpful for understanding the relationships between their morphology and function. However, few studies and little detailed and accurate information of root characteristics were reported in fine-rooted plants like rice (Oryza sativa L.). The aims of this study were to quantitatively classify fine lateral roots (FLRs), thick lateral roots (TLRs), and nodal roots (NRs) and analyze their dynamics of mean diameter (MD), lengths and surface area percentage with growth stages in rice plant. Pot experiments were carried out during three years with three rice cultivars, three nitrogen (N) rates and three water regimes. In cultivar experiment, among the three cultivars, root length of 'Yangdao 6' was longest, while the MD of its FLR was the smallest, and the mean diameters for TLR and NR were the largest, the surface area percentage (SAP) of TLRs (SAPT) was the highest, indicating that Yangdao 6 has better nitrogen and water uptake ability. High N rate increased the length of different types of roots and increased the MD of lateral roots, decreased the SAP of FLRs (SAPF) and TLRs, but increased the SAP of NRs (SAPN). Moderate decrease of water supply increased root length and diameter, water stress increased the SAPF and SAPT, but decreased SAPN. The quantitative results indicate that rice plant tends to increase lateral roots to get more surface area for nitrogen and water uptake when available assimilates are limiting under nitrogen and water stress environments.

Effector-mediated suppression of chitin-triggered immunity by Magnaporthe oryzae is necessary for rice blast disease

NARCIS (Netherlands)

Mentlak, T.A.; Kombrink, A.; Shinya, T.; Ryder, L.S.; Otomo, I.; Saitoh, H.; Terauchi, R.; Nishizawa, Y.; Shibuya, N.; Thomma, B.P.H.J.; Talbot, N.J.

2012-01-01

Plants use pattern recognition receptors to defend themselves from microbial pathogens. These receptors recognize pathogen-associated molecular patterns (PAMPs) and activate signaling pathways that lead to immunity. In rice (Oryza sativa), the chitin elicitor binding protein (CEBiP) recognizes

Effect of coated urea on cadmium accumulation in Oryza sativa L. grown in contaminated soil.

Science.gov (United States)

Xu, Chao; Wu, Zisong; Zhu, Qihong; Zhu, Hanhua; Zhang, Yangzhu; Huang, Daoyou

2015-11-01

Experiments were conducted to determine the effects of three types of coated urea on the accumulation of cadmium (Cd) in rice (Oryza sativa L.) grown in contaminated soil. Pot-culture experiments were conducted in a greenhouse from July to November 2012 on the rice cultivar "Hua Hang Si Miao" in Guangzhou (China). The experimental design was completely randomized with four treatments and three replications. The treatments were control (CK) (N 0 mg/kg), prilled urea (PU) (N 200 mg/kg), polymer-coated urea (PCU) (N 200 mg/kg), and sulfur-coated urea (SCU) (N 200 mg/kg). Our results indicated that applications of PCU and SCU slightly increased the dry weight of rice grains. The application of SCU significantly decreased the CaCl2 and toxicity characteristic leaching procedure (TCLP)-extractable Cd concentrations by 15.4 and 56.1%, respectively. Sequential extractions showed that PCU and SCU applications led to a significant decrease in Cd in the exchangeable fraction and an increase in the bound iron (Fe) and manganese (Mn) oxides fractions. Cd concentrations in grains treated with PCU were reduced by 11.7%, whereas SCU significantly reduced Cd concentrations by 29.1%. SCU reduced Cd transfer from the straws to the grain. Our results demonstrated that PCU and SCU may be effective in mitigating Cd accumulation in rice grown in acidic Cd-contaminated soil, especially in plants receiving SCU.

Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana

Science.gov (United States)

Itoh, Takeshi; Tanaka, Tsuyoshi; Barrero, Roberto A.; Yamasaki, Chisato; Fujii, Yasuyuki; Hilton, Phillip B.; Antonio, Baltazar A.; Aono, Hideo; Apweiler, Rolf; Bruskiewich, Richard; Bureau, Thomas; Burr, Frances; Costa de Oliveira, Antonio; Fuks, Galina; Habara, Takuya; Haberer, Georg; Han, Bin; Harada, Erimi; Hiraki, Aiko T.; Hirochika, Hirohiko; Hoen, Douglas; Hokari, Hiroki; Hosokawa, Satomi; Hsing, Yue; Ikawa, Hiroshi; Ikeo, Kazuho; Imanishi, Tadashi; Ito, Yukiyo; Jaiswal, Pankaj; Kanno, Masako; Kawahara, Yoshihiro; Kawamura, Toshiyuki; Kawashima, Hiroaki; Khurana, Jitendra P.; Kikuchi, Shoshi; Komatsu, Setsuko; Koyanagi, Kanako O.; Kubooka, Hiromi; Lieberherr, Damien; Lin, Yao-Cheng; Lonsdale, David; Matsumoto, Takashi; Matsuya, Akihiro; McCombie, W. Richard; Messing, Joachim; Miyao, Akio; Mulder, Nicola; Nagamura, Yoshiaki; Nam, Jongmin; Namiki, Nobukazu; Numa, Hisataka; Nurimoto, Shin; O’Donovan, Claire; Ohyanagi, Hajime; Okido, Toshihisa; OOta, Satoshi; Osato, Naoki; Palmer, Lance E.; Quetier, Francis; Raghuvanshi, Saurabh; Saichi, Naomi; Sakai, Hiroaki; Sakai, Yasumichi; Sakata, Katsumi; Sakurai, Tetsuya; Sato, Fumihiko; Sato, Yoshiharu; Schoof, Heiko; Seki, Motoaki; Shibata, Michie; Shimizu, Yuji; Shinozaki, Kazuo; Shinso, Yuji; Singh, Nagendra K.; Smith-White, Brian; Takeda, Jun-ichi; Tanino, Motohiko; Tatusova, Tatiana; Thongjuea, Supat; Todokoro, Fusano; Tsugane, Mika; Tyagi, Akhilesh K.; Vanavichit, Apichart; Wang, Aihui; Wing, Rod A.; Yamaguchi, Kaori; Yamamoto, Mayu; Yamamoto, Naoyuki; Yu, Yeisoo; Zhang, Hao; Zhao, Qiang; Higo, Kenichi; Burr, Benjamin; Gojobori, Takashi; Sasaki, Takuji

2007-01-01

We present here the annotation of the complete genome of rice Oryza sativa L. ssp. japonica cultivar Nipponbare. All functional annotations for proteins and non-protein-coding RNA (npRNA) candidates were manually curated. Functions were identified or inferred in 19,969 (70%) of the proteins, and 131 possible npRNAs (including 58 antisense transcripts) were found. Almost 5000 annotated protein-coding genes were found to be disrupted in insertional mutant lines, which will accelerate future experimental validation of the annotations. The rice loci were determined by using cDNA sequences obtained from rice and other representative cereals. Our conservative estimate based on these loci and an extrapolation suggested that the gene number of rice is ∼32,000, which is smaller than previous estimates. We conducted comparative analyses between rice and Arabidopsis thaliana and found that both genomes possessed several lineage-specific genes, which might account for the observed differences between these species, while they had similar sets of predicted functional domains among the protein sequences. A system to control translational efficiency seems to be conserved across large evolutionary distances. Moreover, the evolutionary process of protein-coding genes was examined. Our results suggest that natural selection may have played a role for duplicated genes in both species, so that duplication was suppressed or favored in a manner that depended on the function of a gene. PMID:17210932

Cadmium and lead content in several brands of rice grains (Oryza sativa) in central Iran.

Science.gov (United States)

Shakerian, A; Rahimi, E; Ahmadi, M

2012-11-01

The aim of this study was to investigate the cadmium (Cd) and lead (Pb) content of several commercially available brands of rice grains (Oryza sativa) in central Iran. A total of 67 samples of the most widely consumed brands of rice grains were purchased from local bazaar markets in Shahrekord, Iran. The first step, grains of raw rice were digested by acid digestion method and then were analyzed by atomic absorption spectrometer. The results showed that Cd concentration in rice grains ranged from 0.0378 to 0.1225 ppm dry weight and its average concentration was 0.062 ± 0.019 ppm and Pb content ranged from 0.0405 to 0.1281 ppm dry weight and its average concentration was 0.068 ± 0.0185 ppm. Cd and Pb concentrations in the sampled rice grains were lower in comparison with their upper limits (0.2 and 0.2 ppm for Cd and Pb, respectively) approved by food sanitary standard. Therefore, it can be concluded that there is no health problems due to the consumption of brands of rice grains, for these two elements. The results indicated that weekly intake of Cd and Pb from rice grains was below the provisional tolerable weekly intakes recommended by WHO/FAO.

Influence of lead on atrazine uptake by rice (Oryza sativa L.) seedlings from nutrient solution.

Science.gov (United States)

Su, Yu-Hong; Zhu, Yong-Guan

2005-01-01

Atrazine is a widely used herbicide, and its persistence in soil and water causes environmental concerns. In the past, plant uptake processes are mainly investigated for single contaminants. However, in many cases, contaminants co-exist in environmental matrix, such as soil, and plant uptake of one contaminant may be influenced by its co-existing ones. The uptake of atrazine by rice seedlings (Oryza sativa L.) from nutrient solution through the roots was investigated in a solution culture, over an exposure period of 4 weeks. Atrazine accumulation in plant tissues was determined by gas chromatography, and lead was determined using atomic absorption spectrometry. With different ratios of atrazine and Pb2+ concentrations in solution, the observed atrazine concentrations in shoots and roots varied significantly. In atrazine-Pb2+ mixture systems, the added Pb2+ either increased or decreased the concentrations or BCFs of atrazine in seedlings (relative to those without Pb2+), depending on the atrazine-Pb2+ ratio in nutrient solution. The enhanced atrazine uptake results presumably from atrazine-Pb2+ complex formation. The reduced atrazine uptake, which occurred mainly at high atrazine concentrations, is attributed to atrazine toxicity that inhibited seedling growth and transpiration. The formation of atrazine-Pb2+ complex both in the solution and within plant tissues may affect the accumulation of both contaminants by rice plants.

In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species

Directory of Open Access Journals (Sweden)

Ertuğrul Filiz

2013-01-01

Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

Comparison of physiological and anatomical changes of C3 (Oryza sativa [L.]) and C4 (Echinochloa crusgalli [L.]) leaves in response to drought stress

Science.gov (United States)

Hamim, Hamim; Banon, Sri; Dorly, Dorly

2016-01-01

The experiment aimed to analyse the different response of C3 (Oryza sativa L.) and C4 (Echinochloa crusgalli L.) species to drought stress based on physiological and anatomical properties. Seeds of rice (Oryza sativa) and Echinochloa (Echinochloa crusgalli) were grown in 15 cm (D) pot for 6 weeks under well-watered conditions. After 6 weeks the plants were divided into two groups, (1) well-watered which were watered daily, and (2) drought stress which were withheld from watering for 6 days. After 6 days of drought, the plants were then re-watered to analyse plant recovery. During drought period, the plants were analysed for growth, leaf relative water content (RWC), photosynthesis, and leaf anatomy. Drought stress significantly reduced leaf RWC of both species, but the reduction was bigger in rice than in Echinochloa. The maximum efficiency of photosynthesis (Fv/Fm) was decrease significantly in response to drought stress by about 48.04% in rice, while it was only 34.40% in Echinochloa. Anatomical analysis showed drought treatment tended to reduce leaf thickness in the area of bulliform cell, major- as well as intervein and xylem diameter, more in Echinochloa than in rice, suggesting that the decrease of vein and xylem diameter is among the anatomical parameters that is important to overcome from drought stress in Echinochloa. The number of chloroplast in the mesophyll cell and bundle sheath cell (BSC) was different between these two species, where in Echinochloa chloroplast was found in both mesophyll as well as BSC, while in rice it was only found in mesophyll cell, confirmed that Echinochloa is a C4 and rice is a C3 species. Interestingly, in Echinochloa, the number of chloroplast was significantly increased due to drought stress in BSC, but not in mesophyll cell. The number of starch granules also dramatically increased in response to drought in the mesophyll cells of rice and Echinochloa, and in the bundle sheath cell of Echinochloa which indicate that C3

OsPIN5b modulates rice (Oryza sativa) plant architecture and yield by changing auxin homeostasis, transport and distribution.

Science.gov (United States)

Lu, Guangwen; Coneva, Viktoriya; Casaretto, José A; Ying, Shan; Mahmood, Kashif; Liu, Fang; Nambara, Eiji; Bi, Yong-Mei; Rothstein, Steven J

2015-09-01

Plant architecture attributes such as tillering, plant height and panicle size are important agronomic traits that determine rice (Oryza sativa) productivity. Here, we report that altered auxin content, transport and distribution affect these traits, and hence rice yield. Overexpression of the auxin efflux carrier-like gene OsPIN5b causes pleiotropic effects, mainly reducing plant height, leaf and tiller number, shoot and root biomass, seed-setting rate, panicle length and yield parameters. Conversely, reduced expression of OsPIN5b results in higher tiller number, more vigorous root system, longer panicles and increased yield. We show that OsPIN5b is an endoplasmic reticulum (ER) -localized protein that participates in auxin homeostasis, transport and distribution in vivo. This work describes an example of an auxin-related gene where modulating its expression can simultaneously improve plant architecture and yield potential in rice, and reveals an important effect of hormonal signaling on these traits. © 2015 The Authors The Plant Journal © 2015 John Wiley & Sons Ltd.

Exploring the power of rice (O. sativa x O. rufipogon) chromosome segment substitution line libraries

Science.gov (United States)

Transgressive variation was reported as an increase in grain yield for several rice (Oryza sativa x O. rufipogon) advanced backcross mapping populations. The objective of this study was to develop chromosome segment substitution line (CSSL) libraries to further dissect the reported transgressive var...

A genome browser database for rice (Oryza sativa) and Chinese ...

African Journals Online (AJOL)

STORAGESEVER

2009-10-19

Oct 19, 2009 ... sativa) and Chinese cabbage (Brassica rapa) genomes. The genome ... tant staple food for a large part of the world's human population. .... some banding region for selection and the overview panel shows the location of ...

Chemical Modification of Oryza sativa Linnaeus Husk with Urea for Removal of Brilliant Vital Red and Murexide Dyes from Water by Adsorption in Environmentally Benign Way

International Nuclear Information System (INIS)

Rehman, R.; Mahmud, T.; Kanwal, F.; Aslam, M.N.; Nisar, H.

2013-01-01

Oryza sativa Linnaeus is an important food item all around the world. Due to its huge consumption, a large amount of rice husk is generated as agrowaste which can be used for water treatment by adsorption. Its adsorption capacity further can be enhanced by chemical medication. In the present study, urea modified rice husk has been used for removing Brilliant Vital Red and Murexide form water in an efficient way. After optimizing operating conditions, isothermal and thermodynamical studies were carried out, which showed that maximum adsorption capacity of urea modified rice husk for removing Brilliant Vital Red and Murexide dyes were 28.93 and 30.74 mg.g/sup -1/. Adsorbent characterization was carried out by recording its FT-IR spectra. (author)

Genome-wide comparative in silico analysis of the RNA helicase gene family in Zea mays and Glycine max: a comparison with Arabidopsis and Oryza sativa.

Science.gov (United States)

Xu, Ruirui; Zhang, Shizhong; Huang, Jinguang; Zheng, Chengchao

2013-01-01

RNA helicases are enzymes that are thought to unwind double-stranded RNA molecules in an energy-dependent fashion through the hydrolysis of NTP. RNA helicases are associated with all processes involving RNA molecules, including nuclear transcription, editing, splicing, ribosome biogenesis, RNA export, and organelle gene expression. The involvement of RNA helicase in response to stress and in plant growth and development has been reported previously. While their importance in Arabidopsis and Oryza sativa has been partially studied, the function of RNA helicase proteins is poorly understood in Zea mays and Glycine max. In this study, we identified a total of RNA helicase genes in Arabidopsis and other crop species genome by genome-wide comparative in silico analysis. We classified the RNA helicase genes into three subfamilies according to the structural features of the motif II region, such as DEAD-box, DEAH-box and DExD/H-box, and different species showed different patterns of alternative splicing. Secondly, chromosome location analysis showed that the RNA helicase protein genes were distributed across all chromosomes with different densities in the four species. Thirdly, phylogenetic tree analyses identified the relevant homologs of DEAD-box, DEAH-box and DExD/H-box RNA helicase proteins in each of the four species. Fourthly, microarray expression data showed that many of these predicted RNA helicase genes were expressed in different developmental stages and different tissues under normal growth conditions. Finally, real-time quantitative PCR analysis showed that the expression levels of 10 genes in Arabidopsis and 13 genes in Zea mays were in close agreement with the microarray expression data. To our knowledge, this is the first report of a comparative genome-wide analysis of the RNA helicase gene family in Arabidopsis, Oryza sativa, Zea mays and Glycine max. This study provides valuable information for understanding the classification and putative functions of

Quantitative Classification of Rice (Oryza sativa L.) Root Length and Diameter Using Image Analysis

Science.gov (United States)

Gu, Dongxiang; Zhen, Fengxian; Hannaway, David B.; Zhu, Yan; Liu, Leilei; Cao, Weixing; Tang, Liang

2017-01-01

Quantitative study of root morphological characteristics of plants is helpful for understanding the relationships between their morphology and function. However, few studies and little detailed and accurate information of root characteristics were reported in fine-rooted plants like rice (Oryza sativa L.). The aims of this study were to quantitatively classify fine lateral roots (FLRs), thick lateral roots (TLRs), and nodal roots (NRs) and analyze their dynamics of mean diameter (MD), lengths and surface area percentage with growth stages in rice plant. Pot experiments were carried out during three years with three rice cultivars, three nitrogen (N) rates and three water regimes. In cultivar experiment, among the three cultivars, root length of ‘Yangdao 6’ was longest, while the MD of its FLR was the smallest, and the mean diameters for TLR and NR were the largest, the surface area percentage (SAP) of TLRs (SAPT) was the highest, indicating that Yangdao 6 has better nitrogen and water uptake ability. High N rate increased the length of different types of roots and increased the MD of lateral roots, decreased the SAP of FLRs (SAPF) and TLRs, but increased the SAP of NRs (SAPN). Moderate decrease of water supply increased root length and diameter, water stress increased the SAPF and SAPT, but decreased SAPN. The quantitative results indicate that rice plant tends to increase lateral roots to get more surface area for nitrogen and water uptake when available assimilates are limiting under nitrogen and water stress environments. PMID:28103264

Hybrid Sterility in Rice (Oryza sativa L.) Involves the Tetratricopeptide Repeat Domain Containing Protein.

Science.gov (United States)

Yu, Yang; Zhao, Zhigang; Shi, Yanrong; Tian, Hua; Liu, Linglong; Bian, Xiaofeng; Xu, Yang; Zheng, Xiaoming; Gan, Lu; Shen, Yumin; Wang, Chaolong; Yu, Xiaowen; Wang, Chunming; Zhang, Xin; Guo, Xiuping; Wang, Jiulin; Ikehashi, Hiroshi; Jiang, Ling; Wan, Jianmin

2016-07-01

Intersubspecific hybrid sterility is a common form of reproductive isolation in rice (Oryza sativa L.), which significantly hampers the utilization of heterosis between indica and japonica varieties. Here, we elucidated the mechanism of S7, which specially causes Aus-japonica/indica hybrid female sterility, through cytological and genetic analysis, map-based cloning, and transformation experiments. Abnormal positioning of polar nuclei and smaller embryo sac were observed in F1 compared with male and female parents. Female gametes carrying S7(cp) and S7(i) were aborted in S7(ai)/S7(cp) and S7(ai)/S7(i), respectively, whereas they were normal in both N22 and Dular possessing a neutral allele, S7(n) S7 was fine mapped to a 139-kb region in the centromere region on chromosome 7, where the recombination was remarkably suppressed due to aggregation of retrotransposons. Among 16 putative open reading frames (ORFs) localized in the mapping region, ORF3 encoding a tetratricopeptide repeat domain containing protein was highly expressed in the pistil. Transformation experiments demonstrated that ORF3 is the candidate gene: downregulated expression of ORF3 restored spikelet fertility and eliminated absolutely preferential transmission of S7(ai) in heterozygote S7(ai)/S7(cp); sterility occurred in the transformants Cpslo17-S7(ai) Our results may provide implications for overcoming hybrid embryo sac sterility in intersubspecific hybrid rice and utilization of hybrid heterosis for cultivated rice improvement. Copyright © 2016 by the Genetics Society of America.

Effects of ozone on growth, yield and leaf gas exchange rates of four Bangladeshi cultivars of rice (Oryza sativa L.)

International Nuclear Information System (INIS)

Akhtar, Nahid; Yamaguchi, Masahiro; Inada, Hidetoshi; Hoshino, Daiki; Kondo, Taisuke; Fukami, Motohiro; Funada, Ryo; Izuta, Takeshi

2010-01-01

To assess the effects of tropospheric O 3 on rice cultivated in Bangladesh, four Bangladeshi cultivars (BR11, BR14, BR28 and BR29) of rice (Oryza sativa L.) were exposed daily to charcoal-filtered air or O 3 at 60 and 100 nl l -1 (10:00-17:00) from 1 July to 28 November 2008. The whole-plant dry mass and grain yield per plant of the four cultivars were significantly reduced by the exposure to O 3 . The exposure to O 3 significantly reduced net photosynthetic rate of the 12th and flag leaves of the four cultivars. The sensitivity to O 3 of growth, yield and leaf gas exchange rates was not significantly different among the four cultivars. The present study suggests that the sensitivity to O 3 of yield of the four Bangladeshi rice cultivars is greater than that of American rice cultivars and is similar to that of Japanese rice cultivars and that O 3 may detrimentally affect rice production in Bangladesh. - Bangladeshi cultivars of rice are sensitive to O 3 below 100 ppb.

Germination and Plantlet Regeneration of Encapsulated Microshoots of Aromatic Rice (Oryza sativa L. Cv. MRQ 74

Directory of Open Access Journals (Sweden)

Rosna Mat Taha

2012-01-01

Full Text Available Plant tissues such as somatic embryos, apical shoot tips, axillary shoot buds, embryogenic calli, and protocom-like bodies are potential micropropagules that have been considered for creating synthetic seeds. In the present study, 3–5 mm microshoots of Oryza sativa L. Cv. MRQ 74 were used as explant sources for obtaining synthetic seeds. Microshoots were induced from stem explants on Murashige and Skoog (MS medium supplemented with 1.5 mg/L benzylaminopurine (BAP. They were encapsulated in 3% (w/v sodium alginate, 3% sucrose, 0.1 mg/L BAP, and 0.1 mg/L α-Naphthalene acetic acid (NAA. Germination and plantlet regeneration of the encapsulated seeds were tested by culturing them on various germination media. The effect of storage period (15–30 days was also investigated. The maximum germination and plantlet regeneration (100.0% were recorded on MS media containing 3% sucrose and 0.8% agar with and without 0.1 mg/L BAP. However, a low germination rate (6.67% was obtained using top soil as a sowing substrate. The germination rate of the encapsulated microshoots decreased from 93.33% to 3.33% after 30 days of storage at 4°C in the dark. Therefore, further research is being done to improve the germination rate of the synthetic seeds.

Biochemical and anatomical changes and yield reduction in rice (Oryza sativa L.) under varied salinity regimes.

Science.gov (United States)

Hakim, M A; Juraimi, Abdul Shukor; Hanafi, M M; Ismail, Mohd Razi; Selamat, Ahmad; Rafii, M Y; Latif, M A

2014-01-01

Five Malaysian rice (Oryza sativa L.) varieties, MR33, MR52, MR211, MR219, and MR232, were tested in pot culture under different salinity regimes for biochemical response, physiological activity, and grain yield. Three different levels of salt stresses, namely, 4, 8, and 12 dS m(-1), were used in a randomized complete block design with four replications under glass house conditions. The results revealed that the chlorophyll content, proline, sugar content, soluble protein, free amino acid, and yield per plant of all the genotypes were influenced by different salinity levels. The chlorophyll content was observed to decrease with salinity level but the proline increased with salinity levels in all varieties. Reducing sugar and total sugar increased up to 8 dS m(-1) and decreased up to 12 dS m(-1). Nonreducing sugar decreased with increasing the salinity levels in all varieties. Soluble protein and free amino acid also decreased with increasing salinity levels. Cortical cells of MR211 and MR232 did not show cell collapse up to 8 dS m(-1) salinity levels compared to susceptible checks (IR20 and BRRI dhan29). Therefore, considering all parameters, MR211 and MR232 showed better salinity tolerance among the tested varieties. Both cluster and principal component analyses depict the similar results.

Biochemical and Anatomical Changes and Yield Reduction in Rice (Oryza sativa L. under Varied Salinity Regimes

Directory of Open Access Journals (Sweden)

M. A. Hakim

2014-01-01

Full Text Available Five Malaysian rice (Oryza sativa L. varieties, MR33, MR52, MR211, MR219, and MR232, were tested in pot culture under different salinity regimes for biochemical response, physiological activity, and grain yield. Three different levels of salt stresses, namely, 4, 8, and 12 dS m−1, were used in a randomized complete block design with four replications under glass house conditions. The results revealed that the chlorophyll content, proline, sugar content, soluble protein, free amino acid, and yield per plant of all the genotypes were influenced by different salinity levels. The chlorophyll content was observed to decrease with salinity level but the proline increased with salinity levels in all varieties. Reducing sugar and total sugar increased up to 8 dS m−1 and decreased up to 12 dS m−1. Nonreducing sugar decreased with increasing the salinity levels in all varieties. Soluble protein and free amino acid also decreased with increasing salinity levels. Cortical cells of MR211 and MR232 did not show cell collapse up to 8 dS m−1 salinity levels compared to susceptible checks (IR20 and BRRI dhan29. Therefore, considering all parameters, MR211 and MR232 showed better salinity tolerance among the tested varieties. Both cluster and principal component analyses depict the similar results.

Differences in the sensitivity to UVB radiation of two cultivars of rice (Oryza sativa L.)

International Nuclear Information System (INIS)

Hidema, J.; Kang, H.S.; Kumagai, T.

1996-01-01

The effects of UVB radiation on the growth of two cultivars of Japanese lowland rice (Oryza sativa L.), Sasanishiki and Norin 1, were examined in a phytotron. Supplementation of visible radiation with UVB radiation reduced plant length, tiller number, the fresh and dry weights of the aboveground parts of plants, an the amounts of total leaf nitrogen, chlorophyll, soluble protein and ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) in the eight leaf, the youngest fully expanded leaf. By contrast, UVB radiation significantly increased the accumulation of UV-absorbing compounds. There was a difference between the two cultivars in the resistance to the effects of UVB radiation. The reduction in the amounts of Rubisco was smaller in Sasanishiki, while the increase in the accumulation of UV-absorbing compounds was greater in Sasanishiki. Parameters of plant growth, with the exception of the amount of Rubisco, decreased in direct proportion to decreases in total leaf nitrogen in plants grown under lower or the Rubisco content of Norin 1 grown under a high dose of UVB radiation was exceptionally marked, and was not observed similarly in Sasanishiki. The results suggest that the remarkable reduction in rubisco content in NOrin 1 might have been due to the specific effects of UVB radiation. It is also suggested that the difference between cultivars in the resistance to UVB radiation might be due to the differences in the levels of Rubisco and in UV-absorbing compounds that are induced by UVB radiation

Metabolomics analysis of TiO2 nanoparticles induced toxicological effects on rice (Oryza sativa L.).

Science.gov (United States)

Wu, Biying; Zhu, Lizhong; Le, X Chris

2017-11-01

The wide occurrence and high environmental concentration of titanium dioxide nanoparticles (nano-TiO 2 ) have raised concerns about their potential toxic effects on crops. In this study, we employed a GC-MS-based metabolomic approach to investigate the potential toxicity of nano-TiO 2 on hydroponically-cultured rice (Oryza sativa L.) after exposed to 0, 100, 250 or 500 mg/L of nano-TiO 2 for fourteen days. Results showed that the biomass of rice was significantly decreased and the antioxidant defense system was significantly disturbed after exposure to nano-TiO 2 . One hundred and five identified metabolites showed significant difference compared to the control, among which the concentrations of glucose-6-phosphate, glucose-1-phosphate, succinic and isocitric acid were increased most, while the concentrations of sucrose, isomaltulose, and glyoxylic acid were decreased most. Basic energy-generating ways including tricarboxylic acid cycle and the pentose phosphate pathway, were elevated significantly while the carbohydrate synthesis metabolism including starch and sucrose metabolism, and glyoxylate and dicarboxylate metabolism were inhibited. However, the biosynthetic formation of most of the identified fatty acids, amino acids and secondary metabolites which correlated to crop quality, were increased. The results suggest that the metabolism of rice plants is distinctly disturbed after exposure to nano-TiO 2 , and nano-TiO 2 would have a mixed effect on the yield and quality of rice. Copyright © 2017 Elsevier Ltd. All rights reserved.

Identification of molecular markers linked to rice bacterial blight resistance genes from Oryza meyeriana

Directory of Open Access Journals (Sweden)

Jing WANG,Chen CHENG,Yanru ZHOU,Yong YANG,Qiong MEI,Junmin LI,Ye CHENG,Chengqi YAN,Jianping CHEN

2015-09-01

Full Text Available Y73 is a progeny of asymmetric somatic hybridization between Oryza sativa cv. Dalixiang and the wild rice species Oryza meyeriana. Inoculation with a range of strains of Xanthomonas oryzae pv. oryzae showed that Y73 had inherited a high level of resistance to rice bacterial blight (BB from its wild parent. An F2 population of 7125 individuals was constructed from the cross between Y73 and a BB-susceptible cultivar IR24. After testing 615 SSR and STS markers covering the 12 rice chromosomes, 186 markers were selected that showed polymorphism between Y73 and IR24. Molecular markers linked to the BB resistance genes in Y73 were scanned using the F2 population and the polymorphic markers. The SSR marker RM128 on chromosome 1, the STS marker R03D159 on chromosome 3 and the STS marker R05D104 on chromosome 5 were found to be linked to the rice BB resistance genes in Y73.

Uptake of Total Petroleum Hydrocarbon (TPH) and Polycyclic Aromatic Hydrocarbons (PAHs) by Oryza sativa L. Grown in Soil Contaminated with Crude Oil.

Science.gov (United States)

Patowary, Rupshikha; Patowary, Kaustuvmani; Devi, Arundhuti; Kalita, Mohan Chandra; Deka, Suresh

2017-01-01

The purpose of this study was to determine whether total petroleum hydrocarbon (TPH) and polycyclic aromatic hydrocarbons (PAHs) present in crude oil contaminated sites are transferred to roots, shoots and finally the grains of rice crops (Oryza sativa L.) grown in those sites. Soil was artificially contaminated with crude oil at concentrations of 0, 1000, 5000, 10,000, and 15,000 mg/kg, followed by planting of rice seedlings. After harvest, TPH in plant samples were measured, and it was determined that the uptake of TPH by the plants gradually increased as the concentration of oil in soil increased. Further, from GC-MS analysis, it was observed that PAHs including naphthalene and phenanthrene bioaccumulated in rice plant parts. Vital physico-chemical properties of soil were also altered due to crude oil contamination. Our study revealed that rice plants grown in crude oil polluted sites can uptake TPH including PAHs, thus emphasising the importance of prior investigation of soil condition before cultivation of crops.

Water and radiation use efficiencies of transplanted rice (Oryza sativa L.) at different plant densities and irrigation regimes under semi-arid environment

International Nuclear Information System (INIS)

Ahmad, S.; Ali, H.; Shad, S.A.; Zia-ul-Haq, M.; Ahmad, A.; Maqsood, M.; Khan, M.B.; Mehmood, S.; Hussain, A.

2008-01-01

Growth and yield of rice (Oryza sativa L.), in response to plant densities and irrigation (optimum to stress) were analyzed in terms of interception and utilization of photo-synthetically active radiation (PAR) and water use efficiency (WUE). The amount of PAR intercepted and cumulative evapotranspiration (ET) by each treatment was estimated from the measured leaf area index. The relationships between total dry matter grain yield and accumulated intercepted PAR and cumulative ET were linear. Yield differences among the treatments were attributed to the amount of PAR intercepted and water transpired their efficiencies of utilization or both. The fraction of intercepted radiation and WUE was significantly affected by the plant densities and various irrigation regimes, while, radiation utilization efficiency (RUE) and water use efficiency (WUE) for TDM varied from 1.15 g MJ-1 to 1.36 g MJ-1 and 22.6 kg per ha mm-1 to 24.3 kg per ha mm-1 during both the seasons

Global Transcriptome Analysis of Combined Abiotic Stress Signaling Genes Unravels Key Players in Oryza sativa L.: An In silico Approach

Directory of Open Access Journals (Sweden)

Pandiyan Muthuramalingam

2017-05-01

Full Text Available Combined abiotic stress (CAbS affects the field grown plants simultaneously. The multigenic and quantitative nature of uncontrollable abiotic stresses complicates the process of understanding the stress response by plants. Considering this, we analyzed the CAbS response of C3 model plant, Oryza sativa by meta-analysis. The datasets of commonly expressed genes by drought, salinity, submergence, metal, natural expression, biotic, and abiotic stresses were data mined through publically accessible transcriptomic abiotic stress (AbS responsive datasets. Of which 1,175, 12,821, and 42,877 genes were commonly expressed in meta differential, individual differential, and unchanged expressions respectively. Highly regulated 100 differentially expressed AbS genes were derived through integrative meta-analysis of expression data (INMEX. Of this 30 genes were identified from AbS gene families through expression atlas that were computationally analyzed for their physicochemical properties. All AbS genes were physically mapped against O. sativa genome. Comparative mapping of these genes demonstrated the orthologous relationship with related C4 panicoid genome. In silico expression analysis of these genes showed differential expression patterns in different developmental tissues. Protein–protein interaction of these genes, represented the complexity of AbS. Computational expression profiling of candidate genes in response to multiple stresses suggested the putative involvement of OS05G0350900, OS02G0612700, OS05G0104200, OS03G0596200, OS12G0225900, OS07G0152000, OS08G0119500, OS06G0594700, and Os01g0393100 in CAbS. These potential candidate genes need to be studied further to decipher their functional roles in AbS dynamics.

Effect of fluoride on photosynthesis, growth and accumulation of four widely cultivated rice (Oryza sativa L.) varieties in India.

Science.gov (United States)

Mondal, Naba Kumar

2017-10-01

Long-term use of fluoride contaminated groundwater to irrigate crops; especially paddy rice (Oryza sativa L.) has resulted in elevated soil fluoride levels in Eastern India. There is, therefore, growing concern regarding accumulation of fluoride in rice grown on these soils. A laboratory experiment was conducted to investigate the effect of F on germination and phytotoxicity of four varieties of rice (Orzya sativa L.) (MTU-1010; IET-4094; IET-4786 and GB-1) grown in petri dish in a green house with inorganic sodium fluoride (NaF). Three different levels (0, 5, 10 and 20mg/L) of NaF solution were applied. At the end of the experiment (28 days), biochemical analysis (pigment, sugar, protein, amino acid and phenol), lipid peroxidation, root ion leakage and catalase activity along with fluoride accumulation and fresh and dry weight of roots and shoots of four cultivars were measured. The results revealed that all the four studied varieties exhibited gradual decrease of germination pattern with increasing concentration of F. Pigment and growth morphological study clearly demonstrated that the variety IET-4094 was the least influenced by F compare to the other three varieties of rice. The translocation factor (TF) was recorded to be the highest for variety IET-4786 (0.215 ± 0.03) at 5mg/L F concentration. All the four varieties showed higher level of fluoride accumulation in root than in shoot. Variable results were recorded for biochemical parameters and lipid peroxidation. Catalase activity and relative conductivity (root ion leakage) gradually increased with increasing F concentration for all the four varieties. It is speculated that fluoride accumulation in rice straw at very high levels will affect the feeding cattle and such contaminated straw could be a direct threat to their health and also, indirectly, to human health via presumably contaminated meat and milk. Copyright © 2017. Published by Elsevier Inc.

Tolerance of different rice genotypes (oryza sativa l.) against the infestation of rice stem borers under natural field conditions

International Nuclear Information System (INIS)

Sarwar, M.; Ahmad, N.; Nasrullah; Tofique, M.

2010-01-01

The present studies report the genotypic responses of 61 rice (Oryza sativa L.) genotypes (35 aromatic and 26 non aromatic) against the infestation of rice stem borers under natural field conditions. The data obtained on these genotypes on larval infestation in combination with yield were the criteria to assess the resistance depicted by them. The studies showed that among aromatic genotypes, 'Khushboo-95' gave the best yield of grain and harboured the least pest infestation (2.81% dead hearts and 1.85% white heads); on the other hand variety 'Sonahri Sugdasi (P)' harboured the highest borers attack (10.37% and 19.30%) and yielded the lowest grain yield. Regarding non-aromatic genotypes, IR8-2.5-11 received least infestation (1.32% and 0.26% dead hearts and white heads, respectively) generating highest yield showing its tolerance to borer's attack, in contrast, genotype IR6-252 harboured the highest infestation (5.65%, 4.28%) and yielded minimum grain indicating its susceptibility. These results demonstrate the expression of resistance gene in the genome of tolerant rice genotypes that can provide season-long protection from the natural infestation of insect pests. (author)

Evidence for adaptive evolution of low-temperature stress response genes in a Pooideae grass ancestor

DEFF Research Database (Denmark)

Vigeland, Magnus D; Spannagl, Manuel; Asp, Torben

2013-01-01

Adaptation to temperate environments is common in the grass subfamily Pooideae, suggesting an ancestral origin of cold climate adaptation. Here, we investigated substitution rates of genes involved in low-temperature-induced (LTI) stress responses to test the hypothesis that adaptive molecular...... evolution of LTI pathway genes was important for Pooideae evolution. Substitution rates and signatures of positive selection were analyzed using 4330 gene trees including three warm climate-adapted species (maize (Zea mays), sorghum (Sorghum bicolor), and rice (Oryza sativa)) and five temperate Pooideae...... species (Brachypodium distachyon, wheat (Triticum aestivum), barley (Hordeum vulgare), Lolium perenne and Festuca pratensis). Nonsynonymous substitution rate differences between Pooideae and warm habitat-adapted species were elevated in LTI trees compared with all trees. Furthermore, signatures...

WRKY transcription factor genes in wild rice Oryza nivara.

Science.gov (United States)

Xu, Hengjian; Watanabe, Kenneth A; Zhang, Liyuan; Shen, Qingxi J

2016-08-01

The WRKY transcription factor family is one of the largest gene families involved in plant development and stress response. Although many WRKY genes have been studied in cultivated rice (Oryza sativa), the WRKY genes in the wild rice species Oryza nivara, the direct progenitor of O. sativa, have not been studied. O. nivara shows abundant genetic diversity and elite drought and disease resistance features. Herein, a total of 97 O. nivara WRKY (OnWRKY) genes were identified. RNA-sequencing demonstrates that OnWRKY genes were generally expressed at higher levels in the roots of 30-day-old plants. Bioinformatic analyses suggest that most of OnWRKY genes could be induced by salicylic acid, abscisic acid, and drought. Abundant potential MAPK phosphorylation sites in OnWRKYs suggest that activities of most OnWRKYs can be regulated by phosphorylation. Phylogenetic analyses of OnWRKYs support a novel hypothesis that ancient group IIc OnWRKYs were the original ancestors of only some group IIc and group III WRKYs. The analyses also offer strong support that group IIc OnWRKYs containing the HVE sequence in their zinc finger motifs were derived from group Ia WRKYs. This study provides a solid foundation for the study of the evolution and functions of WRKY genes in O. nivara. © The Author 2016. Published by Oxford University Press on behalf of Kazusa DNA Research Institute.

Transposable element distribution, abundance and role in genome size variation in the genus Oryza.

Science.gov (United States)

Zuccolo, Andrea; Sebastian, Aswathy; Talag, Jayson; Yu, Yeisoo; Kim, HyeRan; Collura, Kristi; Kudrna, Dave; Wing, Rod A

2007-08-29

The genus Oryza is composed of 10 distinct genome types, 6 diploid and 4 polyploid, and includes the world's most important food crop - rice (Oryza sativa [AA]). Genome size variation in the Oryza is more than 3-fold and ranges from 357 Mbp in Oryza glaberrima [AA] to 1283 Mbp in the polyploid Oryza ridleyi [HHJJ]. Because repetitive elements are known to play a significant role in genome size variation, we constructed random sheared small insert genomic libraries from 12 representative Oryza species and conducted a comprehensive study of the repetitive element composition, distribution and phylogeny in this genus. Particular attention was paid to the role played by the most important classes of transposable elements (Long Terminal Repeats Retrotransposons, Long interspersed Nuclear Elements, helitrons, DNA transposable elements) in shaping these genomes and in their contributing to genome size variation. We identified the elements primarily responsible for the most strikingly genome size variation in Oryza. We demonstrated how Long Terminal Repeat retrotransposons belonging to the same families have proliferated to very different extents in various species. We also showed that the pool of Long Terminal Repeat Retrotransposons is substantially conserved and ubiquitous throughout the Oryza and so its origin is ancient and its existence predates the speciation events that originated the genus. Finally we described the peculiar behavior of repeats in the species Oryza coarctata [HHKK] whose placement in the Oryza genus is controversial. Long Terminal Repeat retrotransposons are the major component of the Oryza genomes analyzed and, along with polyploidization, are the most important contributors to the genome size variation across the Oryza genus. Two families of Ty3-gypsy elements (RIRE2 and Atlantys) account for a significant portion of the genome size variations present in the Oryza genus.

Can Cd translocation in Oryza sativa L. be attenuated by arbuscular mycorrhizal fungi in the presence of EDTA?

Science.gov (United States)

Huang, Xiaochen; An, Guangnan; Zhu, Shishu; Wang, Li; Ma, Fang

2018-04-01

Arbuscular mycorrhizal (AM) fungi play an important role in plant tolerance of heavy metal contamination. In this study, a pot experiment was conducted to illustrate the effects of the two AM fungi species Funneliformis mosseae (Fm) and Rhizophagus irregularis (Ri) on plant growth of Oryza sativa L. either with or without ethylenediamine tetraacetate (EDTA) addition and during exposure to five Cd concentrations (in the range of 0-5 mg kg -1 ). The results showed that Fm inoculation achieved greater mycorrhizal colonization and mycorrhizal dependency indexes than Ri inoculation. In addition, the effects of AM fungi on Cd biosorption and translocation in rice were also investigated in the presence of EDTA. Despite cooperative adsorption, the Freundlich isotherm could describe the biosorption effects of Cd on rice roots regardless of AM fungi inoculation or EDTA addition. Cd concentrations in mycorrhizal roots increased but decreased in mycorrhizal shoots in contrast to the control treatment. Although EDTA addition negatively inhibited the uptake of Cd to mycorrhizal shoots, lower translocation factor (TF) and bioconcentration factor (BCF) were still observed in treatments with EDTA compared to control treatment. Our findings suggest that Ri and Fm inoculation enhanced Cd immobilization in the roots, thus preventing Cd entry into the food chain during exposure to low and high Cd stress, respectively.

Changes in gene expression and catalase activity in Oryza sativa L. under abiotic stress.

Science.gov (United States)

Vighi, I L; Benitez, L C; do Amaral, M N; Auler, P A; Moraes, G P; Rodrigues, G S; da Maia, L C; Pinto, L S; Braga, E J B

2016-11-03

Different rice (Oryza sativa L.) genotypes were subjected to high salinity and low temperature (150 mM NaCl and 13°C, respectively) for 0, 6, 24, 48, or 72 h. We evaluated the simultaneous expression of the genes OsCATA, OsCATB, and OsCATC, correlated gene expression with enzyme activity, and verified the regulation of these genes through identification of cis-elements in the promoter region. The hydrogen peroxide content increased in a tolerant genotype and decreased in a sensitive genotype under both stress conditions. Lipid peroxidation increased in the tolerant genotype when exposed to cold, and in the sensitive genotype when exposed to high salinity. Catalase activity significantly increased in both genotypes when subjected to 13°C. In the tolerant genotype, OsCATA and OsCATB were the most responsive to high salinity and cold, while in the sensitive genotype, OsCATA and OsCATC responded positively to saline stress, as did OsCATA and OsCATB to low temperature. Cis-element analysis identified different regulatory sequences in the catalase promoter region of each genotype. The sensitive genotype maintained a better balance between hydrogen oxyacid levels, catalase activity, and lipid peroxidation under low temperature than the resistant genotype. OsCATA and OsCATB were the most responsive in the salt-tolerant genotype to cold, OsCATA and OsCATC were the most responsive to saline stress, and OsCATA and OsCATB were the most responsive to chilling stress in the sensitive genotype. There were positive correlations between catalase activity and OsCATB expression in the tolerant genotype under saline stress and in the sensitive genotype under cold stress.

The response of rice (Oryza sativa L. to elevated night temperature with application of Pyraclostobin

Directory of Open Access Journals (Sweden)

T.Y. Wahjanto

2016-07-01

Full Text Available Rice productivity is having a problem related with climate change phenomenon, mainly the global warming. The rising of temperature in some country threat the rice production. The increasing of temperature is a major limiting factor that affects yield through the growth and development of rice plant. This study was aimed to examine the response of rice (Oryza sativa L. to elevated night temperature with the application of Pyraclostobin. A glasshouse experiment that was conducted from March to August 2015 at Brawijaya University Research Station of Jatikerto – Malang, used nested plot design with three replications and two treatments. The first treatments were the night temperature level (normal temperature, increased 2oC, and increased 4oC. The second treatments were the concentration of Pyraclostrobin (0 ppm, 400 ppm and 800 ppm. Results of the study showed that the increase of temperature at night for about 2oC and 4oC, as well as application of Pyraclostrobin, affected growth and yield of rice. Application of Pyraclostrobin by concentrations of 400 ppm and 800 ppm effectively reduced yield loss by increasing night temperature of 2oC, which resulted in 20.20% and 24.93%, respectively, in comparison with the control; while the increase of night temperature by 4oC have resulted 26.86% and 33.33% in comparison with the control. Pyraclostrobin was effective in maintaining percentage of the filled spikelets by the increase of temperature at night for about 2oC and 4oC.

PENETAPAN KADAR FENOLIK TOTAL DAN FLAVONOID TOTAL EKSTRAK BERAS HITAM (Oryza sativa L DARI KALIMANTAN SELATAN

Directory of Open Access Journals (Sweden)

Anna Khumaira Sari

2017-10-01

Full Text Available The black rice contains anthocyanin compounds which are included in the flavonoids and phenolic compounds. Flavonoids contained in black rice are phenolic components that act as a preventive of hydroxyl and superoxide radicals by protecting membrane lipids against damaging oxidation reactions and phenol compounds also have bacteriocid, antimetic, antihelmintic, antiinflammatory, antimicrobial, anticancer and other degenerative diseases. The aim of this research were to measure total phenolic content and total flavonoid in ethanol extract of black rice (Oryza sativa L. Total phenol content were measured by Folin-Ciocalteu method with gallic acid mean while total flavonoid content were measured by colorimetry method using reagent AlCl3 10% and 5% acetic acid. There are seven variation samples of black rice obtained from seven different places in South Kalimantan. The result of this study, qualitative analysis showed that all samples positive contained flavonoids, alkaloids and tannins. The total phenol content of the seven samples was 100,58 ± 1,344; 91.14 ± 1.699; 96.50 ± 1.529; 77.64 ± 0.462; 81,16 ± 0,614; 112.47 ± 1.040; 81,50 ± 2,928 mgGAE/mg extract and the percent of total flavonoid content from seven samples was 8,53 ± 0,208%; 8.11 ± 0.343%; 7.69 ± 0.446%; 6.03 ± 0.227%; 4.97 ± 0.169%; 3.74 ± 0.210%; 5.02 ± 0.403%.

Black Rice (Oryza sativa L., Poaceae) Extract Reduces Hippocampal Neuronal Cell Death Induced by Transient Global Cerebral Ischemia in Mice.

Science.gov (United States)

Hwang, Sun-Nyoung; Kim, Jae-Cheon; Bhuiyan, Mohammad Iqbal Hossain; Kim, Joo Youn; Yang, Ji Seon; Yoon, Shin Hee; Yoon, Kee Dong; Kim, Seong Yun

2018-04-01

Rice is the most commonly consumed grain in the world. Black rice has been suggested to contain various bioactive compounds including anthocyanin antioxidants. There is currently little information about the nutritional benefits of black rice on brain pathology. Here, we investigated the effects of black rice ( Oryza sativa L ., Poaceae) extract (BRE) on the hippocampal neuronal damage induced by ischemic insult. BRE (300 mg/kg) was orally administered to adult male C57BL/6 mice once a day for 21 days. Bilateral common carotid artery occlusion (BCCAO) was performed for 23 min on the 8th day of BRE or vehicle administration. Histological analyses conducted on the 22nd day of BRE or vehicle administration revealed that administering BRE profoundly attenuated neuronal cell death, inhibited reactive astrogliosis, and prevented loss of glutathione peroxidase expression in the hippocampus when compared to vehicle treatment. In addition, BRE considerably ameliorated BCCAO-induced memory impairment on the Morris water maze test from the 15th day to the 22nd day of BRE or vehicle administration. These results indicate that chronic administration of BRE is potentially beneficial in cerebral ischemia.

Risk assessment of potentially toxic element pollution in soils and rice (Oryza sativa) in a typical area of the Yangtze River Delta

International Nuclear Information System (INIS)

Hang Xiaoshuai; Wang Huoyan; Zhou Jianmin; Ma Chengling; Du Changwen; Chen Xiaoqin

2009-01-01

Soil pollution with potentially toxic elements (PTEs) resulting from rapid industrial development has caused major concerns. Selected PTEs and their accumulation and distribution in soils and rice (Oryza sativa) collected from Changshu, east China, were analyzed to evaluate the potential health risk to the local population. The soils were primarily contaminated with Hg, followed by Cu, Cd, Pb, and Zn. The concentrations of Pb, Hg, and Cd of 46, 32, and 1 rice samples exceeded their national maximum allowable levels in foods, respectively. Spatial distributions of total Cr, Cu, Pb, Zn, and Cd in soils shared similar geographical trends. The risk assessment of PTEs through rice consumption suggests that the concentrations of Cu, Pb, and Cd in some rice samples exceed their reference oral dose for adults and children. In general, there was no target hazard quotient value of any individual element that was greater than 1, but hazard index values for adults and children were 1.726 and 1.523, respectively. - Industrial development has led to increased risk from potentially toxic elements in soils and rice.

Characterization and evolutionary analysis of ent-kaurene synthase like genes from the wild rice species Oryza rufipogon.

Science.gov (United States)

Toyomasu, Tomonobu; Miyamoto, Koji; Shenton, Matthew R; Sakai, Arisa; Sugawara, Chizu; Horie, Kiyotaka; Kawaide, Hiroshi; Hasegawa, Morifumi; Chuba, Masaru; Mitsuhashi, Wataru; Yamane, Hisakazu; Kurata, Nori; Okada, Kazunori

2016-11-18

Cultivated rice (Oryza sativa) possesses various labdane-related diterpene synthase genes, homologs of ent-copalyl diphosphate synthase (CPS) and ent-kaurene synthase (KS) that are responsible for the biosynthesis of phytohormone gibberellins. The CPS homologs and KS like (KSL) homologs successively converted geranylgeranyl diphosphate to cyclic diterpene hydrocarbons via ent-copalyl diphosphate or syn-copalyl diphosphate in O. sativa. Consequently, a variety of labdane-related diterpenoids, including phytoalexin phytocassanes, momilactones and oryzalexins, have been identified from cultivated rice. Our previous report indicated that the biosynthesis of phytocassanes and momilactones is conserved in Oryza rufipogon, the progenitor of Asian cultivated rice. Moreover, their biosynthetic gene clusters, containing OsCPS2 and OsKSL7 for phytocassane biosynthesis and OsCPS4 and OsKSL4 for momilactone biosynthesis, are also present in the O. rufipogon genome. We herein characterized O. rufipogon homologs of OsKSL5, OsKSL6, OsKSL8 responsible for oryzalexin S biosynthesis, and OsKSL10 responsible for oryzalexins A-F biosynthesis, to obtain more evolutionary insight into diterpenoid biosynthesis in O. sativa. Our phytoalexin analyses showed that no accumulation of oryzalexins was detected in extracts from O. rufipogon leaf blades. In vitro functional analyses indicated that unlike OsKSL10, O. rufipogon KSL10 functions as an ent-miltiradiene synthase, which explains the lack of accumulation of oryzalexins A-F in O. rufipogon. The different functions of KSL5 and KSL8 in O. sativa japonica to those in indica are conserved in each type of O. rufipogon, while KSL6 functions (ent-isokaurene synthases) are well conserved. Our study suggests that O. sativa japonica has evolved distinct specialized diterpenoid metabolism, including the biosynthesis of oryzalexins. Copyright © 2016 Elsevier Inc. All rights reserved.

Expression, purification, crystallization and preliminary X-ray analysis of rice (Oryza sativa L.) Os4BGlu12 β-glucosidase

International Nuclear Information System (INIS)

Sansenya, Sompong; Ketudat Cairns, James R.; Opassiri, Rodjana

2010-01-01

Recombinant rice Os4BGlu12 β-glucosidase purified from E. coli was crystallized with and without 2,4-dinitrophenyl-2-deoxy-2-fluoro-β-d-glucopyranoside. Rice (Oryza sativa L.) Os4BGlu12, a glycoside hydrolase family 1 β-glucosidase (EC 3.2.1.21), was expressed as a fusion protein with an N-terminal thioredoxin/His 6 tag in Escherichia coli strain Origami B (DE3) and purified with subsequent removal of the N-terminal tag. Native Os4BGlu12 and its complex with 2,4-dinitrophenyl-2-deoxy-2-fluoro-β-d-glucopyranoside (DNP2FG) were crystallized using 19% polyethylene glycol (3350 or 2000, respectively) in 0.1 M Tris–HCl pH 8.5, 0.16 M NaCl at 288 K. Diffraction data sets for the apo and inhibitor-bound forms were collected to 2.50 and 2.45 Å resolution, respectively. The space group and the unit-cell parameters of the crystal indicated the presence of two molecules per asymmetric unit, with a solvent content of 50%. The structure of Os4BGlu12 was successfully solved in space group P4 3 2 1 2 by molecular replacement using the white clover cyanogenic β-glucosidase structure as a search model

The Perennial Ryegrass GenomeZipper – Targeted Use of Genome Resources for Comparative Grass Genomics

DEFF Research Database (Denmark)

Pfeiffer, Matthias; Martis, Mihaela; Asp, Torben

2013-01-01

(Lolium perenne) genome on the basis of conserved synteny to barley (Hordeum vulgare) and the model grass genome Brachypodium (Brachypodium distachyon) as well as rice (Oryza sativa) and sorghum (Sorghum bicolor). A transcriptome-based genetic linkage map of perennial ryegrass served as a scaffold......Whole-genome sequences established for model and major crop species constitute a key resource for advanced genomic research. For outbreeding forage and turf grass species like ryegrasses (Lolium spp.), such resources have yet to be developed. Here, we present a model of the perennial ryegrass...... to establish the chromosomal arrangement of syntenic genes from model grass species. This scaffold revealed a high degree of synteny and macrocollinearity and was then utilized to anchor a collection of perennial ryegrass genes in silico to their predicted genome positions. This resulted in the unambiguous...

Genetic study of resistance to inhibitory effects of UV radiation in rice (Oryza sativa)

International Nuclear Information System (INIS)

Sato, T.; Kang, H.S.; Kumagai, T.

1994-01-01

Genetic analysis of resistance to the inhibitory effects of UV radiation on growth of rice (Oryza sativa L.) cultivars was carried out. Some experimental plants were grown in visible radiation supplemented with UV radiation containing a large amount of UV-B and a small amount of UV-C in a phytotron, while others were grown without UV radiation. The degree of resistance to UV radiation was estimated in terms of the degree of reduction caused by supplemental UV radiation in the fresh weight of the aboveground plant parts and the chlorophyll content per unit fresh weight. Fresh weight and chlorophyll content in F 2 plants generated by reciprocally crossing cv. Sasanishiki, a cultivar more resistant to UV radiation, and Norin 1, a cultivar less resistant to such radiation exhibited a normal frequency distribution. The heritabilities of these two properties in F 2 plants were low under conditions of non-supplemental UV radiation. Under elevated UV radiation, the F 2 population shifted to the lower range of fresh weight and chlorophyll content, and the means were close to those of Norin 1. The heritabilities of these two properties were the same in the reciprocal crosses, indicating that maternal inheritance was not involved. Inheritance of chlorophyll content per unit fresh weight was further determined in F 3 lines generated by self-fertilizing F 2 plants of Sasanishiki and Norin 1. The results showed that the F 3 population was segregated into three genotypes, namely, resistant homozygotes, segregated heterozygotes and sensitive homozygotes, with a ratio of 1:65:16. It was thus evident that the resistance to the inhibitory effect of elevated UV radiation in these rice plants was controlled by recessive polygenes. (author)

Methodical characterization of rice ( Oryza sativa bran oil from Pakistan

Directory of Open Access Journals (Sweden)

Mahmood, Zahid

2005-06-01

Full Text Available The hexane-extracted oil content of four varieties of rice (Oryza sativa viz. Super Kernel, 386, 385 and Basmati, bran was ranged 14.70-19.10 %. Other physical and chemical parameters of the extracted oils were as follow: Iodine value 112.40, 109.80, 105.1 and 103.70; refractive index ( 40 °C 1.4650, 1.4680, 1.4657 and 1.4660; density ( 40 °C 0.919, 0.913, 0.909 and 0.911; saponification value 183, 177, 186 and 190; unsaponifiable matter 6.15, 5.60, 4.98 and 5.40 % respectively. Tocopherols ( α, γ and δ in the oils were: 284.00, 175.12, 180.42, 300.06; 83.40, 98.70, 120.70, 90.60; 75.16, 57.20, 39.32, 83.00 mg/kg respectively. The contents of tocotrienols ( α, γ and δ in the oils were: 120.30, 106.00, 95.20, 135.74; 196.00, 125.00, 210.0, 276.41; 72.50, 20.00, 39.30, 64.00 mg/kg respectively. The amount of γ - Oryzanol in the investigated oils was ranged 415.12-802.05 The induction periods (Rancimat, 20 L/h, 120 °C of the crude oils were 6.81, 5.99, 6.39 and 7.40 h respectively. The major sterol fractions of the oils consisted of campesterol ranged (10.10-19.20%, stigmasterol (14.00-19.28 %, b -sitosterol (49.30-58.20 %, and D5 ,avenasterol (8.14-13.05 %. The investigated varieties ( Super Kernel, 386, 385 and Basmati of rice bran oil were found to contain high levels of oleic acid 42.67, 38.59, 40.68 and 36.78 % followed by linoleic and palmitic acids 31.58, 33.80, 28.70, 30.51 and 17.00, 14.88, 19.63, 20.00 % respectively. The contents of myristic, stearic and arachidic acids was 1.50, 2.02, 4.28, 1.00; 2.64, 2.87, 4.02, 7.48; and 1.28, 3.00, 1.00, 1.00 % respectively. A number of parameters of the investigated rice bran oils indigenous to Pakistan were comparable to those of typical rice bran and some other vegetable oils, reported in the literature. The results of the present analysis as compared with those of different vegetable oils demonstrated rice bran to be a potential oil source and thus could be useful

Rubisco activity is associated with photosynthetic thermotolerance in a wild rice (Oryza meridionalis).

Science.gov (United States)

Scafaro, Andrew P; Yamori, Wataru; Carmo-Silva, A Elizabete; Salvucci, Michael E; von Caemmerer, Susanne; Atwell, Brian J

2012-09-01

Oryza meridionalis is a wild species of rice, endemic to tropical Australia. It shares a significant genome homology with the common domesticated rice Oryza sativa. Exploiting the fact that the two species are highly related but O. meridionalis has superior heat tolerance, experiments were undertaken to identify the impact of temperature on key events in photosynthesis. At an ambient CO(2) partial pressure of 38 Pa and irradiance of 1500 µmol quanta m(-2) s(-1), the temperature optimum of photosynthesis was 33.7 ± 0.8°C for O. meridionalis, significantly higher than the 30.6 ± 0.7°C temperature optimum of O. sativa. To understand the basis for this difference, we measured gas exchange and rubisco activation state between 20 and 42°C and modeled the response to determine the rate-limiting steps of photosynthesis. The temperature response of light respiration (R(light)) and the CO(2) compensation point in the absence of respiration (Γ(*)) were determined and found to be similar for the two species. C3 photosynthesis modeling showed that despite the difference in susceptibility to high temperature, both species had a similar temperature-dependent limitation to photosynthesis. Both rice species were limited by ribulose-1,5-bisphosphate (RuBP) regeneration at temperatures of 25 and 30°C but became RuBP carboxylation limited at 35 and 40°C. The activation state of rubisco in O. meridionalis was more stable at higher temperatures, explaining its greater heat tolerance compared with O. sativa. Copyright © Physiologia Plantarum 2012.

The rice XA21 ectodomain fused to the Arabidopsis EFR cytoplasmic domain confers resistance to Xanthomonas oryzae pv. oryzae.

Science.gov (United States)

Thomas, Nicholas C; Oksenberg, Nir; Liu, Furong; Caddell, Daniel; Nalyvayko, Alina; Nguyen, Yen; Schwessinger, Benjamin; Ronald, Pamela C

2018-01-01

Rice ( Oryza sativa ) plants expressing the XA21 cell-surface receptor kinase are resistant to Xanthomonas oryzae pv. oryzae (Xoo) infection. We previously demonstrated that expressing a chimeric protein containing the ELONGATION FACTOR Tu RECEPTOR (EFR) ectodomain and the XA21 endodomain (EFR:XA21) in rice does not confer robust resistance to Xoo . To test if the XA21 ectodomain is required for Xoo resistance, we produced transgenic rice lines expressing a chimeric protein consisting of the XA21 ectodomain and EFR endodomain (XA21:EFR) and inoculated these lines with Xoo . We also tested if the XA21:EFR rice plants respond to a synthetic sulfated 21 amino acid derivative (RaxX21-sY) of the activator of XA21-mediated immunity, RaxX. We found that five independently transformed XA21:EFR rice lines displayed resistance to Xoo as measured by lesion length analysis, and showed that five lines share characteristic markers of the XA21 defense response (generation of reactive oxygen species and defense response gene expression) after treatment with RaxX21-sY. Our results indicate that expression of the XA21:EFR chimeric receptor in rice confers resistance to Xoo . These results suggest that the endodomain of the EFR and XA21 immune receptors are interchangeable and the XA21 ectodomain is the key determinant conferring robust resistance to Xoo .

All roads lead to weediness: patterns of genomic divergence reveal extensive recurrent weedy rice origins from South Asian Oryza

Science.gov (United States)

Weedy rice (Oryza spp.), a weedy relative of cultivated rice (O. sativa), invades and persists in cultivated rice fields worldwide. Many weedy rice populations have evolved similar adaptive traits, considered part of the “agricultural weed syndrome,” making this an ideal model to study the genetic b...

Exogenous application of rutin and gallic acid regulate antioxidants and alleviate reactive oxygen generation in Oryza sativa L.

Science.gov (United States)

Singh, Akanksha; Gupta, Rupali; Pandey, Rakesh

2017-04-01

The effect of rutin and gallic acid on growth, phytochemical and defense gene activation of rice ( Oryza sativa L.) was investigated. The seeds of rice were primed with different concentrations of rutin and gallic acid (10-60 µg mL -1 ) to explicate the effect on germination on water agar plates. Further, to study the effect of most effective concentrations of gallic acid (60 µg mL -1 ) and rutin (50 µg mL -1 ), greenhouse pot experiment was set up to determine the changes in growth, antioxidant and defense parameters. The results revealed more pronounced effect of gallic acid on total chlorophyll and carotenoids as well as on total flavonoid content and free radical scavenging activities. Gene expression analysis of OsWRKY71, PAL, CHS and LOX genes involved in strengthening the plant defense further validated the results obtained from the biochemical analysis. Microscopic analysis also confirmed reduction in total reactive oxygen species, free radicals like H 2 O 2 and O 2 - by exogenous application of gallic acid and rutin. The data obtained thus suggest that both gallic acid and rutin can affect the growth and physiology of rice plants and therefore can be used to develop effective plant growth promoters and as substitute of biofertilizers for maximizing their use in field conditions.

Engineering the Oryza sativa cell wall with rice NAC transcription factors regulating secondary wall formation

Directory of Open Access Journals (Sweden)

Kouki eYoshida

2013-10-01

Full Text Available Plant tissues that require structural rigidity synthesize a thick, strong secondary cell wall of lignin, cellulose and hemicelluloses in a complicated bridged structure. Master regulators of secondary wall synthesis were identified in dicots, and orthologs of these regulators have been identified in monocots, but regulation of secondary cell wall formation in monocots has not been extensively studied. Here we demonstrate that the rice transcription factors SECONDARY WALL NAC DOMAIN PROTEINs (SWNs can regulate secondary wall formation in rice (Oryza sativa and are potentially useful for engineering the monocot cell wall. The OsSWN1 promoter is highly active in sclerenchymatous cells of the leaf blade and less active in xylem cells. By contrast, the OsSWN2 promoter is highly active in xylem cells and less active in sclerenchymatous cells. OsSWN2 splicing variants encode two proteins; the shorter protein (OsSWN2S has very low transcriptional activation ability, but the longer protein (OsSWN2L and OsSWN1 have strong transcriptional activation ability. In rice, expression of an OsSWN2S chimeric repressor, driven by the OsSWN2 promoter, resulted in stunted growth and para-wilting (leaf rolling and browning under normal water conditions due to impaired vascular vessels. The same OsSWN2S chimeric repressor, driven by the OsSWN1 promoter, caused a reduction of cell wall thickening in sclerenchymatous cells, a drooping leaf phenotype, reduced lignin and xylose contents and increased digestibility as forage. These data suggest that OsSWNs regulate secondary wall formation in rice and manipulation of OsSWNs may enable improvements in monocotyledonous crops for forage or biofuel applications.

Growth promotion and inhibition of the Amazonian wild rice species Oryza grandiglumis to survive flooding.

Science.gov (United States)

Okishio, Takuma; Sasayama, Daisuke; Hirano, Tatsuya; Akimoto, Masahiro; Itoh, Kazuyuki; Azuma, Tetsushi

2014-09-01

In Asian cultivated rice (Oryza sativa), distinct mechanisms to survive flooding are activated in two groups of varieties. Submergence-tolerant rice varieties possessing the SUBMERGENCE1A (SUB1A) gene display reduced growth during flash floods at the seedling stage and resume growth after the flood recedes, whereas deepwater rice varieties possessing the SNORKEL1 (SK1) and SNORKEL2 (SK2) genes display enhanced growth based on internodal elongation during prolonged submergence at the mature stage. In this study, we investigated the occurrence of these growth responses to submergence in the wild rice species Oryza grandiglumis, which is native to the Amazon floodplains. When subjected to gradual submergence, adult plants of O. grandiglumis accessions showed enhanced internodal elongation with rising water level and their growth response closely resembled that of deepwater varieties of O. sativa with high floating capacity. On the other hand, when subjected to complete submergence, seedlings of O. grandiglumis accessions displayed reduced shoot growth and resumed normal growth after desubmergence, similar to the response of submergence-tolerant varieties of O. sativa. Neither SUB1A nor the SK genes were detected in the O. grandiglumis accessions. These results indicate that the O. grandiglumis accessions are capable of adapting successfully to flooding by activating two contrasting mechanisms as the situation demands and that each mechanism of adaptation to flooding is not mediated by SUB1A or the SK genes.

Transgenic sorghum ( Sorghum bicolor L. Moench) developed by ...

African Journals Online (AJOL)

Sorghum (Sorghum bicolor (L.) Moench) is an important food and fodder crop. Fungal diseases such as anthracnose caused by Colletotrichum sublineolum reduce sorghum yields. Genetic transformation can be used to confer tolerance to plant diseases such as anthracnose. The tolerance can be developed by introducing ...

Arsenate exposure affects amino acids, mineral nutrient status and antioxidants in rice (Oryza sativa L.) genotypes.

Science.gov (United States)

Dwivedi, S; Tripathi, R D; Tripathi, P; Kumar, A; Dave, R; Mishra, S; Singh, R; Sharma, D; Rai, U N; Chakrabarty, D; Trivedi, P K; Adhikari, B; Bag, M K; Dhankher, O P; Tuli, R

2010-12-15

Simulated pot experiments were conducted on four rice (Oryza sativa L.) genotypes (Triguna, IR-36, PNR-519, and IET-4786) to examine the effects of As(V) on amino acids and mineral nutrient status in grain along with antioxidant response to arsenic exposure. Rice genotypes responded differentially to As(V) exposure in terms of amino acids and antioxidant profiles. Total amino acid content in grains of all rice genotypes was positively correlated with arsenic accumulation. While, most of the essential amino acids increased in all cultivars except IR-36, glutamic acid and glycine increased in IET-4786 and PNR-519. The level of nonprotein thiols (NPTs) and the activities of superoxide dismutase (SOD; EC 1.15.1.1), glutathione reductase (GR; EC 1.6.4.2) and ascorbate peroxidase (APX; EC 1.11.1.11) increased in all rice cultivars except IET-4786. A significant genotypic variation was also observed in specific arsenic uptake (SAU; mg kg(-1)dw), which was in the order of Triguna (134) > IR-36 (71) > PNR-519 (53) > IET-4786 (29). Further, application of As(V) at lower doses (4 and 8 mg L(-1) As) enhanced the accumulation of selenium (Se) and other nutrients (Fe, P, Zn, and S), however, higher dose (12 mg L(-1) As) limits the nutrient uptake in rice. In conclusion, low As accumulating genotype, IET-4786, which also had significantly induced level of essential amino acids, seems suitable for cultivation in moderately As contaminated soil and would be safe for human consumption.

Risk Assessment of Heavy Metals Contamination in Paddy Soil, Plants, and Grains (Oryza sativa L.) at the East Coast of India

Science.gov (United States)

Satpathy, Deepmala; Reddy, M. Vikram; Dhal, Soumya Prakash

2014-01-01

Heavy metals known to be accumulated in plants adversely affect human health. This study aims to assess the effects of agrochemicals especially chemical fertilizers applied in paddy fields, which release potential toxic heavy metals into soil. Those heavy metals get accumulated in different parts of paddy plant (Oryza sativa L.) including the grains. Concentrations of nonessential toxic heavy metals (Cd, Cr, and Pb) and the micronutrients (Cu, Mn, and Zn) were measured in the paddy field soil and plant parts. Mn and Cd are found to be accumulated more in shoot than in root. The metal transfer factors from soil to rice plant were significant for Pb, Cd, Cu, Cr, Mn, and Zn. The ranking order of bioaccumulation factor (BAF) for heavy metals was Zn > Mn > Cd > Cu > Cr > Pb indicating that the accumulation of micronutrients was more than that of nonessential toxic heavy metals. The concentrations of heavy metals were found to be higher in paddy field soils than that of the nearby control soil but below permissible limits. The higher Health Index (HI) values of rice consuming adults (1.561) and children (1.360) suggest their adverse health effects in the near future. PMID:24995308

Determination of residues of imazapic and imazaphic in rice (Oryza sativa) by HPLC

International Nuclear Information System (INIS)

Silva Trejos, Paulina

2005-01-01

A requirement to introduce a pesticide in the harvest of any product for the human consume is imperative to determine that it will not leave residues that can injure the human healthy. In this research the residues of imazapic and imazapyr, both systemic herbicides of the imidazolinone family, were determined in rice (Oryza sativa) by extraction of the samples with the extraction solvent prepared by mixing 40 mL of HC1 1 N, 2400 mL of methanol pesticide grade and 1560 mL of bidistilled water. An aliquot of the extract was concentrated approximately to 10 mL in a rotary evaporator; water was added to the concentrated extract and dissolution to 10 % m/v of lead acetate and it was regulated the pH to 6,2 with dissolution of NaOH 1 N. This dissolution was centrifuged and from the floating liquid and aliquot was measured to regulate the pH to 2,1 with dissolution of HC1 1 N. After it was extracted with dichlormethan and the join extracts were carried to dryness in the rotary evaporator. The residues were dissolved in ultrapure water of pH 2,5 and they were injected in HPLC chromatograph with a C 8 column. The validation of the analytical method obtained were: 5,1 x 10 -2 to 5,1 x 10 -3 μg/mL for linearity; (1,5 x 10 -3 , 5,0 x 10 -3 , 7,8 x 10 -3 , 2,6 x 10 -2 ) μg/mL for imazapyr and imazapic for the detection and quantification limits equivalent to 5,0 x 10 -2 mg/kg in rice; the percent of recovery were 80 % and 125 %, for imazapyr and imazapic and finally, the precision for the retention time, the area and for concentration were: 0,003 % standard deviations, 18 500 and 0,008, respectively. (author) [es

Selección preliminar de plantas de arroz con resistencia vertical A pyricularia oryzae Cav por inducción de mutaciones (ING

Directory of Open Access Journals (Sweden)

A Cruz

2016-03-01

Full Text Available Seeds of rice Oryza sativa L. cv. CR-1113 susceptible to blast disease Pyricularia oryzae Cav. Were subjected to gamma radiation with 60Co using doses of 15 and 20 krads to obtain and select mutant plants with vertical resistance to blast. A total of 80.000 rice plants per treatment were individually evaluated in the second mutant generation (M2 at tillering and panicle emergence. Vertical resistance was observed in 47 and 8 plants from the 15 and 20 krads treatments respectively.

Analysis of transactivation potential of rice (Oryza sativa L.) heat shock factors.

Science.gov (United States)

Lavania, Dhruv; Dhingra, Anuradha; Grover, Anil

2018-06-01

Based on yeast one-hybrid assays, we show that the presence of C-terminal AHA motifs is not a prerequisite for transactivation potential in rice heat shock factors. Transcriptional activation or transactivation (TA) of heat stress responsive genes takes place by binding of heat shock factors (Hsfs) to heat shock elements. Analysis of TA potential of thirteen rice (Oryza sativa L.) Hsfs (OsHsfs) carried out in this study by yeast one-hybrid assay showed that OsHsfsA3 possesses strong TA potential while OsHsfs A1a, A2a, A2b, A4a, A4d, A5, A7b, B1, B2a, B2b, B2c and B4d lack TA potential. From a near complete picture of TA potential of the OsHsf family (comprising of 25 members) emerging from this study and an earlier report from our group (Mittal et al. in FEBS J 278(17):3076-3085, 2011), it is concluded that (1) overall, six OsHsfs, namely A3, A6a, A6b, A8, C1a and C1b possess TA potential; (2) four class A OsHsfs, namely A3, A6a, A6b and A8 have TA potential out of which A6a and A6b contain AHA motifs while A3 and A8 lack AHA motifs; (3) nine class A OsHsfs, namely A1a, A2a, A2b, A2e, A4a, A4d, A5, A7a and A7b containing AHA motif(s) lack TA function in the yeast assay system; (4) all class B OsHsfs lack AHA motifs and TA potential (B4a not analyzed) and (5) though all class C OsHsf members lack AHA motifs, two members C1a and C1b possess TA function, while one member C2a lacks TA potential (C2b not analyzed). Thus, the presence or absence of AHA motif is possibly not the only factor determining TA potential of OsHsfs. Our findings will help to identify the transcriptional activators of rice heat shock response.

NCBI nr-aa BLAST: CBRC-OSAT-07-0071 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OSAT-07-0071 ref|NP_001060484.1| Os07g0650600 [Oryza sativa (japonica cultivar...-group)] dbj|BAC20065.2| BLE2 protein [Oryza sativa (japonica cultivar-group)] dbj|BAD32037.1| BLE2 protein [Oryza sativa (jap...onica cultivar-group)] dbj|BAF22398.1| Os07g0650600 [Oryza sativa (japonica cultivar-group)] NP_001060484.1 0.0 59% ...

Competition between rice (Oryza sativa L.) and (barnyardgrass (Echinochloa crus-galli (L.) P. Beauv.) as affected by methanol foliar application.

Science.gov (United States)

Rezaeieh, Alireza D; Aminpanah, Hashem; Sadeghi, Seyed M

2015-01-01

Pot experiment was conducted in Iran, to evaluate the effect of methanol on competition between rice (Oryza sativa) and barnyardgrass (Echinochloa crus-galli). The experiment was conducted as a randomized complete block design with a factorial treatment arrangement and three replicates. Factors were two aqueous methanol foliar applications (0, and 14% v/v) and five rice: barnyardgrass ratios (100:0, 75:25, 50:50, 25:6, and 0:100). Replacement series diagrams for aboveground dry weight illustrated that 'Shiroudi' was more competitive than barnyardgrass as averaged across methanol foliar applications. When methanol was not sprayed, the lines for 'Shiroudi' and barnyardgrass intersected at 75:25 rice: barnyardgrass ratio, but when methanol was sprayed at 14% v/v, the lines for 'Shiroudi' and barnyardgrass intersect at the left of the 75:25 rice: barnyardgrass mixture proportion. These indicate that methanol application reduced competitive ability of 'Shiroudi' against barnyardgrass for aboveground biomass accumulation. At the same time, Methanol foliar application significantly reduced the relative crowding coefficient of 'Shiroudi' while simultaneously it significantly increased the relative crowding coefficient of barnyard grass. This indicates that methanol foliar application reduced the competitive ability of 'Shiroudi' against barnyardgrass for shoot biomass accumulation. This experiment illustrated that foliar spray of aqueous methanol can not be recommended for rice under weedy conditions.

Screening of Oryza sativa L. for HptGene and Evaluation of Hpt Positive Samples Using Houba Retransposon-Based IRAP Markers

Directory of Open Access Journals (Sweden)

Gözde YÜZBAŞIOĞLU

2017-02-01

Full Text Available Increasing world population needs to enhance agricultural production because of food starvation. Genetically modified organism(GMOis a way to solve this problem. During gene transfers, DNA is inserted into a plant’s genome in a random way. Thisproducesspontaneous genetic changeswith movement of transposable elements, and even increasesvariations. Houbawas described as one of the active retrotransposonsin rice. The aim of this study was to screen rice samples collected from Turkey, and analyse Houba retrotransposon movements with IRAP technique intransgenic ones and their controls. For this purpose, 71 different rice seeds obtained from different regions of Turkey were used for GMO analysis.All samples were screened by real time PCR to test cauliflower mosaic virus (CaMV 35S promoter (P-35S regions, T-NOS (nopaline synthase terminator regions, figwort mosaic virus (FMV regions, bar, patand Cry1ab/ac,and hpt(hygromycin resistance genes. Hptgene was identified in 6samples as a result of real time PCR analysis. These 6transgenic samples with their controls were used for IRAP-PCRanalysisand 0-56% polymorphism ratios were observed in analysed samples. This study is one of the first detailed experimental data of transgenic Oryza sativaL. samples in terms of retrotransposon-based variation.

Isolation and Expression analysis of OsPME1, encoding for a putative Pectin Methyl Esterase from Oryza sativa (subsp. indica).

Science.gov (United States)

Kanneganti, Vydehi; Gupta, Aditya Kumar

2009-04-01

Pectin Methyl Esterases (PMEs) play an essential role during plant development by affecting the mechanical properties of the plant cell walls. Recent studies indicated that PMEs play important role in pollen tube development. In this study, we isolated a 1.3 kb cDNA clone from rice panicle cDNA library. It contained a 1038 bp of open reading frame (ORF) encoding for a putative pectin methyl esterase of 345 aminoacids with a 20 aminoacid signal peptide and was hence designated as OsPME1 (Oryza sativaPectin Methyl Esterase 1). It contained the structural arrangement GXYXE and GXXDFIF, found in the active groups of all PMEs. OsPME1 gene product shared varying identities, ranging from 52 % to 33 % with PMEs from other plant species belonging to Brassicaceae, Fabaceae, Amaranthaceae and Funariaceae. Southern blot analysis indicated that PME1 exists as a single copy in the rice genome. Expression pattern analysis revealed that OsPME1 is expressed only in pollen grains, during the later stages of their development and was also regulated by various abiotic stress treatments and phytohormones. Functional characterization of this pollen specific PME from rice would enable us to understand its role in pollen development.

Characterization of High-Value Bioactives in Some Selected Varieties of Pakistani Rice (Oryza sativa L.)

Science.gov (United States)

Zubair, Muhammad; Anwar, Farooq; Ashraf, Muhammad; Uddin, Md. Kamal

2012-01-01

The present study reports the composition and variation of fatty acids, sterols, tocopherols and γ-oryzanol among selected varieties namely Basmati Super, Basmati 515, Basmati 198, Basmati 385, Basmati 2000, Basmati 370, Basmati Pak, KSK-139, KS-282 and Irri-6 of Pakistani rice (Oryza sativa L). Oil content extracted with n-hexane from different varieties of brown rice seed (unpolished rice) ranged from 1.92% to 2.72%. Total fatty acid contents among rice varieties tested varied between 18240 and 25840 mg/kg brown rice seed. The rice tested mainly contained oleic (6841–10952 mg/kg) linoleic (5453–7874 mg/kg) and palmitic acid (3613–5489 mg/kg). The amounts of total phytosterols (GC and GC-MS analysis), with main contribution from β-sitosterol (445–656 mg/kg), campesterol (116–242 mg/kg), Δ5-avenasterol (89–178 mg/kg) and stigmasterol (75–180 mg/kg) were established to be 739.4 to 1330.4 mg/kg rice seed. The content of α-, γ- and δ-tocopherols as analyzed by HPLC varied from 39.0–76.1, 21.6–28.1 and 6.5–16.5 mg/kg rice seed, respectively. The amounts of different γ-oryzanol components (HPLC data), identified as cycloartenyl ferulate, 24-methylene cycloartanyl ferulate, campesteryl ferulate and β-sitosteryl ferulate, were in the range of 65.5–103.6, 140.2–183.1, 29.8–45.5 and 8.6–10.4 mg/kg rice seed, respectively. Overall, the concentration of these bioactives was higher in the Basmati rice cultivars showing their functional food superiority. In conclusion, the tested varieties of Pakistani rice, especially the Basmati cultivars, can provide best ingredients for functional foods. PMID:22605998

Characterization of High-Value Bioactives in Some Selected Varieties of Pakistani Rice (Oryza sativa L.

Directory of Open Access Journals (Sweden)

Md. Kamal Uddin

2012-04-01

Full Text Available The present study reports the composition and variation of fatty acids, sterols, tocopherols and γ-oryzanol among selected varieties namely Basmati Super, Basmati 515, Basmati 198, Basmati 385, Basmati 2000, Basmati 370, Basmati Pak, KSK-139, KS-282 and Irri-6 of Pakistani rice (Oryza sativa L. Oil content extracted with n-hexane from different varieties of brown rice seed (unpolished rice ranged from 1.92% to 2.72%. Total fatty acid contents among rice varieties tested varied between 18240 and 25840 mg/kg brown rice seed. The rice tested mainly contained oleic (6841–10952 mg/kg linoleic (5453–7874 mg/kg and palmitic acid (3613–5489 mg/kg. The amounts of total phytosterols (GC and GC-MS analysis, with main contribution from β-sitosterol (445–656 mg/kg, campesterol (116–242 mg/kg, ∆5-avenasterol (89–178 mg/kg and stigmasterol (75–180 mg/kg were established to be 739.4 to 1330.4 mg/kg rice seed. The content of α-, γ- and δ-tocopherols as analyzed by HPLC varied from 39.0–76.1, 21.6–28.1 and 6.5–16.5 mg/kg rice seed, respectively. The amounts of different γ-oryzanol components (HPLC data, identified as cycloartenyl ferulate, 24-methylene cycloartanyl ferulate, campesteryl ferulate and β-sitosteryl ferulate, were in the range of 65.5–103.6, 140.2–183.1, 29.8–45.5 and 8.6–10.4 mg/kg rice seed, respectively. Overall, the concentration of these bioactives was higher in the Basmati rice cultivars showing their functional food superiority. In conclusion, the tested varieties of Pakistani rice, especially the Basmati cultivars, can provide best ingredients for functional foods.

Field performance of selected mutants of sorghum and rice. Field evaluation review

International Nuclear Information System (INIS)

1996-10-01

Agricultural research conducted in Mali by the Institute Polytechnique Rural (IPR) and the Institute d'Economie Rural (IER), from improvement of sorghum and African rice (Oryza glaberrima) with some Agency support, resulted in several advanced generations of sorghum and African rice with improved characteristics, including high yield. Project MLI/5/014 aims at further supporting both institutions to advance these promising results, particularly by supporting multi-location field trials to select high yielding plant varieties, and by adding capability in tissue culture techniques for advanced mutation breeding as well as in the use of nuclear techniques in soil studies. The project was approved in 1995, as a model project and the current budget for the Agency's input amounts to $469,300 until 1997. The disbursements up to April 1996 amount to $168,991. The present mid-term evaluation aims at assessing the progress of the project towards its intended objectives and overall goal and the evaluation methodology applied was based on the Logical Framework Approach for project design. Figs, tabs

Determination of contents and antioxidant activity of free and bound phenolics compounds and in vitro digestibility of commercial black and red rice (Oryza sativa L.) varieties.

Science.gov (United States)

Sumczynski, Daniela; Kotásková, Eva; Družbíková, Helena; Mlček, Jiří

2016-11-15

Black and red rices (Oryza sativa L.) were analysed for total flavonoids and phenolics and the HPLC profile including both free and bound phenolic fractions. Moreover, antioxidant activity and in vitro digestibility was determined. Content of flavonoids and polyphenols as well as antioxidant activity was higher in free phenolic fractions. Bound flavonoids in black rices were not significant contributors to antioxidant activity. The main free phenolics in black rices were ferulic, protocatechuic and trans-p-coumaric acids, while the major free phenolics in red rices were catechin, protocatechuic and caffeic acids. The main bound phenolics in black rices were ferulic and vanillic acids and quercetin, in red rice types, they were ferulic, syringic, trans-p-coumaric acids and quercetin. Newly, the presence of m-coumaric acid in red rices was detected. Steam cooked rices showed very high levels of organic matter digestibility, whereas red rices were significantly more digestible than black rices (p<0.05). Copyright © 2016 Elsevier Ltd. All rights reserved.

Biogenic synthesis, characterization of silver nanoparticles using multani mitti (fullers earth), tomato (solanum lycopersicum) seeds, rice husk (oryza sativa) and evaluation of their potential antimicrobial activity

International Nuclear Information System (INIS)

Dar, P.; Hina, A.; Anwar, J.

2016-01-01

The synthesis of silver nanoparticles of three different biogenic materials Multani mitti (Fullers earth), Tomato (Solanum lycopersicum) seeds, Rice Husk (Oryza sativa) was carried out. The possible presence and variability of comprehensive biomolecules in these materials turned as capping and reducing agents which optimize the reduction rate and stabilization of silver nanoparticles. Characterizations were determined by using ultraviolet-visible (UV-Vis) spectroscopy, Scanning electron microscope (SEM), Fourier transform infrared spectroscopy (FTIR) and X-ray diffraction (XRD). Stable silver nanoparticles of average size 4.6, 41.1 and 10.6 nm were obtained for Multani mitti, tomato seeds and rice husk respectively. Phenolic and carboxylic biomolecules were identified as active reducing agents of Ag+2 to Ag0. The antimicrobial activity was carried out against Klebsiella pneumonia, Salmonella enterica, Escherichia coli and Staphylococcus aureus strains by using well diffusion method. Maximum zone of inhibition (ZOI) was found against Staphylococcus aureus by all of the three biogenic materials. (author)

iTRAQ-based proteomic analysis reveals the mechanisms of silicon-mediated cadmium tolerance in rice (Oryza sativa) cells.

Science.gov (United States)

Ma, Jie; Sheng, Huachun; Li, Xiuli; Wang, Lijun

2016-07-01

Silicon (Si) can alleviate cadmium (Cd) stress in rice (Oryza sativa) plants, however, the understanding of the molecular mechanisms at the single-cell level remains limited. To address these questions, we investigated suspension cells of rice cultured in the dark environment in the absence and presence of Si with either short- (12 h) or long-term (5 d) Cd treatments using a combination of isobaric tags for relative and absolute quantitation (iTRAQ), fluorescent staining, and inductively coupled plasma mass spectroscopy (ICP-MS). We identified 100 proteins differentially regulated by Si under the short- or long-term Cd stress. 70% of these proteins were down-regulated, suggesting that Si may improve protein use efficiency by maintaining cells in the normal physiological status. Furthermore, we showed two different mechanisms for Si-mediated Cd tolerance. Under the short-term Cd stress, the Si-modified cell walls inhibited the uptake of Cd ions into cells and consequently reduced the expressions of glycosidase, cell surface non-specific lipid-transfer proteins (nsLTPs), and several stress-related proteins. Under the long-term Cd stress, the amount of Cd in the cytoplasm in Si-accumulating (+Si) cells was decreased by compartmentation of Cd into vacuoles, thus leading to a lower expression of glutathione S-transferases (GST). These results provide protein-level insights into the Si-mediated Cd detoxification in rice single cells. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

Influence of chelating ligands on arsenic uptake by hydroponically grown rice seedlings (Oryza sativa L.): a preliminary study

Energy Technology Data Exchange (ETDEWEB)

Rahman, Mohammad A.; Hasegawa, Hiroshi; Ueda, Kazumasa; Maki, Teruya [Graduate School of Natural Science and Technology, Kanazawa University, Kakuma, Kanazawa (Japan); Rahman, M.M. [Department of Botany, Faculty of Biological Sciences, Jahangirnagar University, Savar, Dhaka (Bangladesh)

2008-06-15

Ferric (oxyhydro-)oxides (FeO{sub x}) precipitate in the rhizosphere at neutral or alkaline pH and are adsorbed on the plant root surfaces. Consequently, the higher binding affinity of arsenate to FeO{sub x} and the low iron phytoavailability of the precipitated FeO{sub x} make the phytoremediation of arsenic difficult. In the present study, the influence of chelating ligands on arsenic and iron uptake by hydroponically grown rice seedlings (Oryza sativa L.) was investigated. When chelating ligands were not treated to the growth medium, about 63 and 71% of the total arsenic and iron were distributed in the root extract (outer root surfaces) of rice, respectively. On the other hand, ethylenediaminetetraacetic acid (EDTA), ethylenediaminedisuccinic acid (EDDS) and hydroxyiminodisuccinic acid (HIDS) desorbed a significant amount of arsenic from FeO{sub x} of the outer root surfaces. Therefore, the uptake of arsenic and iron into the roots and their subsequent translocation to the shoots of the rice seedlings increased significantly. The order of increasing arsenic uptake by chelating ligands was HIDS > EDTA > EDDS. Methylglycinediacetic acid (MGDA) and iminodisuccinic acid (IDS) might not be effective in arsenic solubilization from FeO{sub x}. The results suggest that EDDS and HIDS would be a good and environmentally safe choice to accelerate arsenic phytoavailability in the phytoremediation process because of their biodegradability and would be a competent alternative to the widely used non-biodegradable and environmentally persistent EDTA. (Abstract Copyright [2008], Wiley Periodicals, Inc.)

Improvement of nitrogen accumulation and metabolism in rice (Oryza sativa L.) by the endophyte Phomopsis liquidambari.

Science.gov (United States)

Yang, Bo; Ma, Hai-Yan; Wang, Xiao-Mi; Jia, Yong; Hu, Jing; Li, Xia; Dai, Chuan-Chao

2014-09-01

The fungal endophyte Phomopsis liquidambari can enhance nitrogen (N) uptake and metabolism of rice plants under hydroponic conditions. To investigate the effects of P. liquidambari on N accumulation and metabolism in rice (Oryza sativa L.) under field conditions during the entire growing season (S1, the seedling stage; S2, the tillering stage; S3, the heading stage; S4, the ripening stage), we utilized pot experiments to examine metabolic and physiological levels in both shoot and root tissues of rice, with endophyte (E+) and without endophyte (E-), in response to three different N levels. We found that under low-N treatment, P. liquidambari symbiosis increased the rice yield and N use efficiency by 12% and by 11.59%, respectively; that the total N contents in E+ rice plants at the four growth stages were separately increased by 29.05%, 14.65%, 21.06% and 18.38%, respectively; and that the activities of nitrate reductase and glutamine synthetase in E+ rice roots and shoots were significantly increased by fungal infection during the S1 to S3 stages. Moreover, P. liquidambari significantly increased the free NH4(+), NO3(-), amino acid and soluble protein contents in infected rice tissues under low-N treatment during the S1 to S3 stages. The obtained results offer novel data concerning the systemic changes induced by P. liquidambari in rice during the entire growth period and confirm the hypothesis that the rice-P. liquidambari interaction improved the N accumulation and metabolism of rice plants, consequently increasing rice N utilization in nutrient-limited soil. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

Comparative Mapping of Seed Dormancy Loci Between Tropical and Temperate Ecotypes of Weedy Rice (Oryza sativa L.

Directory of Open Access Journals (Sweden)

Lihua Zhang

2017-08-01

Full Text Available Genotypic variation at multiple loci for seed dormancy (SD contributes to plant adaptation to diverse ecosystems. Weedy rice (Oryza sativa was used as a model to address the similarity of SD genes between distinct ecotypes. A total of 12 quantitative trait loci (QTL for SD were identified in one primary and two advanced backcross (BC populations derived from a temperate ecotype of weedy rice (34.3°N Lat.. Nine (75% of the 12 loci were mapped to the same positions as those identified from a tropical ecotype of weedy rice (7.1°N Lat.. The high similarity suggested that the majority of SD genes were conserved during the ecotype differentiation. These common loci are largely those collocated/linked with the awn, hull color, pericarp color, or plant height loci. Phenotypic correlations observed in the populations support the notion that indirect selections for the wild-type morphological characteristics, together with direct selections for germination time, were major factors influencing allelic distributions of SD genes across ecotypes. Indirect selections for crop-mimic traits (e.g., plant height and flowering time could also alter allelic frequencies for some SD genes in agroecosystems. In addition, 3 of the 12 loci were collocated with segregation distortion loci, indicating that some gametophyte development genes could also influence the genetic equilibria of SD loci in hybrid populations. The SD genes with a major effect on germination across ecotypes could be used as silencing targets to develop transgene mitigation (TM strategies to reduce the risk of gene flow from genetically modified crops into weed/wild relatives.

Inhibition of cadmium ion uptake in rice (Oryza sativa) cells by a wall-bound form of silicon.

Science.gov (United States)

Liu, Jian; Ma, Jie; He, Congwu; Li, Xiuli; Zhang, Wenjun; Xu, Fangsen; Lin, Yongjun; Wang, Lijun

2013-11-01

The stresses acting on plants that are alleviated by silicon (Si) range from biotic to abiotic stresses, such as heavy metal toxicity. However, the mechanism of stress alleviation by Si at the single-cell level is poorly understood. We cultivated suspended rice (Oryza sativa) cells and protoplasts and investigated them using a combination of plant nutritional and physical techniques including inductively coupled plasma mass spectrometry (ICP-MS), the scanning ion-selective electrode technique (SIET) and X-ray photoelectron spectroscopy (XPS). We found that most Si accumulated in the cell walls in a wall-bound organosilicon compound. Total cadmium (Cd) concentrations in protoplasts from Si-accumulating (+Si) cells were significantly reduced at moderate concentrations of Cd in the culture medium compared with those from Si-limiting (-Si) cells. In situ measurement of cellular fluxes of the cadmium ion (Cd(2+) ) in suspension cells and root cells of rice exposed to Cd(2+) and/or Si treatments showed that +Si cells significantly inhibited the net Cd(2+) influx, compared with that in -Si cells. Furthermore, a net negative charge (charge density) within the +Si cell walls could be neutralized by an increase in the Cd(2+) concentration in the measuring solution. A mechanism of co-deposition of Si and Cd in the cell walls via a [Si-wall matrix]Cd co-complexation may explain the inhibition of Cd ion uptake, and may offer a plausible explanation for the in vivo detoxification of Cd in rice. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.

Introduction of sorghum (Sorghum bicolor (L.) Moench) into China ...

African Journals Online (AJOL)

The sorghum is a plant, which has been intentionally introduced in China for foods needs. It is a plant of African origin, which is much cultivated in the northern hemisphere. For millions of people in the semiarid tropic temperature of Asia and Africa, sorghum is the most important staple food. Sorghum is becoming one of the ...

Identification of a Rice stripe necrosis virus resistance locus and yield component QTLs using Oryza sativa × O. glaberrima introgression lines

Directory of Open Access Journals (Sweden)

Prado Gustavo

2010-01-01

Full Text Available Abstract Background Developing new population types based on interspecific introgressions has been suggested by several authors to facilitate the discovery of novel allelic sources for traits of agronomic importance. Chromosome segment substitution lines from interspecific crosses represent a powerful and useful genetic resource for QTL detection and breeding programs. Results We built a set of 64 chromosome segment substitution lines carrying contiguous chromosomal segments of African rice Oryza glaberrima MG12 (acc. IRGC103544 in the genetic background of Oryza sativa ssp. tropical japonica (cv. Caiapó. Well-distributed simple-sequence repeats markers were used to characterize the introgression events. Average size of the substituted chromosomal segments in the substitution lines was about 10 cM and covered the whole donor genome, except for small regions on chromosome 2 and 4. Proportions of recurrent and donor genome in the substitution lines were 87.59% and 7.64%, respectively. The remaining 4.78% corresponded to heterozygotes and missing data. Strong segregation distortion was found on chromosomes 3 and 6, indicating the presence of interspecific sterility genes. To illustrate the advantages and the power of quantitative trait loci (QTL detection using substitution lines, a QTL detection was performed for scored traits. Transgressive segregation was observed for several traits measured in the population. Fourteen QTLs for plant height, tiller number per plant, panicle length, sterility percentage, 1000-grain weight and grain yield were located on chromosomes 1, 3, 4, 6 and 9. Furthermore, a highly significant QTL controlling resistance to the Rice stripe necrosis virus was located between SSR markers RM202-RM26406 (44.5-44.8 cM on chromosome 11. Conclusions Development and phenotyping of CSSL libraries with entire genome coverage represents a useful strategy for QTL discovery. Mapping of the RSNV locus represents the first identification

Quantitative Genetic Analysis for Yield and Yield Components in Boro Rice (Oryza sativa L.

Directory of Open Access Journals (Sweden)

Supriyo CHAKRABORTY

2010-03-01

Full Text Available Twenty-nine genotypes of boro rice (Oryza sativa L. were grown in a randomized block design with three replications in plots of 4m x 1m with a crop geometry of 20 cm x 20 cm between November-April, in Regional Agricultural Research Station, Nagaon, India. Quantitative data were collected on five randomly selected plants of each genotype per replication for yield/plant, and six other yield components, namely plant height, panicles/plant, panicle length, effective grains/panicle, 100 grain weight and harvest index. Mean values of the characters for each genotype were used for analysis of variance and covariance to obtain information on genotypic and phenotypic correlation along with coheritability between two characters. Path analyses were carried out to estimate the direct and indirect effects of boro rice�s yield components. The objective of the study was to identify the characters that mostly influence the yield for increasing boro rice productivity through breeding program. Correlation analysis revealed significant positive genotypic correlation of yield/plant with plant height (0.21, panicles/plant (0.53, panicle length (0.53, effective grains/panicle (0.57 and harvest index (0.86. Path analysis based on genotypic correlation coefficients elucidated high positive direct effect of harvest index (0.8631, panicle length (0.2560 and 100 grain weight (0.1632 on yield/plant with a residual effect of 0.33. Plant height and panicles/plant recorded high positive indirect effect on yield/plant via harvest index whereas effective grains/panicle on yield/plant via harvest index and panicle length. Results of the present study suggested that five component characters, namely harvest index, effective grains/plant, panicle length, panicles/plant and plant height influenced the yield of boro rice. A genotype with higher magnitude of these component characters could be either selected from the existing genotypes or evolved by breeding program for genetic

Effects of silicon on Oryza sativa L. seedling roots under simulated acid rain stress.

Science.gov (United States)

Ju, Shuming; Yin, Ningning; Wang, Liping; Zhang, Cuiying; Wang, Yukun

2017-01-01

Silicon (Si) has an important function in reducing the damage of environmental stress on plants. Acid rain is a serious abiotic stress factor, and Si can alleviate the stress induced by acid rain on plants. Based on these assumptions, we investigated the effects of silicon on the growth, root phenotype, mineral element contents, hydrogen peroxide (H2O2) and antioxidative enzymes of rice (Oryza sativa L.) seedling roots under simulated acid rain (SAR) stress. The results showed that the combined or single effects of Si and/or SAR on rice roots depend on the concentration of Si and the pH of the SAR. The combined or single effects of a low or moderate concentration of Si (1.0 or 2.0 mM) and light SAR (pH 4.0) enhanced the growth of rice roots, and the combined effects were stronger than those of the single treatment. A high concentration of Si (4.0 mM) or severe SAR (pH 2.0) exerted deleterious effects. The incorporation of Si (1.0, 2.0 or 4.0 mM) into SAR with pH 3.0 or 2.0 promoted the rice root growth, decreased the H2O2 content, increased the Si concentration and the superoxide dismutase (SOD), catalase (CAT), peroxidase (POD) and ascorbate peroxidase (APX) activities, maintained the balance of mineral element (K, Ca, Mg, Fe, Zn, and Cu) concentrations in the roots of rice seedlings compared with SAR alone. The alleviatory effects observed with a moderate concentration of Si (2.0 mM) were better than the effects obtained with a low or high concentration of Si (1.0 or 4.0 mM). The observed effects were due to disruptions in the absorption and utilization of mineral nutrients and impacts on the activity of antioxidant enzymes in roots, and this conclusion suggests that the degree of rice root damage caused by acid rain might be attributed to not only acid rain but also the level of Si in the soil.

Effects of silicon on Oryza sativa L. seedling roots under simulated acid rain stress

Science.gov (United States)

Wang, Liping; Zhang, Cuiying; Wang, Yukun

2017-01-01

Silicon (Si) has an important function in reducing the damage of environmental stress on plants. Acid rain is a serious abiotic stress factor, and Si can alleviate the stress induced by acid rain on plants. Based on these assumptions, we investigated the effects of silicon on the growth, root phenotype, mineral element contents, hydrogen peroxide (H2O2) and antioxidative enzymes of rice (Oryza sativa L.) seedling roots under simulated acid rain (SAR) stress. The results showed that the combined or single effects of Si and/or SAR on rice roots depend on the concentration of Si and the pH of the SAR. The combined or single effects of a low or moderate concentration of Si (1.0 or 2.0 mM) and light SAR (pH 4.0) enhanced the growth of rice roots, and the combined effects were stronger than those of the single treatment. A high concentration of Si (4.0 mM) or severe SAR (pH 2.0) exerted deleterious effects. The incorporation of Si (1.0, 2.0 or 4.0 mM) into SAR with pH 3.0 or 2.0 promoted the rice root growth, decreased the H2O2 content, increased the Si concentration and the superoxide dismutase (SOD), catalase (CAT), peroxidase (POD) and ascorbate peroxidase (APX) activities, maintained the balance of mineral element (K, Ca, Mg, Fe, Zn, and Cu) concentrations in the roots of rice seedlings compared with SAR alone. The alleviatory effects observed with a moderate concentration of Si (2.0 mM) were better than the effects obtained with a low or high concentration of Si (1.0 or 4.0 mM). The observed effects were due to disruptions in the absorption and utilization of mineral nutrients and impacts on the activity of antioxidant enzymes in roots, and this conclusion suggests that the degree of rice root damage caused by acid rain might be attributed to not only acid rain but also the level of Si in the soil. PMID:28291806

Identifikasi Transgene pada Tanaman Padi (oryza sativa var. koshihikari yang Ditransformasi dengan Bantuan Agrobacterium tumefaciens, Menggunakan Metode Tanpa Teknik Kultur Jaringan.

Directory of Open Access Journals (Sweden)

I Putu Suparthana

2015-04-01

Full Text Available Metode transformasi tanaman dengan bantuan Agrobacterium tumefaciens biasa dilakukan dengan melibatkan teknik kultur jaringan, akan tetapi teknik kultur jaringan memiliki beberapa kelemahan yaitu memerlukan suatu kondisi steril, memakan banyak waktu, sering terjadi mutasi dalam proses kultur in vitro dan sejumlah tanaman bersifat rekalsitran pada tahap regenerasi. Disisi lain metode baru (in planta transformation system yang dikembangkan dalam penelitian ini mampu mengatasi kelemahan-kelemahan tersebut. Penelitian dilakukan pada tanaman padi dengan bantuan A. tumefaciens sebagai inokulum namun tidak melibatkan teknik kultur jaringan pada masa regenerasinya. Biji padi (Oryza sativa L. var. Koshihikari direndam dalam air selama 2 hari, dengan demikian embrionya yang mengandung sel apikal meristem dapat diinokulasi dengan cara menusukkan jarum yang telah dicelupkan dalam inokulum. Biji padi yang telah diinokulasi selanjutnya ditumbuhkan dilapangan selayaknya pembenihan biasa tanpa perlakuan steril. Untuk menentukan keberhasilan teknik ini, dua jenis strain mutan A. tumefaciens (M-21 dan LBA4404 digunakan dalam transformasi. Mutan M-21 mengandung Tn5 tersisip dalam gen iaaM dan mutan LBA4404 membawa binari plasmid vektor. Transgen dari mutan M-21 dapat diidentifikasi dari perubahan fenotipe pada tanaman padi transgenik sedangkan dari mutan LBA4404 dapat diidentifikasi dengan uji histokimia dan ketahanan terhadap antibitik (hygromycin B.Kata kunci: in planta transformation, A. tumefaciens, transformation method

Overcoming the species hybridization barrier by ploidy manipulation in the genus Oryza.

Science.gov (United States)

Tonosaki, Kaoru; Sekine, Daisuke; Ohnishi, Takayuki; Ono, Akemi; Furuumi, Hiroyasu; Kurata, Nori; Kinoshita, Tetsu

2018-02-01

In most eudicot and monocot species, interspecific and interploidy crosses generally display abnormalities in the endosperm that are the major cause of a post-zygotic hybridization barrier. In some eudicot species, however, this type of hybridization barrier can be overcome by the manipulation of ploidy levels of one parental species, suggesting that the molecular mechanisms underlying the species hybridization barrier can be circumvented by genome dosage. We previously demonstrated that endosperm barriers in interspecific and interploidy crosses in the genus Oryza involve overlapping but different mechanisms. This result contrasts with those in the genus Arabidopsis, which shows similar outcomes in both interploidy and interspecific crosses. Therefore, we postulated that an exploration of pathways for overcoming the species hybridization barrier in Oryza endosperm, by manipulating the ploidy levels in one parental species, might provide novel insights into molecular mechanisms. We showed that fertile hybrid seeds could be produced by an interspecific cross of female tetraploid Oryza sativa and male diploid Oryza longistaminata. Although the rate of nuclear divisions did not return to normal levels in the hybrid endosperm, the timing of cellularization, nucellus degeneration and the accumulation of storage products were close to normal levels. In addition, the expression patterns of the imprinted gene MADS87 and YUCCA11 were changed when the species barrier was overcome. These results suggest that the regulatory machinery for developmental transitions and imprinted gene expression are likely to play a central role in overcoming species hybridization barriers by genome dosage in the genus Oryza. © 2017 The Authors The Plant Journal © 2017 John Wiley & Sons Ltd.

Ultrastructure of Oryza glumaepatula , a wild rice species endemic of tropical America

Directory of Open Access Journals (Sweden)

Ethel Sánchez

2005-06-01

Full Text Available Oryza glumaepatula is a perennial wild rice species,endemic to tropical America, previously known as the Latin American race of Oryza rufipogon .In Costa Rica, it is found in the northern region of the country, mainly in the wetland of the Medio Queso River, Los Chiles, Alajuela. It is diploid, of AA type genome and because of its genetic relatedness to cultivated rice it is included in the O.sativa complex. We describe the ultrastructure of leaf blade, spikelet, ligule and auricles. Special emphasis is given to those traits of major taxonomic value for O.glumaepatula and to those characters that distinguish this species from O. rufipogon and O. sativa . O. glumaepatula has a leaf blade covered with tombstone-shaped, oblong and spheroid epicuticular wax papillae. It has diamond-shaped stomata surrounded by spherical papillae, rows of zipper-like silica cells, bulky prickle trichomes of ca .40 mu m in length and small hirsute trichomes of ca. 32 mu m in length.The central vein is covered with large,globular papillae of ca. 146 mu m in length,a characteristic that distinguishes this species from O.rufipogon and O.sativa. The border of the leaf blade exhibits a row of even-sized bulky prickle trichomes of ca .42.5 mu m in length.Auricles have attenuated trichomes of ca .5.5 mm in length on the edges and small bicellular trichomes of 120 mu m in length on the surface.The ligule has a large number of short attenuated trichomes on its surface of 100 mu m in length.These latter two traits have important taxonomic value since they were found in O.glumaepatula but not found in O.sativa or in O.rufipogon . The spikelet has the typical morphology of the Oryza genus. Fertile lemmas have abundant spines, a trait shared with O.rufipogon but not with O.sativa. The sterile lemmas are wing-shaped with serrated borders,a characteristic that distinguishes this species from O. rufipogon and O.sativa. All the ultrastructure characters observed in O.glumaepatula from

Heavy metal phytoextraction-natural and EDTA-assisted remediation of contaminated calcareous soils by sorghum and oat.

Science.gov (United States)

Mahmood-Ul-Hassan, Muhammad; Suthar, Vishandas; Ahmad, Rizwan; Yousra, Munazza

2017-10-30

The abilities of sorghum (Sorghum bicolor L.) and oat (Avena sativa L.) to take up heavy metals from soils amended with ethylenediaminetetraacetic acid (EDTA) were assessed under greenhouse conditions. Both plants were grown in two soils contaminated with heavy metals (Gujranwala-silty loam and Pacca-clay loam). The soils were treated with 0, 0.625, 1.25, and 2.5 mM EDTA kg -1 soil applied at both 45 and 60 days after sowing (DAS); the experiment was terminated at 75 DAS. Addition of EDTA significantly increased concentrations of Cd, Cr, and Pb in roots and shoots, and bio-concentration factors and phytoextraction rates were also increased. Post-harvest soil analysis showed that soluble fractions of metals were also increased significantly. The increase in Cd was ≈ 3-fold and Pb was ≈ 15-fold at the highest addition of EDTA in Gujranwala soil; in the Pacca soil, the increase was less. Similarly, other phytoremediation factors, such as metal translocation, bio-concentration factor, and phytoextraction, efficiency were also maximum when soils were treated with 2.5 mM EDTA kg -1 soil. The study demonstrated that sorghum was better than oat for phytoremediation.

Possible cleavage sites of glutelin partial degradation confirmed by immunological analysis in globulin-less mutants of rice (Oryza sativa L.).

Science.gov (United States)

Khan, Nadar; Yamaguchi, Satoru; Katsube-Tanaka, Tomoyuki

2017-10-01

Proteolytic cleavage or partial degradation of proteins is one of the important post-translational modifications for various biological processes, but it is difficult to analyze. Previously, we demonstrated that some subunits of the major rice (Oryza sativa L.) seed storage protein glutelin are partially degraded to produce newly identified polypeptides X1-X5 in mutants in which another major seed storage protein globulin is absent. In this study, the new polypeptides X3 and X4/X5 were immunologically confirmed to be derived from GluA3 and GluA1/GluA2 subunits, respectively. Additionally, the new polypeptides X1 and X2 were at least in part the α polypeptides of the GluB4 subunit partially degraded at the C-terminus. Simulated 2D-PAGE migration patterns of intact and partially degraded α polypeptides based on the calculation of their MWs and pIs enabled us to narrow or predict the possible locations of cleavage sites. The predicted cleavage sites were also verified by the comparison of 2D-PAGE patterns between seed-extracted and E. coli-expressed proteins of the intact and truncated α polypeptides. The results and methodologies demonstrated here would be useful for analyses of partial degradation of proteins and the structure-function relationships of rice seed protein bodies. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Importance of seed-borne fungi of sorghum and pearl millet in Burkina Faso and their control using plant extracts

DEFF Research Database (Denmark)

Zida, Elisabeth Pawindé; Sérémé, Paco; Leth, Vibeke

2008-01-01

recorded on each crop by the blotter test. Six essential oils of plants were investigated for their inhibitory activity against eight pathogenic fungi. Thirty four and 27 fungal species were found in seed samples of sorghum and pearl millet, respectively. Phoma sp. and Fusarium moniliforme infected 95...... of pearl millet, respectively. Seeds inoculated with Acremonium strictum, Curvularia oryzae, F. equiseti, F. moniliforme and F. subglutinans and sown in sterilized soil, showed considerable mortality of the seedlings. Three essential oils inhibited in vitro the mycelial growth of all the fungi used by 85......Seed-borne fungi of sorghum and pearl millet in Burkina Faso were surveyed. A total of 188 seed samples from various locations, collected in 1989 (42) and 2002 (146), were tested, using the blotter, dry inspection and washing methods. Infection experiments were carried out with the major fungi...

Response of oxidative stress defense systems in rice (Oryza sativa) leaves with supplemental UV-B radiation

International Nuclear Information System (INIS)

Dai, Q.; Yan, B.; Huang, S.; Liu, X.; Peng, S.; Miranda, M.L.L.; Chavez, A.Q.; Vergara, B.S.; Olszyk, D.M.

1997-01-01

The impact of elevated ultraviolet-B radiation (UV-B, 280–320 nm) on membrane systems and lipid peroxidation, and possible involvement of active oxygen radicals was investigated in leaves of two UV-B susceptible rice cultivars (Oryza sativa L. cvs IR74 and Dular). Rice seedlings were grown in a greenhouse for 10 days and then treated with biologically effective UV-B (UV-B BE ) radiation for 28 days. Oxidative stress effects were evaluated by measuring superoxide anion (O 2 ) generation rate, hydrogen peroxide (H 2 O 2 ) content, malondialdehyde (MDA) concentration and relative electrolyte conductivity (EC) for IR74 and Dular at 0 (control), 6 or 13 kJ m −2 day −1 UV-B BE . Significant increases in these parameters were found in rice plants grown at 13 vs 0 kJ m −2 day −1 UV-B BE after 28 days; indicating that disruption of membrane systems may be an eventual reason for UV-B-induced injury in rice plants. There was a positive correlation between O 2 − generation and increases in EC or MDA in leaves. Activities of enzymatic and nonenzymatic free radical scavengers were measured for IR74 after 7, 14, 21 and 28 days of exposure to 13 or 0 UV-B BE to evaluate dynamics of these responses over time. Activities of catalase and superoxide dismutase (but not ascorbate peroxidase) and concentrations of ascorbic acid and glutathione were enhanced by 13 vs 0 UV-B BE after 14 days of UV-B exposure. Further exposure to 28 days of UV-B was associated with a decline in enzyme activities and ascorbic acid, but not glutathione. It is suggested that UV-B-induced injury may be associated with disturbance of active oxygen metabolism through the destruction and alteration of both enzymatic and nonenzymatic defense systems in rice. (author)

The influence of soil water status on Oryza Sativa Var. MR220 in KADA rice agroecosystem

International Nuclear Information System (INIS)

Nashriyah Mat; Ismail Che Haron; Mazleha Maskin; Mohd Razi Ismail

2006-01-01

A study to determine the influence of soil water status on rice plant Oryza sativa var. MR220 after panicle initiation stage was carried out at Ladang Merdeka Mulong Lating in the Kemubu Agricultural Development Authority (KADA) area, Kelantan. Five water management treatments imposed on direct seeded rice were; T1. Continuous flooding, T2. Early flooding up to panicle initiation stage followed by saturated (F55-saturated), T3. Early flooding for the first month followed by saturated (F-30 saturated), T4. Continuous saturated, and T5. Continuous field capacity condition throughout the growth stage. The treatments were arranged in Randomized Complete Block Design (RCBD) with four replicates. Results showed significant differences in soil moisture content in the order of T1>T2>T3>T4>T5. Significant differences were also observed in rice plant water content at 68 DAS (days after seeding) in the order of T2>T3>T4>T1>T5. Moisture content also showed significant differences between replicates in the order of R1>R2>R3>R4 and R2>R1>R3>R4; in rice plant and ricefield soil, respectively. Results however showed no significant difference in leaf stomatal conductance due to water stress. Rice plant moisture, soil moisture and leaf stomatal conductance showed no interaction. Published results show that even though overall crop yield was reduced by sheath blight and panicle blast incidence that occur at later stage in 2004-2005 field trials, highest grain yields were obtained from T2 (off season) and T4 (main season). Saturated condition seems to be the most suitable method of growing rice under minimal water input in KADA rice agroecosystem. (Author)

Combined Mass Spectrometry-Based Metabolite Profiling of Different Pigmented Rice (Oryza sativa L. Seeds and Correlation with Antioxidant Activities

Directory of Open Access Journals (Sweden)

Ga Ryun Kim

2014-09-01

Full Text Available Nine varieties of pigmented rice (Oryza sativa L. seeds that were black, red, or white were used to perform metabolite profiling by using ultra-performance liquid chromatography-quadrupole-time-of-flight mass spectrometry (UPLC-Q-TOF-MS and gas chromatography (GC TOF-MS, to measure antioxidant activities. Clear grouping patterns determined by the color of the rice seeds were identified in principle component analysis (PCA derived from UPLC-Q-TOF-MS. Cyanidin-3-glucoside, peonidin-3-glucoside, proanthocyanidin dimer, proanthocyanidin trimer, apigenin-6-C-glugosyl-8-C-arabiboside, tricin-O-rhamnoside-O-hexoside, and lipids were identified as significantly different secondary metabolites. In PCA score plots derived from GC-TOF-MS, Jakwangdo (JKD and Ilpoom (IP species were discriminated from the other rice seeds by PC1 and PC2. Valine, phenylalanine, adenosine, pyruvate, nicotinic acid, succinic acid, maleic acid, malonic acid, gluconic acid, xylose, fructose, glucose, maltose, and myo-inositol were significantly different primary metabolites in JKD species, while GABA, asparagine, xylitol, and sucrose were significantly distributed in IP species. Analysis of antioxidant activities revealed that black and red rice seeds had higher activity than white rice seeds. Cyanidin-3-glucoside, peonidin-3-glucoside, proanthocyanidin dimers, proanthocyanidin trimers, and catechin were highly correlated with antioxidant activities, and were more plentiful in black and red rice seeds. These results are expected to provide valuable information that could help improve and develop rice-breeding techniques.

A genome-wide association study of a global rice panel reveals resistance in Oryza sativa to root-knot nematodes.

Science.gov (United States)

Dimkpa, Stanley O N; Lahari, Zobaida; Shrestha, Roshi; Douglas, Alex; Gheysen, Godelieve; Price, Adam H

2016-02-01

The root-knot nematode Meloidogyne graminicola is one of the most serious nematode pests worldwide and represents a major constraint on rice production. While variation in the susceptibility of Asian rice (Oryza sativa) exists, so far no strong and reliable resistance has been reported. Quantitative trait loci for partial resistance have been reported but no underlying genes have been tagged or cloned. Here, 332 accessions of the Rice Diversity Panel 1 were assessed for gall formation, revealing large variation across all subpopulations of rice and higher susceptibility in temperate japonica accessions. Accessions Khao Pahk Maw and LD 24 appeared to be resistant, which was confirmed in large pot experiments where no galls were observed. Detailed observations on these two accessions revealed no nematodes inside the roots 2 days after inoculation and very few females after 17 days (5 in Khao Pahk Maw and 100 in the susceptible controls). These two cultivars appear ideal donors for breeding root-knot nematode resistance. A genome-wide association study revealed 11 quantitative trait loci, two of which are close to epistatic loci detected in the Bala x Azucena population. The discussion highlights a small number of candidate genes worth exploring further, in particular many genes with lectin domains and genes on chromosome 11 with homology to the Hordeum Mla locus. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.

Glomus mosseae enhances root growth and Cu and Pb acquisition of upland rice (Oryza sativa L.) in contaminated soils.

Science.gov (United States)

Lin, Aijun; Zhang, Xuhong; Yang, Xiaojin

2014-12-01

A pot culture experiment was carried out to investigate the roles of Glomus mosseae in Cu and Pb acquisition by upland rice (Oryza sativa L.) and the interactions between Cu and Pb. The soil was treated with three Cu levels (0, 100 and 200 mg kg(-1)) and three Pb levels (0, 300, and 600 mg kg(-1)). All treatments were designed with (+M) or without (-M) G. mosseae inoculation in a randomized block design. The addition of Cu and Pb significantly decreased root mycorrhizal colonization. Compared with -M, +M significantly increased root biomass in almost all treatments, and also significantly increased shoot biomass in the Pb(0)Cu(200), Pb(300)Cu(0), and all Pb(600) treatments. AM fungi enhanced plant Cu acquisition, but decreased plant Cu concentrations with all Cu plus Pb treatments, except for shoot in the Cu(200)Pb(600) treatment. Irrespective of Cu and Pb levels, +M plants had higher Pb uptakes than -M plants, but had lower root Pb and higher shoot Pb concentrations than those of -M plants. Another interpretation for the higher shoot Pb concentration in +M plants relied on Cu-Pb interactions. The study provided further evidences for the protective effects of AM fungi on upland rice against Cu and Pb contamination, and uncovered the phenomenon that Cu addition could promote Pb uptake and Pb partitioning to shoot. The possible mechanisms by which AM fungi can alleviate the toxicity induced by Cu and Pb are also discussed.

Distribution of Silicified Microstructures, Regulation of Cinnamyl Alcohol Dehydrogenase and Lodging Resistance in Silicon and Paclobutrazol Mediated Oryza sativa

Directory of Open Access Journals (Sweden)

Deivaseeno Dorairaj

2017-07-01

Full Text Available Lodging is a phenomenon that affects most of the cereal crops including rice, Oryza sativa. This is due to the fragile nature of herbaceous plants whose stems are non-woody, thus affecting its ability to grow upright. Silicon (Si, a beneficial nutrient is often used to toughen and protect plants from biotic and abiotic stresses. Deposition of Si in plant tissues enhances the rigidity and stiffness of the plant as a whole. Silicified cells provide the much needed strength to the culm to resist breaking. Lignin plays important roles in cell wall structural integrity, stem strength, transport, mechanical support, and plant pathogen defense. The aim of this study is to resolve effects of Si on formation of microstructure and regulation of cinnamyl alcohol dehydrogenase (CAD, a key gene responsible for lignin biosynthesis. Besides evaluating silicon, paclobutrazol (PBZ a plant growth retartdant that reduces internode elongation is also incorporated in this study. Hardness, brittleness and stiffness were improved in presence of silicon thus reducing lodging. Scanning electron micrographs with the aid of energy dispersive x-ray (EDX was used to map silicon distribution. Presence of trichomes, silica cells, and silica bodies were detected in silicon treated plants. Transcripts of CAD gene was also upregulated in these plants. Besides, phloroglucinol staining showed presence of lignified vascular bundles and sclerenchyma band. In conclusion, silicon treated rice plants showed an increase in lignin content, silicon content, and formation of silicified microstructures.

Chloroplast DNA polymorphism and evolutional relationships between Asian cultivated rice (Oryza sativa) and its wild relatives (O. rufipogon).

Science.gov (United States)

Li, W J; Zhang, B; Huang, G W; Kang, G P; Liang, M Z; Chen, L B

2012-12-17

We analyzed chloroplast DNA (cpDNA) polymorphism and phylogenic relationships between 6 typical indica rice, 4 japonica rice, 8 javanica rice, and 12 Asian common wild rice (Oryza rufipogon) strains collected from different latitudes in China by comparing polymorphism at 9 highly variable regions. One hundred and forty-four polymorphic bases were detected. The O. rufipogon samples had 117 polymorphic bases, showing rich genetic diversity. One hundred and thirty-one bases at 13 sites were identified with indica/japonica characteristics; they showed differences between the indica and japonica subspecies at these sites. The javanica strains and japonica shared similar bases at these 131 polymorphic sites, suggesting that javanica is closely related to japonica. On the basis of length analyses of the open reading frame (ORF)100 and (ORF)29-tRNA-Cys(GCA) (TrnC(GCA)) fragments, the O. rufipogon strains were classified into indica/japonica subgroups, which was consistent with the results of the phylogenic tree assay based on concatenated datasets. These results indicated that differences in indica and japonica also exist in the cpDNA genome of the O. rufipogon strains. However, these differences demonstrated a certain degree of primitiveness and incompleteness, as an O. rufipogon line may show different indica/ japonica attributes at different sites. Consequently, O. rufipogon cannot be simply classified into the indica/japonica types as O. sativa. Our data support the hypothesis that Asian cultivated rice, O. indica and O. japonica, separately evolved from Asian common wild rice (O. rufipogon) strains, which have different indica-japonica differentiation trends.

Enhanced resistance to blast fungus in rice (Oryza sativa L.) by expressing the ribosome-inactivating protein α-momorcharin.

Science.gov (United States)

Qian, Qian; Huang, Lin; Yi, Rong; Wang, Shuzhen; Ding, Yi

2014-03-01

Rice blast caused by Magnaporthe grisea is one of the three major diseases that seriously affect the rice production. Alpha-momorcharin (α-MC), a ribosome-inactivating protein (RIP) isolated from Momordica charantia seeds, has antifungal effects in vitro. In this study, the α-MC gene was constitutively expressed under the control of the 2×35S promoter in transgenic rice (Oryza sativa L.) using an Agrobacterium tumefaciens-mediated method. The nine transgenic plants were obtained and confirmed by PCR and RT-PCR, and the four (B2, B4, B7 and B9) of them whose copy numbers were 1, 2, 3 and 3, respectively, were shown to express the α-MC protein by Western blot. The molecular weight of α-MC in transgenic plants was approximately 38 kDa larger than the purified α-MC protein (28 kDa) in vitro. When the confirmed T1 generations were inoculated with a suspension of M. grisea spores for ten days, the lesions on leaves of transgenic plants were much lesser than those found on wild type (WT). According to the criteria of International Rice Research Institute standard, the mean values for morbidity and disease index numbers were 29.8% and 14.9%, respectively, which were lower than for WT. It is unclear whether RIPs could impact plant fitness and however our results suggest that the α-MC protein is an effective antifungal protein preventing rice blast in transgenic rice. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

Assessment and genetic analysis of heavy metal content in rice grain using an Oryza sativa × O. rufipogon backcross inbred line population.

Science.gov (United States)

Huang, De-Run; Fan, Ye-Yang; Hu, Biao-Lin; Xiao, Ye-Qing; Chen, Da-Zhou; Zhuang, Jie-Yun

2018-03-01

Heavy metal accumulation in rice is a growing concern for public health. Backcross inbred lines derived from an interspecific cross of Oryza sativa × O. rufipogon were grown in two distinct ecological locations (Hangzhou and Lingshui, China). The objective of this study was to characterise the contents of heavy metal in rice grains, and to identify quantitative trait loci (QTLs) for heavy metal contents. The contents of Ni, As, Pb, Cr and Hg in milled rice showed a significant decline as compared with those in brown rice, whereas the content of Cd showed little change. The concentration of heavy metal in rice grain varied greatly between the two environments. A total of 24 QTLs responsible for heavy metal contents were detected, including two for both the brown and milled rice, 13 for brown rice only, and nine for milled rice only. All the QTLs except two had the enhancing alleles derived from O. rufipogon. Sixteen QTLs were clustered in six chromosomal regions. Environmental variation plays an important role in the heavy metal contents in rice grain. QTLs detected in this study might be useful for breeding rice varieties with low heavy metal content. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

Modulation in the activity of purified tonoplast H+-ATPase by tonoplast glycolipids prepared from cultured rice (Oryza sativa L. var. Boro) cells.

Science.gov (United States)

Yamaguchi, M; Kasamo, K

2001-05-01

Glycolipids, phospholipids, and neutral lipids were extracted from the tonoplast fraction of cultured rice cells (Oryza sativa L. var. Boro). Acyl steryl glucoside (ASG) and glucocerebroside (GlcCer) were also prepared from this fraction. We determined the effects of these tonoplast lipids on the activity of H+-ATPase which was delipidated and purified from the tonoplast fraction. Exogenously added tonoplast phospholipids stimulated the activity of purified tonoplast H+-ATPase, but tonoplast glycolipids did not. When tonoplast glycolipids or tonoplast ASG was added in the presence of tonoplast phospholipids, they decreased the phospholipid-induced activation of the tonoplast H+-ATPase; tonoplast GlcCer only caused a small decrease. Steryl glucoside (SG) did not cause any decrease in this activation. Phospholipids, ASG, and GlcCer made up 35 mol%, 20 mol% and 7 mol% of the total lipids of the tonoplast fraction of cultured rice cells, respectively, and these glycolipid levels were enough to depress the phospholipid-induced activation of the tonoplast H+-ATPASE: These results revealed that H+-ATPase activity in the tonoplast may be modulated toward activation and depression by tonoplast phospholipids and glycolipids, respectively. The acylation of SG would be responsible for the depression in the phospholipid-induced H+-ATPase activity.

Transcriptome Analysis of Early Responsive Genes in Rice during Magnaporthe oryzae Infection

Directory of Open Access Journals (Sweden)

Yiming Wang

2014-12-01

Full Text Available Rice blast disease caused by Magnaporthe oryzae is one of the most serious diseases of cultivated rice (Oryza sativa L. in most rice-growing regions of the world. In order to investigate early response genes in rice, we utilized the transcriptome analysis approach using a 300 K tilling microarray to rice leaves infected with compatible and incompatible M. oryzae strains. Prior to the microarray experiment, total RNA was validated by measuring the differential expression of rice defense-related marker genes (chitinase 2, barwin, PBZ1, and PR-10 by RT-PCR, and phytoalexins (sakuranetin and momilactone A with HPLC. Microarray analysis revealed that 231 genes were up-regulated (>2 fold change, p < 0.05 in the incompatible interaction compared to the compatible one. Highly expressed genes were functionally characterized into metabolic processes and oxidation-reduction categories. The oxidative stress response was induced in both early and later infection stages. Biotic stress overview from MapMan analysis revealed that the phytohormone ethylene as well as signaling molecules jasmonic acid and salicylic acid is important for defense gene regulation. WRKY and Myb transcription factors were also involved in signal transduction processes. Additionally, receptor-like kinases were more likely associated with the defense response, and their expression patterns were validated by RT-PCR. Our results suggest that candidate genes, including receptor-like protein kinases, may play a key role in disease resistance against M. oryzae attack.

Genetic analysis and fine mapping of LH1 and LH2, a set of complementary genes controlling late heading in rice (Oryza sativa L.).

Science.gov (United States)

Liu, Shuang; Wang, Feng; Gao, Li Jun; Li, Jin Hua; Li, Rong Bai; Gao, Han Liang; Deng, Guo Fu; Yang, Jin Shui; Luo, Xiao Jin

2012-12-01

Heading date in rice (Oryza sativa L.) is a critical agronomic trait with a complex inheritance. To investigate the genetic basis and mechanism of gene interaction in heading date, we conducted genetic analysis on segregation populations derived from crosses among the indica cultivars Bo B, Yuefeng B and Baoxuan 2. A set of dominant complementary genes controlling late heading, designated LH1 and LH2, were detected by molecular marker mapping. Genetic analysis revealed that Baoxuan 2 contains both dominant genes, while Bo B and Yuefeng B each possess either LH1 or LH2. Using larger populations with segregant ratios of 3 : 1, we fine-mapped LH1 to a 63-kb region near the centromere of chromosome 7 flanked by markers RM5436 and RM8034, and LH2 to a 177-kb region on the short arm of chromosome 8 between flanking markers Indel22468-3 and RM25. Some candidate genes were identified through sequencing of Bo B and Yuefeng B in these target regions. Our work provides a solid foundation for further study on gene interaction in heading date and has application in marker-assisted breeding of photosensitive hybrid rice in China.

Taxonomy Icon Data: sorghum [Taxonomy Icon

Lifescience Database Archive (English)

Full Text Available sorghum Sorghum bicolor Sorghum_bicolor_L.png Sorghum_bicolor_NL.png Sorghum_bicolor_S.png Sorg...hum_bicolor_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Sorghum+bicolor&t=L http://b...iosciencedbc.jp/taxonomy_icon/icon.cgi?i=Sorghum+bicolor&t=NL http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Sorg...hum+bicolor&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Sorghum+bicolor&t=NS ...

A time course analysis of the extracellular proteome of Aspergillus nidulans growing on sorghum stover

Directory of Open Access Journals (Sweden)

Saykhedkar Sayali

2012-07-01

Full Text Available Abstract Background Fungi are important players in the turnover of plant biomass because they produce a broad range of degradative enzymes. Aspergillus nidulans, a well-studied saprophyte and close homologue to industrially important species such as A. niger and A. oryzae, was selected for this study. Results A. nidulans was grown on sorghum stover under solid-state culture conditions for 1, 2, 3, 5, 7 and 14 days. Based on analysis of chitin content, A. nidulans grew to be 4-5% of the total biomass in the culture after 2 days and then maintained a steady state of 4% of the total biomass for the next 12 days. A hyphal mat developed on the surface of the sorghum by day one and as seen by scanning electron microscopy the hyphae enmeshed the sorghum particles by day 5. After 14 days hyphae had penetrated the entire sorghum slurry. Analysis (1-D PAGE LC-MS/MS of the secretome of A. nidulans, and analysis of the breakdown products from the sorghum stover showed a wide range of enzymes secreted. A total of 294 extracellular proteins were identified with hemicellulases, cellulases, polygalacturonases, chitinases, esterases and lipases predominating the secretome. Time course analysis revealed a total of 196, 166, 172 and 182 proteins on day 1, 3, 7 and 14 respectively. The fungus used 20% of the xylan and cellulose by day 7 and 30% by day 14. Cellobiose dehydrogenase, feruloyl esterases, and CAZy family 61 endoglucanases, all of which are thought to reduce the recalcitrance of biomass to hydrolysis, were found in high abundance. Conclusions Our results show that A. nidulans secretes a wide array of enzymes to degrade the major polysaccharides and lipids (but probably not lignin by 1 day of growth on sorghum. The data suggests simultaneous breakdown of hemicellulose, cellulose and pectin. Despite secretion of most of the enzymes on day 1, changes in the relative abundances of enzymes over the time course indicates that the set of enzymes

Advances in sorghum genetic mapping with implications for sorghum improvement

International Nuclear Information System (INIS)

Lee, M.

1998-01-01

Despite the importance of the sorghum crop, comprehensive genetic characterization has been limited. Therefore, the primary goal of this research program was to develop basic genetic tools to facilitate research in the genetics and breeding of sorghum. The first phase of this project consisted of constructing a genetic map based on restriction fragment length polymorphisms (RFLPs). The ISU sorghum map was created through linkage analysis of 78 F2 plants of an intraspecific cross between inbred CK60 and accession PI229828. Subsequent mapping, efforts in several labs have enriched the sorghum map to the point where it now contains over 1,500 loci defined by RFLPs and many others defined by mutant phenotypes and QTLs. The ISU map consists of 201 loci distributed among 10 linkage groups covering 1299 cM. Comparison of sorghum and maize RFLP maps on the basis of common sets of DNA probes revealed a high degree of conservation as reflected by homology, copy number, and colinearity. Examples of conserved and rearranged locus orders were observed. The same sorghum population was used to map genetic factors (mutants and QTLS) for several traits including vegetative and reproductive morphology, maturity, insect, and disease resistance. Four QTLs for plant height, an important character for sorghum adaptation in temperate latitudes for grain production, were identified in a sample of 152 F2 plants whereas 6 QTLs were detected among their F3 progeny. These observations and assessments of other traits at 4 QTLs common to F2 plants and their F3 progeny indicate some of these regions correspond to loci (dw) previously identified on the basis of alleles with highly qualitative effects. Four of the six sorghum plant height QTLs seem to be orthologous to plant height QTLs in maize. Other possible instances of orthologous QTLs included regions for maturity and tillering. These observations suggest that the conservation of the maize and sorghum genomes encompasses sequence homology

Importance of seed-borne fungi of sorghum and pearl millet in Burkina Faso and their control using plant extracts.

Science.gov (United States)

Zida, Pawindé Elisabeth; Sérémé, Paco; Leth, Vibeke; Sankara, Philippe; Somda, Irénée; Néya, Adama

2008-02-01

Seed-borne fungi of sorghum and pearl millet in Burkina Faso were surveyed. A total of 188 seed samples from various locations, collected in 1989 (42) and 2002 (146), were tested, using the blotter, dry inspection and washing methods. Infection experiments were carried out with the major fungi recorded on each crop by the blotter test. Six essential oils of plants were investigated for their inhibitory activity against eight pathogenic fungi. Thirty four and 27 fungal species were found in seed samples of sorghum and pearl millet, respectively. Phoma sp. and Fusarium moniliforme infected 95 to 100% of the seed samples of both sorghum and pearl millet. Sphacelotheca sorghi and Tolyposporium ehrenbergii were encountered in respectively, 75 and 33% of seed samples of sorghum. T. penicillariae, Sclerospora graminicola and Claviceps fusiformis were present in 88, 41 and 32% of seed samples of pearl millet, respectively. Seeds inoculated with Acremonium strictum, Curvularia oryzae, F. equiseti, F. moniliforme and F. subglutinans and sown in sterilized soil, showed considerable mortality of the seedlings. Three essential oils inhibited in vitro the mycelial growth of all the fungi used by 85 to 100% and reduced significantly sorghum and pearl millet seed infection rates of Phoma sp., Fusarium sp., Curvularia sp., Colletotrichum graminicola and Exserohilum sp. Presence of many pathogenic fungi in considerable number of seed samples indicates the need of field surveys for these and other pathogens. Development of plant extracts for the control of seed-borne pathogens and public awareness on seed-borne diseases management measures for maintaining quality seed should be increased.

Identification of heterotic loci associated with yield-related traits in Chinese common wild rice (Oryza rufipogon Griff.).

Science.gov (United States)

Luo, Xiaojin; Wu, Shuang; Tian, Feng; Xin, Xiaoyun; Zha, Xiaojun; Dong, Xianxin; Fu, Yongcai; Wang, Xiangkun; Yang, Jinshui; Sun, Chuanqing

2011-07-01

Many rice breeding programs have currently reached yield plateaus as a result of limited genetic variability in parental strains. Dongxiang common wild rice (Oryza rufipogon Griff.) is the progenitor of cultivated rice (Oryza sativa L.) and serves as an important gene pool for the genetic improvement of rice cultivars. In this study, heterotic loci (HLs) associated with six yield-related traits were identified in wild and cultivated rice and investigated using a set of 265 introgression lines (ILs) of O. rufipogon Griff. in the background of the Indica high-yielding cultivar Guichao 2 (O. sativa L.). Forty-two HLs were detected by a single point analysis of mid-parent heterosis values from test cross F(1) offspring, and 30 (71.5%) of these HLs showed significantly positive effects, consistent with the superiority shown by the F(1) test cross population in the six yield-related traits under study. Genetic mapping of hsp11, a locus responsible for the number of spikelets per panicle, confirmed the utility of these HLs. The results indicate that favorable HLs capable of improving agronomic traits are available. The identification of HLs between wild rice and cultivated rice could lead to a new strategy for the application of heterosis in rice breeding. Copyright © 2011. Published by Elsevier Ireland Ltd.

Common and distinct organ and stress responsive transcriptomic patterns in Oryza sativa and Arabidopsis thaliana

Directory of Open Access Journals (Sweden)

Castleden Ian

2010-11-01

Full Text Available Abstract Background Arabidopsis thaliana is clearly established as the model plant species. Given the ever-growing demand for food, there is a need to translate the knowledge learned in Arabidopsis to agronomically important species, such as rice (Oryza sativa. To gain a comparative insight into the similarities and differences into how organs are built and how plants respond to stress, the transcriptomes of Arabidopsis and rice were compared at the level of gene orthology and functional categorisation. Results Organ specific transcripts in rice and Arabidopsis display less overlap in terms of gene orthology compared to the orthology observed between both genomes. Although greater overlap in terms of functional classification was observed between root specific transcripts in rice and Arabidopsis, this did not extend to flower, leaf or seed specific transcripts. In contrast, the overall abiotic stress response transcriptome displayed a significantly greater overlap in terms of gene orthology compared to the orthology observed between both genomes. However, ~50% or less of these orthologues responded in a similar manner in both species. In fact, under cold and heat treatments as many or more orthologous genes responded in an opposite manner or were unchanged in one species compared to the other. Examples of transcripts that responded oppositely include several genes encoding proteins involved in stress and redox responses and non-symbiotic hemoglobins that play central roles in stress signalling pathways. The differences observed in the abiotic transcriptomes were mirrored in the presence of cis-acting regulatory elements in the promoter regions of stress responsive genes and the transcription factors that potentially bind these regulatory elements. Thus, both the abiotic transcriptome and its regulation differ between rice and Arabidopsis. Conclusions These results reveal significant divergence between Arabidopsis and rice, in terms of the

Reduction of aflatoxin-beta/sub 1/ and ochratoxin-A levels in polished basmati rice (oryza sativa linn.) by different cooking methods

International Nuclear Information System (INIS)

Hussain, A.; Luttfullah, G.

2009-01-01

Rice (Oryza sativa Linn) is one of the basic diets of Pakistan. The aim of present study was to evaluate the effect of different cooking methods on the levels of aflatoxin-B/sub 1/ (AFB.) and ochratoxin-A (OTA). For this purpose the rice samples were artificially contaminated with AFB1 and ochratoxin-A (OTA) individually and simultaneously. The samples were then submitted to three different cooking methods i.e. normal cooking, cooking in an excess of water and in a microwave oven. After treatment, the both toxins were determined by thin layer chromatography (TLC) technique. The highest myco toxin reductions were observed when rice samples cooked in excess water (87.5 % for AFB1 and 86.6 % for OTA), followed by normal cooking (84.0 % for AFB, and 83.0 % for OTA) and microwave oven cooking (72.5 % for AFB1 and 82.4 % for OTA). The samples artificially contaminated with both AFB1 and OTA, the highest reductions were also observed for rice cooked in excess water (87.5 and 83.0 %) than cooked by normal cooking (82.5 and 766 %), and by microwave oven cooking (77.6 and 75.9 %). The rates of toxin reduction were relatively lower in samples artificially simultaneously contaminated with AFB1 and OTA, than the rice samples contaminated with AFB. and OTA individually. (author)

Sorghum to Ethanol Research

Energy Technology Data Exchange (ETDEWEB)

Dahlberg, Jeffrey A. [Univ. of California, Parlier, CA (United States). Kearney Research and Extension Center; Wolfrum, Edward J. [National Renewable Energy Lab. (NREL), Golden, CO (United States). Process and Analytical Engineering Group

2010-09-28

The development of a robust source of renewable transportation fuel will require a large amount of biomass feedstocks. It is generally accepted that in addition to agricultural and forestry residues, we will need crops grown specifically for subsequent conversion into fuels. There has been a lot of research on several of these so-called "dedicated bioenergy crops" including switchgrass, miscanthus, sugarcane, and poplar. It is likely that all of these crops will end up playing a role as feedstocks, depending on local environmental and market conditions. Many different types of sorghum have been grown to produce syrup, grain, and animal feed for many years. It has several features that may make it as compelling as other crops mentioned above as a renewable, sustainable biomass feedstock; however, very little work has been done to investigate sorghum as a dedicated bioenergy crop. The goal of this project was to investigate the feasibility of using sorghum biomass to produce ethanol. The work performed included a detailed examination of the agronomics and composition of a large number of sorghum varieties, laboratory experiments to convert sorghum to ethanol, and economic and life-cycle analyses of the sorghum-to-ethanol process. This work showed that sorghum has a very wide range of composition, which depended on the specific sorghum cultivar as well as the growing conditions. The results of laboratory- and pilot-scale experiments indicated that a typical high-biomass sorghum variety performed very similarly to corn stover during the multi-step process required to convert biomass feedstocks to ethanol; yields of ethanol for sorghum were very similar to the corn stover used as a control in these experiments. Based on multi-year agronomic data and theoretical ethanol production, sorghum can achieve more than 1,300 gallons of ethanol per acre given the correct genetics and environment. In summary, sorghum may be a compelling dedicated bioenergy crop that could help

Silicon mitigates heavy metal stress by regulating P-type heavy metal ATPases, Oryza sativa low silicon genes, and endogenous phytohormones

Science.gov (United States)

2014-01-01

Background Silicon (Si) application has been known to enhance the tolerance of plants against abiotic stresses. However, the protective mechanism of Si under heavy metals contamination is poorly understood. The aim of this study was to assess the role of Si in counteracting toxicity due to cadmium (Cd) and copper (Cu) in rice plants (Oryza sativa). Results Si significantly improved the growth and biomass of rice plants and reduced the toxic effects of Cd/Cu after different stress periods. Si treatment ameliorated root function and structure compared with non-treated rice plants, which suffered severe root damage. In the presence of Si, the Cd/Cu concentration was significantly lower in rice plants, and there was also a reduction in lipid peroxidation and fatty acid desaturation in plant tissues. The reduced uptake of metals in the roots modulated the signaling of phytohormones involved in responses to stress and host defense, such as abscisic acid, jasmonic acid, and salicylic acid. Furthermore, the low concentration of metals significantly down regulated the mRNA expression of enzymes encoding heavy metal transporters (OsHMA2 and OsHMA3) in Si-metal-treated rice plants. Genes responsible for Si transport (OsLSi1 and OsLSi2), showed a significant up-regulation of mRNA expression with Si treatment in rice plants. Conclusion The present study supports the active role of Si in the regulation of stresses from heavy metal exposure through changes in root morphology. PMID:24405887

Enhancement of gama-aminobutyric acid (GABA) and other health-related metabolites in germinated red rice (Oryza sativa L.) by ultrasonication.

Science.gov (United States)

Ding, Junzhou; Ulanov, Alexander V; Dong, Mengyi; Yang, Tewu; Nemzer, Boris V; Xiong, Shanbai; Zhao, Siming; Feng, Hao

2018-01-01

Red rice (Oryza sativa L.) that has a red (reddish brown) bran layer in de-hulled rice is known to contain rich biofunctional components. Germination is an effective technique to improve the nutritional quality, digestibility, and flavor of de-hulled rice. Ultrasonication, a form of physical stimulation, has been documented as a novel approach to improve the nutritional quality of plant-based food. This study was undertaken to test the use of ultrasound to enhance the nutritional value of red rice. Ultrasonication (5min, 16W/L) was applied to rice during soaking or after 66h germination. Changes of metabolites (amino acids, sugars, and organic acids) in red rice treated by ultrasonication were determined using a GC/MS plant primary metabolomics analysis platform. Differential expressed metabolites were identified through multivariate statistical analysis. Results showed that γ-aminobutyric acid (GABA) and riboflavin (vitamin B 2 ) in red rice significantly increased after germination for 72h, and then experienced a further increase after treatment by ultrasound at different stages during germination. The metabolomics analysis showed that some plant metabolites, i.e. GABA, O-phosphoethanolamine, and glucose-6-phosphate were significantly increased after the ultrasonic treatment (VIP>1.5) in comparison with the untreated germinated rice. The findings of this study showed that controlled germination with ultrasonic stress is an effective method to enhance GABA and other health-promoted components in de-hulled rice. Copyright © 2017 Elsevier B.V. All rights reserved.

Analysis of genetic and genotype X environment interaction effects for agronomic traits of rice (oryza sativa l.) in salt tolerance

International Nuclear Information System (INIS)

Zhou, H.K.; Hayat, Y.; Fang, L.J.; Guo, R.F.; He, J.M.; Xu, H.M.

2010-01-01

A diallel cross experiment of 4 rice (Oryza sativa L.) female and 6 male varieties was conducted to study the genetic effects and their interaction with salt-stress condition of 7 agronomic traits in normal and salt-stressed planting conditions. The panicle length (PL), effective number of panicles per plant (ENP), plumped number of grains per panicles (PNG), total number of grains per panicles (TNG), 1000-grain weight (W), seed setting ratio (SSR) and grain weight per plant (PGW), were investigated. A genetic model including additive effect, dominance effect and their interaction effects with environment (ADE) was employed for analysis of data. It was observed that significant (p<0.05) additive effects, dominance effects, additive X environment interaction effects and dominance X environment interaction effects exist for most of the agronomic traits of rice. In addition, significant (p<0.05) narrow sense heritabilities of ENP, PNG, TNG, W and PGW were found, indicating that the genetic performance of these traits are greatly affected by salt stress condition. A significant (p<0.05) negative correlations in the additive effects and additive X environment interaction effects detected between ENP and PNG suggesting that selection on increasing of ENP can reduce PNG. In addition, there exist a highly significant (p<0.01) positive dominance correlation among the dominance effects of the ENP, PNG and TNG, which shows that it is possible to breed salt-tolerant rice variety by coordinating large panicle and multi-panicle in utilization of heterosis. (author)

Molecular cloning, functional expression and subcellular localization of two putative vacuolar voltage-gated chloride channels in rice (Oryza sativa L.).

Science.gov (United States)

Nakamura, Atsuko; Fukuda, Atsunori; Sakai, Shingo; Tanaka, Yoshiyuki

2006-01-01

We isolated two cDNA clones (OsCLC-1 and OsCLC-2) homologous to tobacco CLC-Nt1, which encodes a voltage-gated chloride channel, from rice (Oryza sativa L. ssp. japonica, cv. Nipponbare). The deduced amino acid sequences were highly conserved (87.9% identity with each other). Southern blot analysis of the rice genomic DNA revealed that OsCLC-1 and OsCLC-2 were single-copy genes on chromosomes 4 and 2, respectively. OsCLC-1 was expressed in most tissues, whereas OsCLC-2 was expressed only in the roots, nodes, internodes and leaf sheaths. The level of expression of OsCLC-1, but not of OsCLC-2, was increased by treatment with NaCl. Both genes could partly substitute for GEF1, which encodes the sole chloride channel in yeast, by restoring growth under ionic stress. These results indicate that both genes are chloride channel genes. The proteins from both genes were immunochemically detected in the tonoplast fraction. Tagged synthetic green fluorescent protein which was fused to OsCLC-1 or OsCLC-2 localized in the vacuolar membranes. These results indicate that the proteins may play a role in the transport of chloride ions across the vacuolar membrane. We isolated loss-of-function mutants of both genes from a panel of rice mutants produced by the insertion of a retrotransposon, Tos17, in the exon region, and found inhibition of growth at all life stages.

Molecular cloning and characterization of RGA1 encoding a G protein alpha subunit from rice (Oryza sativa L. IR-36).

Science.gov (United States)

Seo, H S; Kim, H Y; Jeong, J Y; Lee, S Y; Cho, M J; Bahk, J D

1995-03-01

A cDNA clone, RGA1, was isolated by using a GPA1 cDNA clone of Arabidopsis thaliana G protein alpha subunit as a probe from a rice (Oryza sativa L. IR-36) seedling cDNA library from roots and leaves. Sequence analysis of genomic clone reveals that the RGA1 gene has 14 exons and 13 introns, and encodes a polypeptide of 380 amino acid residues with a calculated molecular weight of 44.5 kDa. The encoded protein exhibits a considerable degree of amino acid sequence similarity to all the other known G protein alpha subunits. A putative TATA sequence (ATATGA), a potential CAAT box sequence (AGCAATAC), and a cis-acting element, CCACGTGG (ABRE), known to be involved in ABA induction are found in the promoter region. The RGA1 protein contains all the consensus regions of G protein alpha subunits except the cysteine residue near the C-terminus for ADP-ribosylation by pertussis toxin. The RGA1 polypeptide expressed in Escherichia coli was, however, ADP-ribosylated by 10 microM [adenylate-32P] NAD and activated cholera toxin. Southern analysis indicates that there are no other genes similar to the RGA1 gene in the rice genome. Northern analysis reveals that the RGA1 mRNA is 1.85 kb long and expressed in vegetative tissues, including leaves and roots, and that its expression is regulated by light.

Identification of differentially expressed genes in sorghum (Sorghum bicolor) brown midrib mutants

Science.gov (United States)

Sorghum (Sorghum bicolor L.), with a high biomass yield and excellent tolerance to drought and low nutrition, has been recommended as one of the most competitive bioenergy crops. Brown midrib (bmr) mutant sorghum with reduced lignin content showed a high potential for the improvement of bioethanol ...

PENGARUH RHIZOPUS ORYZAE DAN ASPERGILLUS ORYZAE TERHADAP KUALITAS KECAP

Directory of Open Access Journals (Sweden)

Dewi Sabita Slamet

2012-11-01

Full Text Available Telah diteliti pengganti fermentasi mikroorganisme Aspergillus oryzae Rhyzopus oryzae dan campuran Aspergillus dan Rhyzopus oryzae, dengan perendaman dalam larutan garam 20% dalam waktu yang berbeda terhadap kualitas kecap.Lamanya perendaman dalam larutan garam 20% yang berbeda menghasilkan kadar protein kecap yang berbeda. Aspergillus oryzae lebih baik dalam menghasilkan enzima protease dari pada Rhyzopus oryzae.Uji organoleptik menunjukkan perbedaan tidak bermakna dalam hal rasa maupun aroma antar kecap yang dibuat dengan strain jamur yang berlainan serta waktu perendaman yang berbeda. Untuk membuat kecap, sebaiknya dilakukan perendaman dalam larutan garam 20% selama 14 hari.

Polyhydroxyalcanoates of strains of Azospirillum spp. isolated of roots of Lycopersicon esculentum Mill. “tomato” and Oryza sativa L. “rice” in Lambayeque

Directory of Open Access Journals (Sweden)

Katty Baca

2010-12-01

Full Text Available In this work was determined the concentration of polyhydroxyalkanoates (PHAs of Azospirillum strains isolated from roots of Lycopersicon esculentum Mill "tomato" and Oryza sativa L. "rice" as an alternative to accumulation of petroleum-based plastics. Previously disinfected root were plated in Nfb semisolid medium where nitrogen-fixing bacteria were recognized by a whitish film on the surface and turn from green to blue. The genus Azospirillum was identified in Congo red agar medium, obtained 96 isolates of A. lipoferum and A. brasilense on tomato and rice. Batch fermentation was performed with broth Azotobacter modified feeding a saturated solution of malic acid every 12 hours and were stained with Sudan Black B. Strains were selected with the greatest number of PHAs granules (in tomato, 18 of A. lipoferum and 2 of A. brasilense; in rice, 10 of A. lipoferum and 10 of A. brasilense and quantified the biomass and PHAs. PHAs concentration reached 0.661 gL-1 in A. lipoferum KM(T-73 and 0.738 gL-1 in A. brasilense KM(T-19, both isolated from tomato. Strains of A. lipoferum and A. brasilense isolated from tomato reached a higher concentration of biomass and PHAs against the strains of rice.

Plant growth enhancing effects by a siderophore-producing endophytic streptomycete isolated from a Thai jasmine rice plant (Oryza sativa L. cv. KDML105).

Science.gov (United States)

Rungin, Siriwan; Indananda, Chantra; Suttiviriya, Pavinee; Kruasuwan, Worarat; Jaemsaeng, Ratchaniwan; Thamchaipenet, Arinthip

2012-10-01

An endophytic Streptomyces sp. GMKU 3100 isolated from roots of a Thai jasmine rice plant (Oryza sativa L. cv. KDML105) showed the highest siderophore production on CAS agar while phosphate solubilization and IAA production were not detected. A mutant of Streptomyces sp. GMKU 3100 deficient in just one of the plant growth promoting traits, siderophore production, was generated by inactivation of a desD-like gene encoding a key enzyme controlling the final step of siderophore biosynthesis. Pot culture experiments revealed that rice and mungbean plants inoculated with the wild type gave the best enhancement of plant growth and significantly increased root and shoot biomass and lengths compared with untreated controls and siderophore-deficient mutant treatments. Application of the wild type in the presence or absence of ferric citrate significantly promoted plant growth of both plants. The siderophore-deficient mutant clearly showed the effect of this important trait involved in plant-microbe interaction in enhancement of growth in rice and mungbean plants supplied with sequestered iron. Our results highlight the value of a substantial understanding of the relationship of the plant growth promoting properties of endophytic actinomycetes to the plants. Endophytic actinomycetes, therefore, can be applied as potentially safe and environmentally friendly biofertilizers in agriculture.

Breeding for blast-disease-resistant and high-yield Thai jasmine rice (Oryza sativa L. cv. KDML 105) mutants using low-energy ion beams

Science.gov (United States)

Mahadtanapuk, S.; Teraarusiri, W.; Phanchaisri, B.; Yu, L. D.; Anuntalabhochai, S.

2013-07-01

Low-energy ion beam was applied on mutation induction for plant breeding of blast-disease-resistant Thai jasmine rice (Oryza sativa L. cv. KDML 105). Seeds of the wild-type rice were bombarded in vacuum by nitrogen ion beam at energy of 60-80 keV to a beam fluence range of 2 × 1016-2 × 1017 ions/cm2. The ion-bombarded rice seeds were grown in soil for 2 weeks as transplanted rice in plastic pots at 1 seedling/pot. The seedlings were then screened for blast resistance by Pyricularia grisea inoculation with 106 spores/ml concentrations. The blast-resistant rice mutant was planted up to F6 generation with the consistent phenotypic variation. The high percentage of the blast-disease-resistant rice was analyzed with DNA fingerprint. The HAT-RAPD (high annealing temperature-random amplified polymorphic DNA) marker revealed the modified polymorphism fragment presenting in the mutant compared with wild type (KDML 105). The cDNA fingerprints were investigated and the polymorphism fragment was subcloned into pGEM-T easy vector and then sequenced. The sequence of this fragment was compared with those already contained in the database, and the fragment was found to be related to the Spotted leaf protein 11 (Spl11).

Soil-to-plant transfer factors of trace and major elements in rice plant (Oryza Sativa) at Kalpakkam

International Nuclear Information System (INIS)

Sreedevi, K.R.; Rajaram, S.; Thulasi Brindha, J.; Venkataraman, S.; Hegde, A.G.

2011-01-01

The objective of this study was to evaluate the distribution of trace and major elements in rice plant (Oryza Sativa) which is the staple diet of the public at Kalpakkam. The transfer factor from soil to various parts of plant was also studied. Trace and major elements such as Fe, Mn, Zn, Co, Cu, Ni, Cr, Cd, Pb , Sr, K, Ca and Mg were selected based on their role in nutrition and also to study the behaviour of their radioactive counterparts. Among the trace elements Fe concentration was observed to be maximum in soil, the mean value of which was 18394 mg/kg dry wt. Cadmium concentration was observed to be minimum with the mean value of 2 mg/kg dry wt. The maximum and minimum concentration observed in the rice grain were due to Zn and Cd and the values were found to be 9 and 0.044 mg/kg dry wt, respectively. In the stem and leaves part the maximum and minimum concentration was due to Fe and Cd and the values were found to be 26.8 and 0.12 mg/kg dry wt. Similarly in the root part Fe and Cd concentrations were found to be maximum and minimum, respectively. Among the different parts of the rice plant, trace elements concentration in root was maximum and in stem and leaves major elements concentration was maximum. Transfer factor from soil to plant parts was computed. In general, the transfer factor was maximum in root, followed by stem and leaves and grain for trace elements. The transfer factor computed for whole rice plant was maximum for Zn and minimum for Sr which is a significant observation from radiological point of view. (author)

Growth and Cd uptake by rice (Oryza sativa) in acidic and Cd-contaminated paddy soils amended with steel slag.

Science.gov (United States)

He, Huaidong; Tam, Nora F Y; Yao, Aijun; Qiu, Rongliang; Li, Wai Chin; Ye, Zhihong

2017-12-01

Contamination of rice (Oryza sativa) by Cd is of great concern. Steel slag could be used to amend Cd-contaminated soils and make them safe for cereal production. This work was conducted to study the effects of steel slag on Cd uptake and growth of rice plants in acidic and Cd-contaminated paddy soils and to determine the possible mechanisms behind these effects. Pot (rhizobag) experiments were conducted using rice plants grown on two acidic and Cd-contaminated paddy soils with or without steel slag amendment. Steel slag amendment significantly increased grain yield by 36-45% and root catalase activity, and decreased Cd concentrations in brown rice by 66-77% compared with the control, in both soils. Steel slag amendment also markedly decreased extractable soil Cd, Cd concentrations in pore-water and Cd translocation from roots to above-ground parts. It also significantly increased soil pH, extractable Si and Ca in soils and Ca concentrations in roots. Significant positive correlations were found between extractable soil Cd and Cd concentrations in rice tissues, but it was negatively correlated with soil pH and extractable Si. Calcium in root tissues significantly and negatively correlated with Cd translocation factors from roots to straw. Overall, steel slag amendment not only significantly promoted rice growth but decreased Cd accumulation in brown rice. These benefits appear to be related to improvements in soil conditions (e.g. increasing pH, extractable Si and Ca), a reduction in extractable soil Cd, and suppression of Cd translocation from roots to above-ground parts. Copyright © 2017 Elsevier Ltd. All rights reserved.

An assessment of Wx microsatellite allele, alkali degradation and differentiation of chloroplast DNA in traditional black rice (Oryza sativa L.) from Thailand and Lao PDR.

Science.gov (United States)

Prathepha, Preecha

2007-01-15

Thailand and Lao PDR are the country's rich rice diversity. To contribute a significant knowledge for development new rice varieties, a collection of 142 black rice (Oryza sativa) accessions were determined for variation of physico-chemical properties, Wx microsatellite allele, Wx allele and chloroplast DNA type. The results showed that amylose content of black rice accessions were ranged from 1.9 to 6.8%. All of the alkali disintegration types (high, intermediate and low) was observed in these rice with average of 1.75 on the 1-3 digestibility scale. The unique Wx microsatellite allele (CT)17 was found in these samples and all black rice strains carried Wx(b) allele. In addition, all black rice accessions were found the duplication of the 23 bp sequence motif in the exon 2 of the wx gene. This evidence is a common phenomenon in glutinous rice. Based on two growing condition for black rice, rainfed lowland and rainfed upland, chloroplast DNA type was distinct from each other. All rice strains from rainfed lowland was deletion plastotype, but all other rainfed upland strains were non-deletion types.

The diversity of local sorghum (Sorghum bicolor L. Moench) in Nusa Tenggara Timur province

Science.gov (United States)

Mukkun, L.; Lalel, H. J. D.; Richana, N.; Pabendon, M. B.; Kleden, S. R.

2018-04-01

Sorghum (Sorghum bicolor L. Moench) is an important food crop in the dry land including Nusa Tenggara Timur (NTT) Province. This plant has a high adaptability to drought, can produce on marginal land, and is relatively resistant to pests and diseases. The study aims to collect and identify the species of local sorghum being cultivated by farmers, and the purposes of cultivation. In addition, this study will preserve germ plasm of local sorghum by providing bank seeds for the next growing season. A collection of local sorghum samples was conducted in 7 districts using survey and observation method. A total of 53 species of sorghum were collected, with various characteristics and different local names. Based on the skin color of the seeds, the accessions were grouped into white groups (26.42%), light yellow (15.09%), black (20.75%), brown (24.52%), and red (13.20 %). Sorghum is used for complementary food for rice, consumption in times of food insecurity, fodder, and as a fence for corn and rice. It is necessary to characterize the type of local sorghum that has the potential to be developed for food, industrial raw materials, and for functional food.

Molecular Mapping of QTLs for Yield and Yield-Related Traits in Oryza sativa cv Swarna × O. nivara (IRGC81848 Backcross Population

Directory of Open Access Journals (Sweden)

B.P. MALLIKARJUNA SWAMY

2011-09-01

Full Text Available Advanced backcross QTL analysis was used to identify QTLs for seven yield and yield-related traits in a BC2F2 population from the cross between a popular Oryza sativa cv Swarna and O. nivara IRGC81848. Transgressive segregants with more than 15% increased effect over Swarna were observed for all the traits except days to heading and days to 50% flowering. Thirty QTLs were detected for seven yield and yield-related traits using interval and composite interval mapping. Enhancing alleles at 13 (45% of these QTLs were derived from O. nivara, and enhancing alleles at all the QTLs for stem diameter and rachis diameter were derived from O. nivara. Three stem diameter QTLs, two rachis diameter QTLs and one number of secondary branches QTL identified by both Interval and composite interval mapping contributed more than 15% of the total phenotypic variance. The QTL epistasis was significant for stem diameter and plot yield. The most significant QTLs qSD7.2, qSD8.1 and qSD9.1 for stem diameter, qRD9.1 for rachis diameter and qNSB1.1 for number of secondary branches are good targets to evaluate their use in marker-assisted selection. O. nivara is a good source of novel alleles for yield related traits and reveals major effect QTLs suitable for marker-assisted selection.

Purification, crystallization and preliminary X-ray analysis of recombinant betaine aldehyde dehydrogenase 2 (OsBADH2), a protein involved in jasmine aroma, from Thai fragrant rice (Oryza sativa L.)

International Nuclear Information System (INIS)

Kuaprasert, Buabarn; Silprasit, Kun; Horata, Natharinee; Khunrae, Pongsak; Wongpanya, Ratree; Boonyalai, Nonlawat; Vanavichit, Apichart; Choowongkomon, Kiattawee

2011-01-01

Crystals of betaine aldehyde dehydrogenase 2 from rice (O. sativa L.) belonged to a C-centred orthorhombic space group and diffraceted X-rays to 2.6 Å resolution. Fragrant rice (Oryza sativa L.) betaine aldehyde dehydrogenase 2 (OsBADH2) is a key enzyme in the synthesis of fragrance aroma compounds. The extremely low activity of OsBADH2 in catalyzing the oxidation of acetaldehyde is believed to be crucial for the accumulation of the volatile compound 2-acetyl-1-pyrroline (2AP) in many scented plants, including fragrant rice. Recombinant fragrant rice OsBADH2 was expressed in Escherichia coli as an N-terminal hexahistidine fusion protein, purified using Ni Sepharose affinity chromatography and crystallized using the microbatch method. Initial crystals were obtained within 24 h using 0.1 M Tris pH 8.5 with 30%(w/v) PEG 4000 and 0.2 M magnesium chloride as the precipitating agent at 291 K. Crystal quality was improved when the enzyme was cocrystallized with NAD + . Improved crystals were grown in 0.1 M HEPES pH 7.4, 24%(w/v) PEG 4000 and 0.2 M ammonium chloride and diffracted to beyond 2.95 Å resolution after being cooled in a stream of N 2 immediately prior to X-ray diffraction experiments. The crystals belonged to space group C222 1 , with unit-cell parameters a = 66.03, b = 183.94, c = 172.28 Å. An initial molecular-replacement solution has been obtained and refinement is in progress

In planta transformation of sorghum (Sorghum bicolor (L.) Moench)

Indian Academy of Sciences (India)

An in planta transformation protocol for sorghum (Sorghum bicolor (L.) Moench) using shoot apical meristem of germinating seedlings is reported in this study. Agrobacterium tumefaciens strain, LBA4404 with pCAMBIA1303 vector and construct pCAMBIA1303TPS1 were individually used for transformation. Since, the ...

Caracterização agromorfológica interpopulacional em Oryza glumaepatula Interpopulational agro-morphological haracterization of Oryza glumaepatula

Directory of Open Access Journals (Sweden)

Mariana Silva Rosa

2006-01-01

Full Text Available O gênero Oryza apresenta duas espécies cultivadas e 21 espécies silvestres, sendo quatro originárias da América do Sul e Central. Dentre essas, a única espécie diplóide é Oryza glumaepatula Steud., compatível em cruzamentos com a espécie cultivada O. sativa L. O objetivo deste trabalho foi caracterizar, por meio de caracteres agromorfológicos, oito populações de O. glumaepatula, coletadas em diferentes bacias hidrográficas brasileiras. O experimento foi realizado em casa de vegetação utilizando-se o delineamento em blocos ao acaso com oito tratamentos e seis repetições. Cada parcela foi constituída de quatro plantas, obtendo-se o total de 24 plantas por população. Foram avaliadas três características agronômicas e 18 características morfológicas. Os dados foram analisados utilizando-se estatísticas univariadas e multivariadas. Os resultados mostraram diferenças significativas entre populações para todos os caracteres avaliados, o que indica a grande variabilidade genética observada para todas as populações. Os resultados da análise de componentes principais foram similares aos da análise de agrupamento que classificou as populações em quatro grupos, sendo um grupo para cinco populações da Amazônia, um grupo para uma população do Rio Negro, e dois grupos, um para cada população originária do Rio Xingu e do Rio Paraguai, no Pantanal. A população com características agronômicas mais desejáveis, maior produção de sementes e maior número de perfilhos foi a PG-4, originária do Pantanal Matogrossense, seguida da população JA-4, do Rio Japurá.The genus Oryza contains two cultivated and 21 wild species, and four of these wild species originated from South and Central America. Among these, the only diploid species, compatible in crossing experiments with the cultivated O. sativa L. is O. glumaepatula Steud. The objective of this research was to characterize with morpho-agronomic traits eight

Production of oleic acid ethyl ester catalyzed by crude rice bran (Oryza sativa lipase in a modified fed-batch system: problem and its solution

Directory of Open Access Journals (Sweden)

Indro Prastowo

2015-01-01

Full Text Available A fed-batch system was modified for the enzymatic production of Oleic Acid Ethyl Ester (OAEE using rice bran (Oryza sativa lipase by retaining the substrate molar ratio (ethanol/oleic acid at 2.05: 1 during the reaction. It resulted in an increase in the ester conversion up to 76.8% in the first 6 h of the reaction, and then followed by a decrease from 76.8% to 22.9% in 6 h later. Meanwhile, the production of water in the reaction system also showed a similar trend to the trend of ester production. The water was hypothesized to lead lipase to reverse the reaction which resulted in a decrease in both (water and esters in the last 6 h of the reaction. In order to overcome the problem, zeolite powders (25 and 50 mg/ml were added into the reaction system at 5 h of the reaction. As the result, final ester conversions increased drastically up to 90 - 95.7% (1.17 – 1.24 times. The addition also proved a hypothesis that the water was involved in reducing the ester conversion in the last 6 h of the reaction. Thus, the combination was effective to produce the high final ester conversion.

Flavonoid glycosides from leaves and straw of Oryza sativa and their effects of cytotoxicity on a macrophage cell line and allelopathic on weed germination

Directory of Open Access Journals (Sweden)

Ill-Min Chung

2018-03-01

Full Text Available Five new flavonoids namely, 5-hydroxy-6-isoprenyl-7,4′-dimethoxyflavonol-3-O-β-d-arabinofuranoside (1, 5,7-dihydroxy-4′-methoxyflavone-7-O-β-d-arabinopyranosyl-2′′-n-decan-1′′′-oate (2, 3-butanoyl-5,6,8-trihydroxy-7,4′-dimethoxyflavonol--5-O-β-d-glucopyranoside (3, 7, 4′-dimethoxy-5-hydroxyflavone-5-O-α-d-arabinopyranosyl-(2′′ → 1′′′-O-α-d-arabinopyranoside (4, and 5,6-dihydroxy-7, 4′-dimethoxyflavone-5-O-α-d-glucopyranoside (5, together with two known compounds, were isolated from the methanol extract of Oryza sativa leaves and straw. Their structures of new compounds were elucidated by 1D and 2D NMR spectral methods, viz: COSY, HMBC and HSQC aided by mass techniques and IR spectroscopy. The cytotoxicity of these compounds (1–7 were assessed by using (RAW 264.7 mouse macrophages cell line, and allelopathic effects of compounds (1–7 on the germination characteristics of barnyardgrass (Echinochloa oryzicola and pigweed (Chenopodium album L. were also evaluated. The compounds 1, 6 and 7 showed cytotoxicity and compounds 1–7 exhibited significant inhibitory activity on the seed germination of two weed species.

Determination of Optimal Harvest Time of Chuchung Variety Green Rice(®) (Oryza sativa L.) with High Contents of GABA, γ-Oryzanol, and α-Tocopherol.

Science.gov (United States)

Kim, Hoon; Kim, Oui-Woung; Ha, Ae Wha; Park, Soojin

2016-06-01

In our previous study, an early-maturing variety of rice (Oryza sativa L.), Jinbu can have feature with unique green color, various phytochemicals as well as nutritive components by the optimal early harvesting, called Green Rice(®) (GR). The aims of the present field experiments were to evaluate the changes in the weight of 1,000 kernels, yield, and contents of proximate and bioactive compounds in Chuchung, a mid-late maturing variety, during the pre-harvest maturation of rough rice and to research the appropriate harvest time and potent bioactivity of Chuchung GR. The weights of 1,000 kernels of Chuchung GR dramatically increased until 27 days after heading (DAH). The yields of Chuchung GR declined after 27 DAH and significantly declined to 0.0% after 45 DAH. The caloric value and total mineral contents were higher in the GR than in the full ripe stage, the brown rice (BR). In the GR, the contents of bioactive compounds, such as γ-aminobutyric acid, γ-oryzanol, and α-tocopherol, were much higher (P<0.05) than those in the BR, specifically during 24~27 DAH. Therefore, bioactive Chuchung GR can be produced with a reasonable yield at 24~27 DAH and it could be useful for applications in various nutritive and functional food products.

Determination of Optimal Harvest Time of Chuchung Variety Green Rice® (Oryza sativa L.) with High Contents of GABA, γ-Oryzanol, and α-Tocopherol

Science.gov (United States)

Kim, Hoon; Kim, Oui-Woung; Ha, Ae Wha; Park, Soojin

2016-01-01

In our previous study, an early-maturing variety of rice (Oryza sativa L.), Jinbu can have feature with unique green color, various phytochemicals as well as nutritive components by the optimal early harvesting, called Green Rice® (GR). The aims of the present field experiments were to evaluate the changes in the weight of 1,000 kernels, yield, and contents of proximate and bioactive compounds in Chuchung, a mid-late maturing variety, during the pre-harvest maturation of rough rice and to research the appropriate harvest time and potent bioactivity of Chuchung GR. The weights of 1,000 kernels of Chuchung GR dramatically increased until 27 days after heading (DAH). The yields of Chuchung GR declined after 27 DAH and significantly declined to 0.0% after 45 DAH. The caloric value and total mineral contents were higher in the GR than in the full ripe stage, the brown rice (BR). In the GR, the contents of bioactive compounds, such as γ-aminobutyric acid, γ-oryzanol, and α-tocopherol, were much higher (P<0.05) than those in the BR, specifically during 24~27 DAH. Therefore, bioactive Chuchung GR can be produced with a reasonable yield at 24~27 DAH and it could be useful for applications in various nutritive and functional food products. PMID:27390725

Genetic Analysis of Recombinant Inbred Lines for Sorghum bicolor ? Sorghum propinquum

OpenAIRE

Kong, Wenqian; Jin, Huizhe; Franks, Cleve D.; Kim, Changsoo; Bandopadhyay, Rajib; Rana, Mukesh K.; Auckland, Susan A.; Goff, Valorie H.; Rainville, Lisa K.; Burow, Gloria B.; Woodfin, Charles; Burke, John J.; Paterson, Andrew H.

2013-01-01

We describe a recombinant inbred line (RIL) population of 161 F5 genotypes for the widest euploid cross that can be made to cultivated sorghum (Sorghum bicolor) using conventional techniques, S. bicolor ? Sorghum propinquum, that segregates for many traits related to plant architecture, growth and development, reproduction, and life history. The genetic map of the S. bicolor ? S. propinquum RILs contains 141 loci on 10 linkage groups collectively spanning 773.1 cM. Although the genetic map ha...

Black rice (Oryza sativa L.) extract modulates ultraviolet-induced expression of matrix metalloproteinases and procollagen in a skin cell model.

Science.gov (United States)

Han, Mira; Bae, Jung-Soo; Ban, Jae-Jun; Shin, Hee Soon; Lee, Dong Hun; Chung, Jin Ho

2018-05-01

Exposure of the skin to ultraviolet (UV) radiation causes extracellular matrix (ECM) collapse in the dermis, owing to an increase in matrix metalloproteinase (MMP) production in both the epidermis and dermis, and a decrease in type I collagen expression in the dermis. Recently, black rice (Oryza sativa L.) was reported to have a wide range of pharmacological effects in various settings. However, the effects of black rice extract (BRE) on UV‑irradiated skin cells have not yet been characterized. BRE treatment did not affect cell morphology and viability of HaCaT and human dermal fibroblasts (HDF). We demonstrated that BRE downregulated basal and UV‑induced MMP‑1 expression in HaCaT cells. Furthermore, BRE significantly increased type I procollagen expression, and decreased MMP‑1 and MMP‑3 expression in UV‑irradiated HDF. The underlying mechanisms of these results involve a decrease in p38 and c‑Jun N‑terminal kinase activity, and suppression of UV‑induced activation of activator protein‑1 (AP‑1). BRE reduced UV‑induced reactive oxygen species production in HaCaT cells in a dose‑dependent manner. Indeed, mass spectrometry revealed that BRE contained antioxidative flavonoid components such as cyanidin‑3‑O‑β‑D‑glycoside and taxifolin‑7‑O‑glucoside. These findings suggest that BRE attenuates UV‑induced ECM damage by modulating mitogen‑activated protein kinase and AP‑1 signaling, and could be used as an active ingredient for preventing photoaging of the skin.

Improvement of efficient in vitro regeneration potential of mature callus induced from Malaysian upland rice seed (Oryza sativa cv. Panderas).

Science.gov (United States)

Mohd Din, Abd Rahman Jabir; Iliyas Ahmad, Fauziah; Wagiran, Alina; Abd Samad, Azman; Rahmat, Zaidah; Sarmidi, Mohamad Roji

2016-01-01

A new and rapid protocol for optimum callus production and complete plant regeneration has been assessed in Malaysian upland rice (Oryza sativa) cv. Panderas. The effect of plant growth regulator (PGR) on the regeneration frequency of Malaysian upland rice (cv. Panderas) was investigated. Mature seeds were used as a starting material for callus induction experiment using various concentrations of 2,4-D and NAA. Optimal callus induction frequency at 90% was obtained on MS media containing 2,4-D (3 mg L(-1)) and NAA (2 mg L(-1)) after 6 weeks while no significant difference was seen on tryptophan and glutamine parameters. Embryogenic callus was recorded as compact, globular and light yellowish in color. The embryogenic callus morphology was further confirmed with scanning electron microscopy (SEM) analysis. For regeneration, induced calli were treated with various concentrations of Kin (0.5-1.5 mg L(-1)), BAP, NAA and 0.5 mg L(-1) of TDZ. The result showed that the maximum regeneration frequency (100%) was achieved on MS medium containing BAP (0.5 mg L(-1)), Kin (1.5 mg L(-1)), NAA (0.5 mg L(-1)) and TDZ (0.5 mg L(-1)) within four weeks. Developed shoots were successfully rooted on half strength MS free hormone medium and later transferred into a pot containing soil for acclimatization. This cutting-edge finding is unique over the other existing publishable data due to the good regeneration response by producing a large number of shoots.

Do Si/As ratios in growth medium affect arsenic uptake, arsenite efflux and translocation of arsenite in rice (Oryza sativa)?

Science.gov (United States)

Zhang, Min; Zhao, Quanli; Xue, Peiying; Zhang, Shijie; Li, Bowen; Liu, Wenju

2017-10-01

Silicon (Si) may decrease the uptake and accumulation of arsenic (As) in rice. However, the effects of Si/As ratios in growth medium on arsenic uptake, arsenite efflux to the external medium and translocation of arsenite in rice are currently unclear. Rice seedlings (Oryza sativa L.) were exposed to nutrient solutions with 10 μM arsenite [As(III)] or 10 μM arsenate [As(V)] to explore the influence of different silicic acid concentrations (0, 10, 100, 1000 μM) on arsenic uptake and translocation of arsenite with or without 91 μM phosphate for 24 h. Arsenic speciation was determined in nutrient solutions, roots, and shoots. In the arsenite treatments, different Si/As ratios (1:1, 10:1, 100:1) did not affect As(III) uptake by rice roots, however they did inhibit translocation of As(III) from roots to shoots significantly (P rice roots and shoots. A Si/As ratio of 100:1 reduced As(III) translocation from roots to shoots markedly without phosphate. When phosphate was supplied, As(III) translocation from roots to shoots was significantly inhibited by Si/As ratios of 10:1 and 100:1. The results indicated that in the presence of P, different silicic acid concentrations did not impact arsenite uptake and transport in rice when arsenite was supplied. However, a Si/As ratio of 100:1 inhibited As(V) uptake, as well as As(III) efflux and translocation from roots to shoots when arsenate was supplied. Copyright © 2017 Elsevier Ltd. All rights reserved.

[Effect of selenium on the uptake and translocation of manganese, iron, phosphorus and selenium in rice (Oryza sativa L.)].

Science.gov (United States)

Hu, Ying; Huang, Yi-Zong; Huang, Yan-Chao; Liu, Yun-Xia; Liang, Jian-Hong

2013-10-01

A pot experiment was conducted to clarify the effect of selenium on the uptake and translocation of manganese (Mn), iron (Fe) , phosphorus (P) and selenium (Se) in rice ( Oryza sativa L.). The results showed that addition of Se led to the significant increase of Se concentration in iron plaque on the root surface, root, shoot, husk and brown rice, and significant decrease of Mn concentration in shoot, husk and brown rice. At the Se concentrations of 0.5 and 1.0 mg.kg-1 in soil, Mn concentrations in rice shoot decreased by 32. 2% and 35.0% respectively, in husk 22.0% and 42.6% , in brown rice 27.5% and 28.5% , compared with the Se-free treatment. There was no significant effect of Se on the P and Fe concentrations in every parts of rice, except for Fe concentrations in husk. The translocation of P and Fe from iron plaque, root, shoot and husk to brown rice was not significantly affected by Se addition, but Mn translocation from iron plaque and root to brown rice was significantly inhibited by Se addition. Addition of 1.0 mg.kg-1. Se resulted in the decrease of translocation factor from iron plaque and root to brown rice by 38.9% and 37.9%, respectively, compared with the control treatment. The distribution ratios of Mn, Fe, P and Se in iron plaque, root, shoot, husk and brown rice were also affected by Se addition. The results indicated that Mn uptake, accumulation and translocation in rice could be decreased by the addition of Se in soil, therefore, Se addition could reduce the Mn harm to human health through food chain.

a survey of sorghum downy mildew in sorghum in the sudano

African Journals Online (AJOL)

DR. AMINU

Sahel savanna AEZs respectively) indicated that the disease was present only at the seedling stage ... In the southern guinea ... northern Nigeria, sorghum downy mildew in sorghum .... There was a significant (P>0.05) difference in SDM.

Comparison of phenotyping methods for resistance to stem rot and aggregated sheath spot in rice

Science.gov (United States)

Stem and sheath diseases caused by Sclerotium oryzae Cattaneo (SCL) and Rhizoctonia oryzae-sativae Sawada Mordue (ROS) can severely reduce rice (Oryza sativa L.) yield and grain quality. Genetic resistance is the best strategy to control them. Phenotypic selection for resistance is hampered due to a...

Comparison of gene co-networks reveals the molecular mechanisms of the rice (Oryza sativa L.) response to Rhizoctonia solani AG1 IA infection.

Science.gov (United States)

Zhang, Jinfeng; Zhao, Wenjuan; Fu, Rong; Fu, Chenglin; Wang, Lingxia; Liu, Huainian; Li, Shuangcheng; Deng, Qiming; Wang, Shiquan; Zhu, Jun; Liang, Yueyang; Li, Ping; Zheng, Aiping

2018-05-05

Rhizoctonia solani causes rice sheath blight, an important disease affecting the growth of rice (Oryza sativa L.). Attempts to control the disease have met with little success. Based on transcriptional profiling, we previously identified more than 11,947 common differentially expressed genes (TPM > 10) between the rice genotypes TeQing and Lemont. In the current study, we extended these findings by focusing on an analysis of gene co-expression in response to R. solani AG1 IA and identified gene modules within the networks through weighted gene co-expression network analysis (WGCNA). We compared the different genes assigned to each module and the biological interpretations of gene co-expression networks at early and later modules in the two rice genotypes to reveal differential responses to AG1 IA. Our results show that different changes occurred in the two rice genotypes and that the modules in the two groups contain a number of candidate genes possibly involved in pathogenesis, such as the VQ protein. Furthermore, these gene co-expression networks provide comprehensive transcriptional information regarding gene expression in rice in response to AG1 IA. The co-expression networks derived from our data offer ideas for follow-up experimentation that will help advance our understanding of the translational regulation of rice gene expression changes in response to AG1 IA.

Effect of peanut shell and wheat straw biochar on the availability of Cd and Pb in a soil-rice (Oryza sativa L.) system.

Science.gov (United States)

Xu, Chao; Chen, Hao-Xiang; Xiang, Qian; Zhu, Han-Hua; Wang, Shuai; Zhu, Qi-Hong; Huang, Dao-You; Zhang, Yang-Zhu

2018-01-01

Soil amendments, such as biochar, have been used to enhance the immobilization of heavy metals in contaminated soil. A pot experiment was conducted to immobilize the available cadmium (Cd) and lead (Pb) in soil using peanut shell biochar (PBC) and wheat straw biochar (WBC), and to observe the accumulation of these heavy metals in rice (Oryza sativa L.). The application of PBC and WBC led to significantly higher pH, soil organic carbon (SOC), and cation exchange capacity (CEC) in paddy soil, while the content of MgCl 2 -extractable Cd and Pb was lower than that of untreated soil. MgCl 2 -extractable Cd and Pb showed significant negative correlations with pH, SOC, and CEC (p rice plants. Specially, when compared to the corresponding concentrations in rice grown in control soils, 5% PBC addition lowered Cd and Pb concentrations in grains by 22.9 and 12.2%, respectively, while WBC addition lowered them by 29.1 and 15.0%, respectively. Compared to Pb content, Cd content was reduced to a greater extent in grain by PBC and WBC. These results suggest that biochar application is effective for immobilizing Cd and Pb in contaminated paddy soil, and reduces their bioavailability in rice. Biochar could be used as a soil amendment for the remediation of soils contaminated with heavy metals.

TECHNOLOGICAL ADVANCES IN THE OBTAINING OF ETHANOL FROM Sweet sorghum (Sorghum bicolor (L. Moench

Directory of Open Access Journals (Sweden)

Sandro Pedroso Cunha

2010-11-01

Full Text Available ABSTRACT: Replacing the use of gasoline with ethanol in vehicles reduces by 90% CO2 emissions, this justifies the interest in the use of bioethanol as renewable energy. Besides sugar cane, cassava, maize and sugar beet special emphasis is being given to sorghum (Sorghum bicolor L. Moench to produce ethanol for its productivity and resistance. The sorghum is grown in Rio Grande do Sul with a production of about 70,000 tons / year. Embrapa has a program to develop cultivars of sorghum from the time the Pro-Alcohol and currently 25 new varieties of sorghum are being evaluated. Several factors are relevant in the optimization of production such as increased productivity and reduced costs in the production of ethanol. This study aimed to survey recent data that will assess production parameters of ethanol from sorghum. Factors such as reducing the risk of bacterial contamination, the means conducive to fermentation processes or grain sorghum stalk through the use of pretreatment of the sample, have been of great importance because it is basically turning cellulosic biomass into fermentable sugars. Superior genotypes of sweet sorghum for ethanol production are of utmost importance, as well as better ways to convert sugars into ethanol. Lignin, toxic against microorganisms, prevents the conversion of lignocellulose into ethanol. The conversion of lignocellulosic ethanol compounds based on the hydrolysis of cellulose producing simple sugars and fermenting those sugars into ethanol through microbiology.

Extração, análise e distribuição dos ácidos fenólicos em genótipos pigmentados e não pigmentados de arroz (Oryza sativa L. Extraction, analysis and distribution of phenolic acids in pigmented and non-pigmented genotypes of rice (Oryza sativa L.

Directory of Open Access Journals (Sweden)

Nádia Valéria Mussi de Mira

2008-12-01

Full Text Available Neste estudo, avaliaram-se a distribuição dos Compostos Fenólicos Totais (CFT e o perfil de ácidos fenólicos, presentes nas frações, solúvel e insolúvel de dez genótipos de arroz (Oryza sativa L. de pericarpo pigmentado e não pigmentado. Devido à sua elevada capacidade antioxidante, os compostos fenólicos vem sendo apontados como possíveis promotores da saúde. Grande parte corresponde aos ácidos fenólicos presentes no grão sob a forma solúvel (livre e conjugada e insolúvel (ligada. Na literatura há poucas informações sobre a contribuição dos compostos fenólicos ligados, cujos teores são costumeiramente subestimados. Os CFT foram quantificados pelo método de Folin-Ciocalteau, enquanto os ácidos fenólicos por RP-HPLC. Na fração solúvel dos genótipos pigmentados, os teores de CFT foram variáveis, mas, em média, 5,7 vezes maiores do que nos não pigmentados (média de 3468 e 602 µg eq. Ácido Ferúlico (AF/g arroz, respectivamente, principalmente devido à presença de antocianinas e proantocianidinas. Na fração insolúvel, os pigmentados apresentaram duas vezes mais CFT do que os não pigmentados (825 e 378 µg eq. AF/g arroz, respectivamente, provavelmente devido à retenção de antocianinas e proantocianidinas, mesmo após cinco extrações consecutivas. Dentre os ácidos fenólicos, o ácido ferúlico foi o principal componente em todos os genótipos estudados, exceto no arroz preto, no qual predominou o ácido protocatecóico.This study was conducted to evaluate the distribution of total phenolic compounds and phenolic acids in the soluble and insoluble fractions of 10 rice (Oryza sativa L. genotypes with pigmented or non-pigmented pericarp. These compounds were reported to exert beneficial effects on human health due to their high antioxidant activities. The total phenolic compounds (CFT in both fractions was determined by the Folin-Ciocalteau method and phenolic acids RP-HPLC with Diode-Array Detection

Using brown midrib 6 dwarf forage sorghum silage and fall-grown oat silage in lactating dairy cow rations.

Science.gov (United States)

Harper, M T; Oh, J; Giallongo, F; Lopes, J C; Roth, G W; Hristov, A N

2017-07-01

Double cropping and increasing crop diversity could improve dairy farm economic and environmental sustainability. In this experiment, corn silage was partially replaced with 2 alternative forages, brown midrib-6 brachytic dwarf forage sorghum (Sorghum bicolor) or fall-grown oat (Avena sativa) silage, in the diet of lactating dairy cows. We investigated the effect on dry matter (DM) intake, milk yield (MY), milk components and fatty acid profile, apparent total-tract nutrient digestibility, N utilization, enteric methane emissions, and income over feed cost. We analyzed the in situ DM and neutral detergent fiber disappearance of the alternative forages versus corn silage and alfalfa haylage. Sorghum was grown in the summer and harvested in the milk stage. Oats were grown in the fall and harvested in the boot stage. Compared with corn silage, neutral detergent fiber and acid detergent fiber concentrations were higher in the alternative forages. Lignin content was highest for sorghum silage and similar for corn silage and oat silage. The alternative forages had less than 1% starch compared with the approximately 35% starch in the corn silage. Ruminal in situ DM effective degradability was similar, although statistically different, for corn silage and oat silage, but lower for sorghum silage. Diets with the alternative forages were fed in a replicated 3 × 3 Latin square design experiment with three 28-d periods and 12 Holstein cows. The control diet contained 44% (DM basis) corn silage. In the other 2 diets, sorghum or oat silages were included at 10% of dietary DM, replacing corn silage. Sorghum silage inclusion decreased DM intake, MY, and milk protein content but increased milk fat and maintained energy-corrected MY similar to the control. Oat silage had no effect on DM intake, MY, or milk components compared to the control. The oat silage diet increased apparent total-tract digestibility of dietary nutrients, except starch, whereas the sorghum diet slightly

Evaluation and characterization of advanced rice mutant line of rice (Oryza sativa), MR219-4 and MR219-9 under drought condition

International Nuclear Information System (INIS)

Abdul Rahim Harun; Zarith Shafika Kamarudin; Abdullah, M.Z.; Anna, L.P.K.; Sobri Hussain; Rusli Ibrahim; Khairuddin abdul Rahim

2012-01-01

Two advance rice mutant lines, MR219-4 and MR219-9 derived from mutagenesis of Oryza sativa cv. MR219 with gamma radiation at 300 Gy were evaluated in simulated drought condition in the greenhouse at Malaysian Nuclear Agency. The mutants were evaluated simultaneously with ARN1, a drought resistant variety and MR211 a susceptible cultivar as a check. Randomized complete block design with three replicates was used in the experiment. The evaluation and selection were done based on leaf rolling and leaf drying as well as other agronomic traits, such as, number of tillers per plant, plant height, flag leaf area, grain weight per plant, grain yield per plant, 100-grain weight, harvest index, panicle length and plant biomass. The mutants MR219-4 showed moderate tolerance and MR219-9 showed tolerance to drought respectively as compare to the check variety (ARN1, MR211) and control MR219. Leaf rolling, leaf drying, days to flowering and days to maturity are valuable secondary traits that may provide additional information for selection because of associating with the plant survival under water stress. Further research on expression of drought-tolerant lines under different drought conditions is essential in order to identify particular traits that are associated with drought tolerance and high yield potential. Similarly the importance of secondary traits, relative to other putative traits for drought tolerance, needs to be tested in various environments. (author)

In silico Allergenicity Study of Insect resistant genetically Modified Rice (Oryza sativa L. for assessment of biosafety

Directory of Open Access Journals (Sweden)

S.K. Das

2017-12-01

Full Text Available India is one of the world's largest producers of rice (Oryza sativa, accounting for 20% of all world rice production. However, lepidopteran pests severely impact the harvest of rice, which leads to environmental pollution and increase production cost. Alternatively, genetic engineering methods may be used to prevent rice pests and increase production of rice in a safe and environmentally friendly manner. Bacillus thuringiensis (Bt genes have been widely used to generate genetically modified (GM crops because the expressed cry1Ab protein confers resistance to lepidopteron pests. The proteins expressed by these genes may lead to food safety problems. Thus, safety evaluations are necessary prior to commercialization. Bioinformatics analysis for allergenicity assessment of cry1Ab protein is performed using different allergen databases viz. FARRP SDAP, Allergome, and Algpred to identify any potential sequence matches to allergen proteins that might indicate allergenic cross-reactivity with the query sequence. A full FASTA search was performed to identify highly similar proteins. However; the full length search cannot identify discontinuous or conformational epitopes that depend upon the tertiary structure of the protein.So every possible contiguous 80-amino acid sequence of each query protein was searched for determining the similarity. The proteins sequence can be searched using FASTA/BLAST for broad homology to known allergens to identify any short sequence that might represent an allergenic epitope. The domains in the Cry protein sequences were searched using Interproscan for potential similarity at the domain level. The results showed neither significant alignment nor similarity of cry1Ab protein at full sequence, domain, and epitope level with any of the known allergen proteins in the full sequence matching. Matching the 80 amino acid and matching of 8 amino acids showed no similarity to determine the epitope potential. From literature survey

Sorghum allelopathy--from ecosystem to molecule.

Science.gov (United States)

Weston, Leslie A; Alsaadawi, Ibrahim S; Baerson, Scott R

2013-02-01

Sorghum allelopathy has been reported in a series of field experiments following sorghum establishment. In recent years, sorghum phytotoxicity and allelopathic interference also have been well-described in greenhouse and laboratory settings. Observations of allelopathy have occurred in diverse locations and with various sorghum plant parts. Phytotoxicity has been reported when sorghum was incorporated into the soil as a green manure, when residues remained on the soil surface in reduced tillage settings, or when sorghum was cultivated as a crop in managed fields. Allelochemicals present in sorghum tissues have varied with plant part, age, and cultivar evaluated. A diverse group of sorghum allelochemicals, including numerous phenolics, a cyanogenic glycoside (dhurrin), and a hydrophobic p-benzoquinone (sorgoleone) have been isolated and identified in recent years from sorghum shoots, roots, and root exudates, as our capacity to analyze and identify complex secondary products in trace quantities in the plant and in the soil rhizosphere has improved. These allelochemicals, particularly sorgoleone, have been widely investigated in terms of their mode(s) of action, specific activity and selectivity, release into the rhizosphere, and uptake and translocation into sensitive indicator species. Both genetics and environment have been shown to influence sorgoleone production and expression of genes involved in sorgoleone biosynthesis. In the soil rhizosphere, sorgoleone is released continuously by living root hairs where it accumulates in significant concentrations around its roots. Further experimentation designed to study the regulation of sorgoleone production by living sorghum root hairs may result in increased capacity to utilize sorghum cover crops more effectively for suppression of germinating weed seedlings, in a manner similar to that of soil-applied preemergent herbicides like trifluralin.

Use of hybridization (F1 in forage sorghum (Sorghum bicolor (L. Moench breeding

Directory of Open Access Journals (Sweden)

Pataki Imre

2010-01-01

Full Text Available In plants with bisexual flowers, the development of hybrids and F1 seed production is only possible by using cytoplasmatic male sterility. The discovery of such sterility and the maintainers has made it possible to utilize the phenomenon of heterosis to improve yields and yield components in forage sorghum. It has been shown that the best way to develop forage sorghum hybrids is to cross grain sorghum as the female parent and Sudan grass as the male. The objective of this study was to develop a forage sorghum hybrid for the production of green matter to be used either fresh or for silage. The sorghum hybrid developed in these efforts (Siloking is intended for multiple cutting, as the basal nodes produce buds and regrowth takes place. The performance of the new hybrid with respect to yield and quality was compared to that of the forage sorghum cultivar NS Džin. In a two-year study conducted under different growing conditions in four locations, Siloking produced an average green matter yield of 86.29 t ha-1 (two cuts, a dry matter yield of 25.34 t ha-1, and a crude protein content of 11.85 %. Siloking outperformed NS Džin in terms of yield and quality. .

The Effect of Silicon on Photosynthesis and Expression of Its Relevant Genes in Rice (Oryza sativa L.) under High-Zinc Stress

Science.gov (United States)

Song, Alin; Li, Ping; Fan, Fenliang; Li, Zhaojun; Liang, Yongchao

2014-01-01

The main objectives of this study were to elucidate the roles of silicon (Si) in alleviating the effects of 2 mM zinc (high Zn) stress on photosynthesis and its related gene expression levels in leaves of rice (Oryza sativa L.) grown hydroponically with high-Zn stress. The results showed that photosynthetic parameters, including net photosynthetic rate, transpiration rate, stomatal conductance, intercellular CO2 concentration, chlorophyll concentration and the chlorophyll fluorescence, were decreased in rice exposed to high-Zn treatment. The leaf chloroplast structure was disordered under high-Zn stress, including uneven swelling, disintegrated and missing thylakoid membranes, and decreased starch granule size and number, which, however, were all counteracted by the addition of 1.5 mM Si. Furthermore, the expression levels of Os08g02630 (PsbY), Os05g48630 (PsaH), Os07g37030 (PetC), Os03g57120 (PetH), Os09g26810 and Os04g38410 decreased in Si-deprived plants under high-Zn stress. Nevertheless, the addition of 1.5 mM Si increased the expression levels of these genes in plants under high-Zn stress at 72 h, and the expression levels were higher in Si-treated plants than in Si-deprived plants. Therefore, we conclude that Si alleviates the Zn-induced damage to photosynthesis in rice. The decline of photosynthesis in Zn-stressed rice was attributed to stomatal limitation, and Si activated and regulated some photosynthesis-related genes in response to high-Zn stress, consequently increasing photosynthesis. PMID:25426937

(cucurbita pepo) and sorghum

African Journals Online (AJOL)

big timmy

... properties of pumpkin (Cucurbita pepo) and sorghum (Sorghum bicolor) flour blends fermented with pure strains of Lactobacillus ... good storage characteristics and affordable cost. (Akinrele ... (MRS), Nutrient agar (NA) and Potato dextrose.

The Organelle Genomes of Hassawi Rice (Oryza sativa L.) and Its Hybrid in Saudi Arabia: Genome Variation, Rearrangement, and Origins

Science.gov (United States)

Zhang, Tongwu; Hu, Songnian; Zhang, Guangyu; Pan, Linlin; Zhang, Xiaowei; Al-Mssallem, Ibrahim S.; Yu, Jun

2012-01-01

Hassawi rice (Oryza sativa L.) is a landrace adapted to the climate of Saudi Arabia, characterized by its strong resistance to soil salinity and drought. Using high quality sequencing reads extracted from raw data of a whole genome sequencing project, we assembled both chloroplast (cp) and mitochondrial (mt) genomes of the wild-type Hassawi rice (Hassawi-1) and its dwarf hybrid (Hassawi-2). We discovered 16 InDels (insertions and deletions) but no SNP (single nucleotide polymorphism) is present between the two Hassawi cp genomes. We identified 48 InDels and 26 SNPs in the two Hassawi mt genomes and a new type of sequence variation, termed reverse complementary variation (RCV) in the rice cp genomes. There are two and four RCVs identified in Hassawi-1 when compared to 93–11 (indica) and Nipponbare (japonica), respectively. Microsatellite sequence analysis showed there are more SSRs in the genic regions of both cp and mt genomes in the Hassawi rice than in the other rice varieties. There are also large repeats in the Hassawi mt genomes, with the longest length of 96,168 bp and 96,165 bp in Hassawi-1 and Hassawi-2, respectively. We believe that frequent DNA rearrangement in the Hassawi mt and cp genomes indicate ongoing dynamic processes to reach genetic stability under strong environmental pressures. Based on sequence variation analysis and the breeding history, we suggest that both Hassawi-1 and Hassawi-2 originated from the Indonesian variety Peta since genetic diversity between the two Hassawi cultivars is very low albeit an unknown historic origin of the wild-type Hassawi rice. PMID:22870184

Low pH-induced changes of antioxidant enzyme and ATPase activities in the roots of rice (Oryza sativa L. seedlings.

Directory of Open Access Journals (Sweden)

Yi-Kai Zhang

Full Text Available Soil acidification is the main problem in the current rice production. Here, the effects of low pH on the root growth, reactive oxygen species metabolism, plasma membrane functions, and the transcript levels of the related genes were investigated in rice seedlings (Oryza sativa L. in a hydroponic system at pH 3.5, 4.5, and 5.5. There were two hybrid rice cultivars in this trial, including Yongyou 12 (YY12, a japonica hybrid and Zhongzheyou 1 (ZZY1, an indica hybrid. Higher H+ activity markedly decreased root length, the proportion of fine roots, and dry matter production, but induced a significant accumulation of hydrogen peroxide (H2O2, and led to serious lipid peroxidation in the roots of the two varieties. The transcript levels of copper/zinc superoxide dismutase 1 (Cu/Zn SOD1, copper/zinc superoxide dismutase 2 (Cu/Zn SOD2, catalase A (CATA and catalase B (CATB genes in YY12 and ZZY1 roots were significantly down-regulated after low pH exposure for two weeks. Meanwhile, a significant decrease was observed in the expression of the P-type Ca2+-ATPases in roots at pH 3.5. The activities of antioxidant enzymes (SOD, CAT and plasma membrane (PM Ca2+-ATPase in the two varieties were dramatically inhibited by strong rhizosphere acidification. However, the expression levels of ascorbate peroxidase 1 (APX1 and PM H+-ATPase isoform 7 were up-regulated under H+ stress compared with the control. Significantly higher activities of APX and PM H+-ATPase could contribute to the adaptation of rice roots to low pH.

Impact of postharvest drying conditions on in vitro starch digestibility and estimated glycemic index of cooked non-waxy long-grain rice (Oryza sativa L.).

Science.gov (United States)

Donlao, Natthawuddhi; Ogawa, Yukiharu

2017-02-01

Wet paddy needs to be dried to reduce its moisture content after harvesting. In this study, effects of postharvest drying condition on in vitro starch digestibility and estimated glycemic index of cooked rice (Oryza sativa L.) were investigated. Varying drying conditions, i.e. hot-air drying at 40, 65, 90 and 115 °C, and sun drying were applied to raw paddy. After husking and polishing, polished grains were cooked using an electric rice cooker. Cooked samples were analyzed for their moisture content and amount of resistant and total starch. Five samples in both intact grain and slurry were digested under simulated in vitro gastrointestinal digestion process. The in vitro starch digestion rate was measured and the hydrolysis index (HI) and estimated glycemic index (eGI) were calculated. Cooked rice obtained from hot-air drying showed relatively lower HI and eGI than that obtained from sun-drying. Among samples from hot-air drying treatment, eGI of cooked rice decreased with increasing drying temperature, except for the drying temperature of 115 °C. As a result, cooked rice from the hot-air drying at 90 °C showed lowest eGI. The results indicated that cooked rice digestibility was affected by postharvest drying conditions. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Sorghums: viable biomass candidates

Energy Technology Data Exchange (ETDEWEB)

McClure, T A; Arthur, M F; Kresovich, S; Scantland, D A

1980-01-01

Agronomic studies conducted at Battelle's Columbus Division to evaluate biomass and sugar yields of sweet sorghum are described and the major findings are summarized. Development opportunities for using sorghum cultivars as a large-scale energy crop are discussed. With presently available cultivars, sweet sorghum should produce 3500 to 4000 liters ethanol per hectare from the fermentable sugars alone. Conversion of the stalk fibers into alcohol could increase production by another 1600 to 1900 liters per hectare with existing cultivars. These yields are approximately 30 to 40% greater per hectare than would be obtained from above average yields of grain and stalk fiber with corn. There is reason to believe, that with hybrid sweet sorghum, these yields could be further increased by as much as 30%. Diminishing land availability for agricultural crops necessitates that maximum yields be obtained. Over the next decade, imaginative technological innovations in sorghum harvesting, processing, and crop preservation, coupled with plant breeding research should help this crop realize its full potential as a renewable resource for energy production.

[Quantifying rice (Oryza sativa L.) photo-assimilated carbon input into soil organic carbon pools following continuous 14C labeling].

Science.gov (United States)

Nie, San-An; Zhou, Ping; Ge, Ti-Da; Tong, Cheng-Li; Xiao, He-Ai; Wu, Jin-Shui; Zhang, Yang-Zhu

2012-04-01

The microcosm experiment was carried out to quantify the input and distribution of photo-assimilated C into soil C pools by using a 14C continuous labeling technique. Destructive samplings of rice (Oryza sativa) were conducted after labeling for 80 days. The allocation of 14C-labeled photosynthates in plants and soil C pools such as dissolved organic C (DOC) and microbial biomass C (MBC) in rice-planted soil were examined over the 14C labeling span. The amounts of rice shoot and root biomass C was ranged from 1.86 to 5.60 g x pot(-1), 0.46 to 0.78 g x pot(-1) in different tested paddy soils after labeling for 80 days, respectively. The amount of 14C in the soil organic C (14C-SOC) was also dependent on the soils, ranged from 114.3 to 348.2 mg x kg(-1), accounting for 5.09% to 6.62% of the rice biomass 14C, respectively. The amounts of 14C in the dissolved organic C (14C-DOC) and in the microbial biomass C(14C-MBC), as proportions of 14C-SOC, were 2.21%-3.54% and 9.72% -17.2%, respectively. The 14C-DOC, 14C-MBC, and 14C-SOC as proportions of total DOC, MBC, and SOC, respectively, were 6.72% -14.64%, 1.70% -7.67%, and 0.73% -1.99%, respectively. Moreover, the distribution and transformation of root-derived C had a greater influence on the dynamics of DOC and MBC than on the dynamics of SOC. Further studies are required to ascertain the functional significance of soil microorganisms (such as C-sequestering bacteria and photosynthetic bacteria) in the paddy system.

Seed Germination Behaviors Of Some Aerobic Rice Cultivars Oryza Sativa L After Priming With Polyethylene Glycol-8000 Peg-8000

Directory of Open Access Journals (Sweden)

Elkheir H.A

2015-08-01

Full Text Available Seed Priming Is Famous Technique To Accelerate Seed Germination Behaviors. This Experiment Was Conducted To Study The Effect Of Polyethylene Glycol-8000 Peg-8000 As Priming Agent On Seed Germination Behavior Of Some Aerobic Rice Cultivars Oryza Sativa L. Experiment Was Carried Out By Using Two-Factor Three Aerobic Rice Cultivars And Peg With Four Replications Which Arranged In Factorial System Design And Conducted With Completely Randomized Design. The Factor Was Varieties Which Were Inpago 8 V1 Ir64 V2 And Situbagendit V3 Combine With 4 Levels Of Peg Concentrations 0100 And 200 Gl-1 And Control With No Treatment. Experiment Was Repeated 4 Times So Total Number Of Experimental Units Were 48. Germination Parameters Measured Were Germination Percentage Germination Index Days Of 50 Germination Seedling Fresh Weight Mg Seedling Shoot Fresh Weight And Root Fresh Weight Mg Seedling Dry Weigh Mg Seedling Shoot Dry Weight And Root Dry Weight Mg ShootRoot Ratio Seedling Length Cm Seedling Root Length Cm And Shoot Length Cm And Seed Vigor Index. The Results Indicated That Seed Priming Significantly Affected Germination Behaviors Compared With Control Depending Upon Varieties. The Highest Germination Was Obtained Under Laboratory And Greenhouse Condition By The Treatment Of Peg 200 G L-1 On The Situbagendit And Ir-64 Variety 90.25 And 93.33 Respectively Compared To Control In Inpago-8 In Both Laboratory 75.75 And Greenhouse 80 . As Implementation To Increase Seed And Seedling Vigor Of Rice It Is A Best Practice To Use Peg Priming With 200 Gl-1 Solutions Depend Upon Varietal Response And We Suggest That More Research About The Effect Of Peg As Seed Priming Techniques On Seed Germination Behavior Of Many Grain Crops Is Needed To Confirm The Methodology.

Copper and ectopic expression of the Arabidopsis transport protein COPT1 alter iron homeostasis in rice (Oryza sativa L.).

Science.gov (United States)

Andrés-Bordería, Amparo; Andrés, Fernando; Garcia-Molina, Antoni; Perea-García, Ana; Domingo, Concha; Puig, Sergi; Peñarrubia, Lola

2017-09-01

Copper deficiency and excess differentially affect iron homeostasis in rice and overexpression of the Arabidopsis high-affinity copper transporter COPT1 slightly increases endogenous iron concentration in rice grains. Higher plants have developed sophisticated mechanisms to efficiently acquire and use micronutrients such as copper and iron. However, the molecular mechanisms underlying the interaction between both metals remain poorly understood. In the present work, we study the effects produced on iron homeostasis by a wide range of copper concentrations in the growth media and by altered copper transport in Oryza sativa plants. Gene expression profiles in rice seedlings grown under copper excess show an altered expression of genes involved in iron homeostasis compared to standard control conditions. Thus, ferritin OsFER2 and ferredoxin OsFd1 mRNAs are down-regulated whereas the transcriptional iron regulator OsIRO2 and the nicotianamine synthase OsNAS2 mRNAs rise under copper excess. As expected, the expression of OsCOPT1, which encodes a high-affinity copper transport protein, as well as other copper-deficiency markers are down-regulated by copper. Furthermore, we show that Arabidopsis COPT1 overexpression (C1 OE ) in rice causes root shortening in high copper conditions and under iron deficiency. C1 OE rice plants modify the expression of the putative iron-sensing factors OsHRZ1 and OsHRZ2 and enhance the expression of OsIRO2 under copper excess, which suggests a role of copper transport in iron signaling. Importantly, the C1 OE rice plants grown on soil contain higher endogenous iron concentration than wild-type plants in both brown and white grains. Collectively, these results highlight the effects of rice copper status on iron homeostasis, which should be considered to obtain crops with optimized nutrient concentrations in edible parts.

Analysis of aluminium sensitivity in sorghum (Sorghum bicolor (L.) Moench) genotypes

NARCIS (Netherlands)

Tan, K.

1993-01-01

Twelve genotypes of sorghum ( Sorghum bicolor (L.) Moench) differing in Al sensitivity were grown in an acid soil (with additions of lime or MgSO ₄ ) and in nutrient solutions (with or without Al at constant pH) for periods between 14 and 35 days.

Modulation of proton pumping across proteoliposome membranes reconstituted with tonoplast H(+)-ATPase from cultured rice (Oryza sativa L. var. Boro) cells by acyl steryl glucoside and steryl glucoside.

Science.gov (United States)

Yamaguchi, Mineo; Kasamo, Kunihiro

2002-07-01

Tonoplast H(+)-ATPase purified from cultured rice cells (Oryza sativa L. var. Boro) was reconstituted into asolectin liposomes containing steryl glucoside (SG) or acyl steryl glucoside (ASG), and the effects of SG and ASG on proton pumping, ATP-hydrolysis activity and proton permeability of the proteoliposome membranes were investigated. In the proteoliposomes containing 10 mol% SG, proton pumping and ATP-hydrolysis activity were increased to around 140% of those in SG-free proteoliposomes. In the proteoliposomes containing ASG, proton pumping and ATP-hydrolysis activity were decreased to one-tenth of those in ASG-free proteoliposomes at 15 mol% ASG; however, activity increased again slightly in the range between 20 and 40 mol% ASG. The change in proton pumping across the proteoliposome membrane is not due to a change of proteoliposome size nor to the location of the catalytic site of the tonoplast H(+)-ATPase in the proteoliposomes. SG and ASG also reduced the passive proton permeability of the proteoliposomes. These results show that SG and ASG modulate proton pumping across the tonoplast toward stimulation and depression, respectively, and they reduce the passive proton permeability of the tonoplast.

Genetic Dissection of Bioenergy-Related Traits in Sweet Sorghum (Sorghum bicolor) under Danish Agro-Climatic Conditions

DEFF Research Database (Denmark)

Mocoeur, Anne Raymonde Joelle

Sorghum (Sorghum bicolor (L.) Moench), a C4 African originated grass, ranks 5th most important crop worldwide, feeding over 500 million people in tropical regions as it withstands a wide panel of biotic and abiotic stresses. The small and simple diploid genome of sorghum was elected as the third...... plant for sequencing in 2009 promoting it as a C4 model plant. Among the very diverse genetic resources available for sorghum, sweet sorghum plants; amassing large quantities of juice-rich and sugar-rich stem, grain and vegetative biomass; have been enlightened as bioenergy crop as it can produced from...... a single plant food, feed and fuel. Sweet sorghum has gained interest in Europe to replace maize, for biogas and bioenergy productions, but this versatile crop is sensitive to chilling temperatures and little breeding efforts have been done toward its cold acclimation. The state-of-art of using...

Achievements and problems in the weed control in grain sorghum (Sorghum Bicolor Moench.

Directory of Open Access Journals (Sweden)

Gr. Delchev

2017-09-01

Full Text Available Abstract. Chemical control has emerged as the most efficient method of weed control. Herbicides combinations and tank mixtures of herbicides with adjuvants, fertilizers, growth regulators, fungicides, insecticides are more effective than when applied alone on sorghum crops. Their combined use often leads to high synergistic effect on yield. The use of herbicide antidotes for the treatment of seeds in sorghum is a safe way to overcome its high sensitivity to many herbicides. Data regarding herbicide for chemical control of annual graminaceous weeds in sorghum crops are quite scarce even worldwide. Problem is the persistence of some herbicides used in the predecessors on succeeding crops, which is directly related to the weather conditions during their degradation. Most of the information on sorghum relates to the conventional technology for weed control. There is no information about the new Concep technology in grain sorghum. A serious problem is also the volunteers of the Clearfield and Express sun sunflower. They have resistance to herbicides different from that of conventional sunflower hybrids. There is no information yet in scientific literature on control of these volunteers.

Genetic dissection of black grain rice by the development of a near isogenic line

OpenAIRE

Maeda, Hiroaki; Yamaguchi, Takuya; Omoteno, Motoyasu; Takarada, Takeshi; Fujita, Kenji; Murata, Kazumasa; Iyama, Yukihide; Kojima, Yoichiro; Morikawa, Makiko; Ozaki, Hidenobu; Mukaino, Naoyuki; Kidani, Yoshinori; Ebitani, Takeshi

2014-01-01

Rice (Oryza sativa L.) can produce black grains as well as white. In black rice, the pericarp of the grain accumulates anthocyanin, which has antioxidant activity and is beneficial to human health. We developed a black rice introgression line in the genetic background of Oryza sativa L. ‘Koshihikari’, which is a leading variety in Japan. We used Oryza sativa L. ‘Hong Xie Nuo’ as the donor parent and backcrossed with ‘Koshihikari’ four times, resulting in a near isogenic line (NIL) for black g...

Genome-wide analysis of Dongxiang wild rice (Oryza rufipogon Griff.) to investigate lost/acquired genes during rice domestication.

Science.gov (United States)

Zhang, Fantao; Xu, Tao; Mao, Linyong; Yan, Shuangyong; Chen, Xiwen; Wu, Zhenfeng; Chen, Rui; Luo, Xiangdong; Xie, Jiankun; Gao, Shan

2016-04-26

It is widely accepted that cultivated rice (Oryza sativa L.) was domesticated from common wild rice (Oryza rufipogon Griff.). Compared to other studies which concentrate on rice origin, this study is to genetically elucidate the substantially phenotypic and physiological changes from wild rice to cultivated rice at the whole genome level. Instead of comparing two assembled genomes, this study directly compared the Dongxiang wild rice (DXWR) Illumina sequencing reads with the Nipponbare (O. sativa) complete genome without assembly of the DXWR genome. Based on the results from the comparative genomics analysis, structural variations (SVs) between DXWR and Nipponbare were determined to locate deleted genes which could have been acquired by Nipponbare during rice domestication. To overcome the limit of the SV detection, the DXWR transcriptome was also sequenced and compared with the Nipponbare transcriptome to discover the genes which could have been lost in DXWR during domestication. Both 1591 Nipponbare-acquired genes and 206 DXWR-lost transcripts were further analyzed using annotations from multiple sources. The NGS data are available in the NCBI SRA database with ID SRP070627. These results help better understanding the domestication from wild rice to cultivated rice at the whole genome level and provide a genomic data resource for rice genetic research or breeding. One finding confirmed transposable elements contribute greatly to the genome evolution from wild rice to cultivated rice. Another finding suggested the photophosphorylation and oxidative phosphorylation system in cultivated rice could have adapted to environmental changes simultaneously during domestication.

A hairy-leaf gene, BLANKET LEAF, of wild Oryza nivara increases photosynthetic water use efficiency in rice.

Science.gov (United States)

Hamaoka, Norimitsu; Yasui, Hideshi; Yamagata, Yoshiyuki; Inoue, Yoko; Furuya, Naruto; Araki, Takuya; Ueno, Osamu; Yoshimura, Atsushi

2017-12-01

High water use efficiency is essential to water-saving cropping. Morphological traits that affect photosynthetic water use efficiency are not well known. We examined whether leaf hairiness improves photosynthetic water use efficiency in rice. A chromosome segment introgression line (IL-hairy) of wild Oryza nivara (Acc. IRGC105715) with the genetic background of Oryza sativa cultivar 'IR24' had high leaf pubescence (hair). The leaf hairs developed along small vascular bundles. Linkage analysis in BC 5 F 2 and F 3 populations showed that the trait was governed by a single gene, designated BLANKET LEAF (BKL), on chromosome 6. IL-hairy plants had a warmer leaf surface in sunlight, probably due to increased boundary layer resistance. They had a lower transpiration rate under moderate and high light intensities, resulting in higher photosynthetic water use efficiency. Introgression of BKL on chromosome 6 from O. nivara improved photosynthetic water use efficiency in the genetic background of IR24.

Bacterial mediated amelioration of drought stress in drought tolerant ...

African Journals Online (AJOL)

Bacterial mediated amelioration of drought stress in drought tolerant and susceptible cultivars of rice ( Oryza sativa L.) ... and IR-64 (drought sensitive) cultivars of rice (Oryza sativa L.) under different level of drought stress. ... from 32 Countries:.

Alternate economical starchy substrates for the production of 70% sorbitol

Energy Technology Data Exchange (ETDEWEB)

Upadhyay, C.M. (Sarabhai Research Centre, Baroda (India). Industrial Enzymes Dept.); Nehete, P.N. (Sarabhai Research Centre, Baroda (India). Industrial Fermentation Div.); Shah, D.N. (GSFC Research and Development Centre, Fertilizernagar (India). Biotechnology Dept.); Shah, N.K. (Armour Chemicals Pvt. Ltd., Ankleshwar (India)); Shankar, V. (National Chemical Lab., Pune (India). Biochemistry Div.); Kothari, R.M. (Thapar Corporate Research and Development Centre, Patiala (India). Biotechnology Div.)

1991-03-01

In view of the soaring prices of corn and tapioca starch, use of their hydrolysate in the production of 70% sorbitol became less remunerative. Therefore, an economical alternative is explored by using hydrolysates of cereal flours, namely, rice (Oryzae sativa), wheat (Triticum aestivum), jowar (Sorghum vulgare) and bajra (Pennisetum typhoideum). A protocol is devised to (a) prepare their high DE hydrolysates, (b) purify it after saccharification, (c) monitor the chemical chracteristics of concentrated hydrolysate, as feedstock for Raney nickel catalyzed pressure hydrogenation and (d) finally prepare 70% sorbital. Merits and demerits of hydrolysates of these cereal flours are discussed in terms of operational limitations and percentage recovery, the governing factors for their industrial acceptability. Rice flour hydrolysate appears to be an alternative substrate, operationally and economically. (orig.).

Molecular detection of Xanthomonas oryzae pv. oryzae, Xanthomonas oryzae pv. oryzicola, and Burkholderia glumae in infected rice seeds and leaves

Science.gov (United States)

Polymerase chain reaction (PCR) is particularly useful for plant pathogen detection. In the present study, multiplex PCR and SYBR green real-time PCR were developed to facilitate simultaneous detection of three important rice pathogens, Xanthomonas oryzae pv. oryzae, X. oryzae pv. oryzicola, and Bur...

Response of yield and yield components of rice (Oryza sativa L. cv. Tarom Hashemi in rice, duck and Azolla (Azolla sp. farming

Directory of Open Access Journals (Sweden)

M Gharavi Baigi

2016-05-01

Full Text Available In order to evaluate the yield and yield components of rice (Oryza sativa L. cv. Tarom Hashemi in integrated rice, duck and Azolla, an experiment was conducted at the Research Farm of Sari University of Agricultural Sciences and Natural Resources during 2012. Experiment was arranged in split plot based on a randomized complete block design with three replications. The number of ducks as main plots at four levels (0, 400, 800 and 1200 ducks.ha-1 and Nitrogen source as sub plots at four levels (without Azolla and nitrogen, Azolla, Azolla+nitrogen and nitrogen were the treatments. Analysis of variance showed highly significant differences for the number of ducks, Azolla+nitrogen and their interaction effects of plant height, number of tillers.plant-1, number of panicle.plant-1, number of grains.panicle-1, panicle weight, panicle dry weight and grain yield. The results revealed that the highest values of plant height (133 cm, number of tillers (38 tillers.plant-1, number of panicle (24 numbers.plant-1, number of grains (171 numbers.panicle-1, panicle weight (23 g, panicle dry weight (13 g and grain yield (4 t.ha-1 were recorded in 1200 duck pieces per hectare while treated with Azolla (500 g.m-2 and nitrogen (50 kg.ha-1. In conclusion, results of the current experiment showed that increasing of duck number from 400 to 1200 pieces.ha-1 along with Azolla and nitrogen could enhance the yield and yield components of rice (Tarom Hashemi cultivar.

Potential Application of the Oryza sativa Monodehydroascorbate Reductase Gene (OsMDHAR to Improve the Stress Tolerance and Fermentative Capacity of Saccharomyces cerevisiae.

Directory of Open Access Journals (Sweden)

Il-Sup Kim

Full Text Available Monodehydroascorbate reductase (MDHAR; EC 1.6.5.4 is an important enzyme for ascorbate recycling. To examine whether heterologous expression of MDHAR from Oryza sativa (OsMDHAR can prevent the deleterious effects of unfavorable growth conditions, we constructed a transgenic yeast strain harboring a recombinant plasmid carrying OsMDHAR (p426GPD::OsMDHAR. OsMDHAR-expressing yeast cells displayed enhanced tolerance to hydrogen peroxide by maintaining redox homoeostasis, proteostasis, and the ascorbate (AsA-like pool following the accumulation of antioxidant enzymes and molecules, metabolic enzymes, and molecular chaperones and their cofactors, compared to wild-type (WT cells carrying vector alone. The addition of exogenous AsA or its analogue isoascorbic acid increased the viability of WT and ara2Δ cells under oxidative stress. Furthermore, the survival of OsMDHAR-expressing cells was greater than that of WT cells when cells at mid-log growth phase were exposed to high concentrations of ethanol. High OsMDHAR expression also improved the fermentative capacity of the yeast during glucose-based batch fermentation at a standard cultivation temperature (30°C. The alcohol yield of OsMDHAR-expressing transgenic yeast during fermentation was approximately 25% (0.18 g·g-1 higher than that of WT yeast. Accordingly, OsMDHAR-expressing transgenic yeast showed prolonged survival during the environmental stresses produced during fermentation. These results suggest that heterologous OsMDHAR expression increases tolerance to reactive oxygen species-induced oxidative stress by improving cellular redox homeostasis and improves survival during fermentation, which enhances fermentative capacity.

Effect of emulsifiers on complexation and retrogradation characteristics of native and chemically modified White sorghum (Sorghum bicolor) starch

International Nuclear Information System (INIS)

Ali, Tahira Mohsin; Hasnain, Abid

2013-01-01

Highlights: ► Sorghum starches were chemically modified. ► Starch–lipid complexes were studied in the presence of emulsifiers. ► Type II complexes were also detected in native and oxidized starches on adding GMS. ► Starch–lipid complexes sharply reduced retrogradation in modified starches. - Abstract: The effect of emulsifiers on complexation and retrogradation characteristics of native and chemically modified white sorghum starches was studied. Complex forming tendency of white sorghum starch with commercially available emulsifiers GMS and DATEM improved after acetylation. Presence of emulsifiers reduced λ max (wavelength of maximum absorbance) both for native and modified sorghum starches suggesting lower availability of amylose chains to complex with iodine. In native white sorghum starch (NWSS) and oxidized white sorghum starch (OWSS), both Type I and Type II starch–lipid complexes were observed on addition of 1.0% GMS prior to gelatinization. Acetylated-oxidized white sorghum starch (AOWSS) formed weakest complexes among all the modified starches. The results revealed that antistaling characteristics of modified sorghum starches were enhanced when used in combination with emulsifiers. The most prominent decline in reassociative capability among modified starches was observed for acetylated starches.

Rice black streaked dwarf virus P7-2 forms a SCF complex through binding to Oryza sativa SKP1-like proteins, and interacts with GID2 involved in the gibberellin pathway.

Science.gov (United States)

Tao, Tao; Zhou, Cui-Ji; Wang, Qian; Chen, Xiang-Ru; Sun, Qian; Zhao, Tian-Yu; Ye, Jian-Chun; Wang, Ying; Zhang, Zong-Ying; Zhang, Yong-Liang; Guo, Ze-Jian; Wang, Xian-Bing; Li, Da-Wei; Yu, Jia-Lin; Han, Cheng-Gui

2017-01-01

As a core subunit of the SCF complex that promotes protein degradation through the 26S proteasome, S-phase kinase-associated protein 1 (SKP1) plays important roles in multiple cellular processes in eukaryotes, including gibberellin (GA), jasmonate, ethylene, auxin and light responses. P7-2 encoded by Rice black streaked dwarf virus (RBSDV), a devastating viral pathogen that causes severe symptoms in infected plants, interacts with SKP1 from different plants. However, whether RBSDV P7-2 forms a SCF complex and targets host proteins is poorly understood. In this study, we conducted yeast two-hybrid assays to further explore the interactions between P7-2 and 25 type I Oryza sativa SKP1-like (OSK) proteins, and found that P7-2 interacted with eight OSK members with different binding affinity. Co-immunoprecipitation assay further confirmed the interaction of P7-2 with OSK1, OSK5 and OSK20. It was also shown that P7-2, together with OSK1 and O. sativa Cullin-1, was able to form the SCF complex. Moreover, yeast two-hybrid assays revealed that P7-2 interacted with gibberellin insensitive dwarf2 (GID2) from rice and maize plants, which is essential for regulating the GA signaling pathway. It was further demonstrated that the N-terminal region of P7-2 was necessary for the interaction with GID2. Overall, these results indicated that P7-2 functioned as a component of the SCF complex in rice, and interaction of P7-2 with GID2 implied possible roles of the GA signaling pathway during RBSDV infection.

Rice black streaked dwarf virus P7-2 forms a SCF complex through binding to Oryza sativa SKP1-like proteins, and interacts with GID2 involved in the gibberellin pathway.

Directory of Open Access Journals (Sweden)

Tao Tao

Full Text Available As a core subunit of the SCF complex that promotes protein degradation through the 26S proteasome, S-phase kinase-associated protein 1 (SKP1 plays important roles in multiple cellular processes in eukaryotes, including gibberellin (GA, jasmonate, ethylene, auxin and light responses. P7-2 encoded by Rice black streaked dwarf virus (RBSDV, a devastating viral pathogen that causes severe symptoms in infected plants, interacts with SKP1 from different plants. However, whether RBSDV P7-2 forms a SCF complex and targets host proteins is poorly understood. In this study, we conducted yeast two-hybrid assays to further explore the interactions between P7-2 and 25 type I Oryza sativa SKP1-like (OSK proteins, and found that P7-2 interacted with eight OSK members with different binding affinity. Co-immunoprecipitation assay further confirmed the interaction of P7-2 with OSK1, OSK5 and OSK20. It was also shown that P7-2, together with OSK1 and O. sativa Cullin-1, was able to form the SCF complex. Moreover, yeast two-hybrid assays revealed that P7-2 interacted with gibberellin insensitive dwarf2 (GID2 from rice and maize plants, which is essential for regulating the GA signaling pathway. It was further demonstrated that the N-terminal region of P7-2 was necessary for the interaction with GID2. Overall, these results indicated that P7-2 functioned as a component of the SCF complex in rice, and interaction of P7-2 with GID2 implied possible roles of the GA signaling pathway during RBSDV infection.

Review of Sorghum Production Practices: Applications for Bioenergy

Energy Technology Data Exchange (ETDEWEB)

Turhollow Jr, Anthony F [ORNL; Webb, Erin [ORNL; Downing, Mark [ORNL

2010-06-01

Sorghum has great potential as an annual energy crop. While primarily grown for its grain, sorghum can also be grown for animal feed and sugar. Sorghum is morphologically diverse, with grain sorghum being of relatively short stature and grown for grain, while forage and sweet sorghums are tall and grown primarily for their biomass. Under water-limited conditions sorghum is reliably more productive than corn. While a relatively minor crop in the United States (about 2% of planted cropland), sorghum is important in Africa and parts of Asia. While sorghum is a relatively efficient user of water, it biomass potential is limited by available moisture. The following exhaustive literature review of sorghum production practices was developed by researchers at Oak Ridge National Laboratory to document the current state of knowledge regarding sorghum production and, based on this, suggest areas of research needed to develop sorghum as a commercial bioenergy feedstock. This work began as part of the China Biofuels Project sponsored by the DOE Energy Efficiency and Renewable Energy Program to communicate technical information regarding bioenergy feedstocks to government and industry partners in China, but will be utilized in a variety of programs in which evaluation of sorghum for bioenergy is needed. This report can also be used as a basis for data (yield, water use, etc.) for US and international bioenergy feedstock supply modeling efforts.

Radioinduced variation in genetic improvement of sorghum (Sorghum bicolor (l.). Moench)

International Nuclear Information System (INIS)

Gutierrez del Rio, E.

1984-01-01

A genetic variability study among 25 varieties of sorghum (Sorghum bicolor (L.) Moench) is presented. The populations are irradiated with 0, 10, 20, 30, 40, 50 and 60 Krads of cobalt 60 as far as M 5 generation. An individual selection is done taking into consideration agronomic characteristics like precocity, type, size. height of the plant. (M.A.C.) [pt

Physiological basis of genetic variation in leaf photosynthesis among rice (Oryza sativa L.) introgression lines under drought and well-watered conditions

Science.gov (United States)

Yin, Xinyou

2012-01-01

To understand the physiological basis of genetic variation and resulting quantitative trait loci (QTLs) for photosynthesis in a rice (Oryza sativa L.) introgression line population, 13 lines were studied under drought and well-watered conditions, at flowering and grain filling. Simultaneous gas exchange and chlorophyll fluorescence measurements were conducted at various levels of incident irradiance and ambient CO2 to estimate parameters of a model that dissects photosynthesis into stomatal conductance (g s), mesophyll conductance (g m), electron transport capacity (J max), and Rubisco carboxylation capacity (V cmax). Significant genetic variation in these parameters was found, although drought and leaf age accounted for larger proportions of the total variation. Genetic variation in light-saturated photosynthesis and transpiration efficiency (TE) were mainly associated with variation in g s and g m. One previously mapped major QTL of photosynthesis was associated with variation in g s and g m, but also in J max and V cmax at flowering. Thus, g s and g m, which were demonstrated in the literature to be responsible for environmental variation in photosynthesis, were found also to be associated with genetic variation in photosynthesis. Furthermore, relationships between these parameters and leaf nitrogen or dry matter per unit area, which were previously found across environmental treatments, were shown to be valid for variation across genotypes. Finally, the extent to which photosynthesis rate and TE can be improved was evaluated. Virtual ideotypes were estimated to have 17.0% higher photosynthesis and 25.1% higher TE compared with the best genotype investigated. This analysis using introgression lines highlights possibilities of improving both photosynthesis and TE within the same genetic background. PMID:22888131

Molecular evolution of the endosperm starch synthesis pathway genes in rice (Oryza sativa L.) and its wild ancestor, O. rufipogon L.

Science.gov (United States)

Yu, Guoqin; Olsen, Kenneth M; Schaal, Barbara A

2011-01-01

The evolution of metabolic pathways is a fundamental but poorly understood aspect of evolutionary change. One approach for understanding the complexity of pathway evolution is to examine the molecular evolution of genes that together comprise an integrated metabolic pathway. The rice endosperm starch biosynthetic pathway is one of the most thoroughly characterized metabolic pathways in plants, and starch is a trait that has evolved in response to strong selection during rice domestication. In this study, we have examined six key genes (AGPL2, AGPS2b, SSIIa, SBEIIb, GBSSI, ISA1) in the rice endosperm starch biosynthesis pathway to investigate the evolution of these genes before and after rice domestication. Genome-wide sequence tagged sites data were used as a neutral reference to overcome the problems of detecting selection in species with complex demographic histories such as rice. Five variety groups of Oryza sativa (aus, indica, tropical japonica, temperate japonica, aromatic) and its wild ancestor (O. rufipogon) were sampled. Our results showed evidence of purifying selection at AGPL2 in O. rufipogon and strong evidence of positive selection at GBSSI in temperate japonica and tropical japonica varieties and at GBSSI and SBEIIb in aromatic varieties. All the other genes showed a pattern consistent with neutral evolution in both cultivated rice and its wild ancestor. These results indicate the important role of positive selection in the evolution of starch genes during rice domestication. We discuss the role of SBEIIb and GBSSI in the evolution of starch quality during rice domestication and the power and limitation of detecting selection using genome-wide data as a neutral reference.

Development of a quantitative pachytene chromosome map and its unification with somatic chromosome and linkage maps of rice (Oryza sativa L.).

Science.gov (United States)

Ohmido, Nobuko; Iwata, Aiko; Kato, Seiji; Wako, Toshiyuki; Fukui, Kiichi

2018-01-01

A quantitative pachytene chromosome map of rice (Oryza sativa L.) was developed using imaging methods. The map depicts not only distribution patterns of chromomeres specific to pachytene chromosomes, but also the higher order information of chromosomal structures, such as heterochromatin (condensed regions), euchromatin (decondensed regions), the primary constrictions (centromeres), and the secondary constriction (nucleolar organizing regions, NOR). These features were image analyzed and quantitatively mapped onto the map by Chromosome Image Analyzing System ver. 4.0 (CHIAS IV). Correlation between H3K9me2, an epigenetic marker and formation and/or maintenance of heterochromatin, thus was, clearly visualized. Then the pachytene chromosome map was unified with the existing somatic chromosome and linkage maps by physically mapping common DNA markers among them, such as a rice A genome specific tandem repeat sequence (TrsA), 5S and 45S ribosomal RNA genes, five bacterial artificial chromosome (BAC) clones, four P1 bacteriophage artificial chromosome (PAC) clones using multicolor fluorescence in situ hybridization (FISH). Detailed comparison between the locations of the DNA probes on the pachytene chromosomes using multicolor FISH, and the linkage map enabled determination of the chromosome number and short/long arms of individual pachytene chromosomes using the chromosome number and arm assignment designated for the linkage map. As a result, the quantitative pachytene chromosome map was unified with two other major rice chromosome maps representing somatic prometaphase chromosomes and genetic linkages. In conclusion, the unification of the three rice maps serves as an indispensable basic information, not only for an in-depth comparison between genetic and chromosomal data, but also for practical breeding programs.

Effect of Harvesting Stage on Sweet Sorghum (Sorghum bicolor L. Genotypes in Western Kenya

Directory of Open Access Journals (Sweden)

Moses Owuor Oyier

2017-01-01

Full Text Available Harvesting stage of sweet sorghum (Sorghum bicolor L. Moench cane is an important aspect in the content of sugar for production of industrial alcohol. Four sweet sorghum genotypes were evaluated for harvesting stage in a randomized complete block design. In order to determine sorghum harvest growth stage for bioethanol production, sorghum canes were harvested at intervals of seven days after anthesis. The genotypes were evaluated at different stages of development for maximum production of bioethanol from flowering to physiological maturity. The canes were crushed and juice fermented to produce ethanol. Measurements of chlorophyll were taken at various stages as well as panicles from the harvested canes. Dried kernels at 14% moisture content were also weighed at various stages. Chlorophyll, grain weight, absolute ethanol volume, juice volume, cane yield, and brix showed significant (p=0.05 differences for genotypes as well as the stages of harvesting. Results from this study showed that harvesting sweet sorghum at stages IV and V (104 to 117 days after planting would be appropriate for production of kernels and ethanol. EUSS10 has the highest ethanol potential (1062.78 l ha−1 due to excellent juice volume (22976.9 l ha−1 and EUSS11 (985.26 l ha−1 due to its high brix (16.21.

Glucuronoarabinoxylans from sorghum grain

NARCIS (Netherlands)

Verbruggen, M.A.

1996-01-01

Water-unextractable cell wall materials (WUS) were prepared from raw, polished, and malted sorghum ( Sorghum vulgare cv. Fara Fara). Except for the amounts, hardly any difference could be observed between the WUS of these three raw materials. This means that cell wall

Comparison of brown midrib-6 and -18 forage sorghum with conventional sorghum and corn silage in diets of lactating dairy cows.

Science.gov (United States)

Oliver, A L; Grant, R J; Pedersen, J F; O'Rear, J

2004-03-01

Total mixed rations containing conventional forage sorghum, brown midrib (bmr)-6 forage sorghum, bmr-18 forage sorghum, or corn silage were fed to Holstein dairy cows to determine the effect on lactation, ruminal fermentation, and total tract nutrient digestion. Sixteen multiparous cows (4 ruminally fistulated; 124 d in milk) were assigned to 1 of 4 diets in a replicated Latin square design with 4-wk periods (21-d adaptation and 7 d of collection). Diets consisted of 40% test silage, 10% alfalfa silage, and 50% concentrate mix (dry basis). Acid detergent lignin concentration was reduced by 21 and 13%, respectively, for the bmr-6 and bmr-18 sorghum silages when compared with the conventional sorghum. Dry matter intake was not affected by diet. Production of 4% fat-corrected milk was greatest for cows fed bmr-6 (33.7 kg/d) and corn silage (33.3 kg/d), was least for cows fed the conventional sorghum (29.1 kg/d), and was intermediate for cows fed the bmr-18 sorghum (31.2 kg/d), which did not differ from any other diet. Total tract neutral detergent fiber (NDF) digestibility was greatest for the bmr-6 sorghum (54.4%) and corn silage (54.1%) diets and was lower for the conventional (40.8%) and bmr-18 sorghum (47.9%) diets. In situ extent of NDF digestion was greatest for the bmr-6 sorghum (76.4%) and corn silage (79.0%) diets, least for the conventional sorghum diet (70.4%), and intermediate for the bmr-18 sorghum silage diet (73.1%), which was not different from the other diets. Results of this study indicate that the bmr-6 sorghum hybrid outperformed the conventional sorghum hybrid; the bmr-18 sorghum was intermediate between conventional and bmr-6 in most cases. Additionally, the bmr-6 hybrid resulted in lactational performance equivalent to the corn hybrid used in this study. There are important compositional differences among bmr forage sorghum hybrids that need to be characterized to predict animal response accurately.

Transgenerational inheritance of modified DNA methylation patterns and enhanced tolerance induced by heavy metal stress in rice (Oryza sativa L.).

Science.gov (United States)

Ou, Xiufang; Zhang, Yunhong; Xu, Chunming; Lin, Xiuyun; Zang, Qi; Zhuang, Tingting; Jiang, Lili; von Wettstein, Diter; Liu, Bao

2012-01-01

DNA methylation is sensitive and responsive to stressful environmental conditions. Nonetheless, the extent to which condition-induced somatic methylation modifications can impose transgenerational effects remains to be fully understood. Even less is known about the biological relevance of the induced epigenetic changes for potentially altered well-being of the organismal progenies regarding adaptation to the specific condition their progenitors experienced. We analyzed DNA methylation pattern by gel-blotting at genomic loci representing transposable elements and protein-coding genes in leaf-tissue of heavy metal-treated rice (Oryza sativa) plants (S0), and its three successive organismal generations. We assessed expression of putative genes involved in establishing and/or maintaining DNA methylation patterns by reverse transcription (RT)-PCR. We measured growth of the stressed plants and their unstressed progenies vs. the control plants. We found (1) relative to control, DNA methylation patterns were modified in leaf-tissue of the immediately treated plants, and the modifications were exclusively confined to CHG hypomethylation; (2) the CHG-demethylated states were heritable via both maternal and paternal germline, albeit often accompanying further hypomethylation; (3) altered expression of genes encoding for DNA methyltransferases, DNA glycosylase and SWI/SNF chromatin remodeling factor (DDM1) were induced by the stress; (4) progenies of the stressed plants exhibited enhanced tolerance to the same stress their progenitor experienced, and this transgenerational inheritance of the effect of condition accompanying heritability of modified methylation patterns. Our findings suggest that stressful environmental condition can produce transgenerational epigenetic modifications. Progenies of stressed plants may develop enhanced adaptability to the condition, and this acquired trait is inheritable and accord with transmission of the epigenetic modifications. We suggest

Application of glycine reduces arsenic accumulation and toxicity in Oryza sativa L. by reducing the expression of silicon transporter genes.

Science.gov (United States)

Kumar Dubey, Arvind; Kumar, Navin; Ranjan, Ruma; Gautam, Ambedkar; Pande, Veena; Sanyal, Indraneel; Mallick, Shekhar

2018-02-01

The present study was intended to investigate the role of amino acid glycine in detoxification of As in Oryza sativa L. The growth parameters such as, shoot length and fresh weight were decreased during As(III) and As(V) toxicity. However, the application of glycine recovered the growth parameters against As stress. The application of glycine reduced the As accumulation in all the treatments, and it was more effective against As(III) treatment and reduced the accumulation by 68% in root and 71% in shoot. Similarly, the translocation of As from root to shoot, was higher against As(III) and As(V) treatments, whereas, reduced upon glycine application. The translocation of Fe and Na was also affected by As, which was lower under As(III) and As(V) treatments. However, the application of glycine significantly enhanced the translocation of Fe and Na in the shoot. Besides, the expression of lower silicon transporters i.e. Lsi-1 and Lsi-2 was observed to be significantly suppressed in the root with the application of glycine against As treatment. Similarly, the expression of three GRX and two GST gene isoforms were found to be significantly increased with glycine application. Simultaneously, the activities of antioxidant enzymes i.e. l-arginine dependent NOS, SOD, NTR and GRX were found to be significantly enhanced in the presence of glycine. Increased activities of antioxidant enzymes coincided with the decreased level of TBARS and H 2 O 2 in rice seedlings. Overall, the results suggested that the application of glycine reduces As accumulation through suppressing the gene expression of lower silicon transporters and ameliorates As toxicity by enhancing antioxidants defense mechanism in rice seedlings. Copyright © 2017 Elsevier Inc. All rights reserved.

Physical and Mechanical Properties of Sorghum Grains (Sorghum Vulgare

Directory of Open Access Journals (Sweden)

2016-11-01

Full Text Available The physical and mechanical properties of sorghum grains (sorghum vulgare were studied at varying moisture contents of 13%, 20% and 30% (w.b. The four varieties of sorghum grains studied include; Dura, Guinea, Faterita and Kafir. Results indicate that the size ranges were 3.94mm - 4.83mm for Dura variety; 3.75mm - 4.54mm for Guinea variety; 3.21mm - 4.42mm for Kafir variety and 2.70mm - 4.14mm for Faterita variety. Irregularities in the shapes of the grains were observed but all approximated to a sphere. In the mechanical properties, at major diameter, Dura variety had highest rupture force of 1.16kN at 13% moisture content (w.b while the Guinea variety had the lowest rupture force of 0.955kN. In minor diameter, the Dura variety also recorded highest rupture force of 1.12kN at 13% moisture content (w.b while the Kafir variety had the lowest value of 0.952kN. Also at 20% moisture content, the Dura variety had highest rupture force of 1.025kN while the Guinea variety had the lowest rupture force of 0.965kN. The same trend applies in the varieties at 30% moisture content. This is because, increase in moisture content results to decrease in rupture force. And this implies that force beyond these points at these moisture contents may cause damage to the sorghum varieties.

Field damage of sorghum (Sorghum bicolor) with reduced lignin levels by naturally occurring insect pests and pathogens

Science.gov (United States)

Mutant lines of sorghum with low levels of lignin are potentially useful for bioenergy production, but may have problems with insects or disease. Field grown normal and low lignin bmr6 and bmr12 sorghum (Sorghum bicolor) were examined for insect and disease damage in the field, and insect damage in ...

(Arachis hypogaea) and Sorghum (Sorghum bicolor)

African Journals Online (AJOL)

ADOWIE PERE

as enzyme activities of Arachis hypogaea and Sorghum bicolor in crude oil contaminated soil. Crude oil ... Treatments without crude oil were ... replicates were made for each treatment. .... dead sections of leaf margins, burning and stunted or.

Fermentation characteristics of different purpose sorghum silage

Directory of Open Access Journals (Sweden)

Arthur Behling Neto

2017-08-01

Full Text Available Sorghum stands out among other plants recommended for ensiling due to its forage composition, its resistance to drought, and its planting range. New cultivars of grain and sweet sorghum that can be used for silage production are available, but there is little information regarding their ensiling characteristics. The aim of this study was to evaluate the fermentation characteristics at the ensiling of different purpose sorghum cultivars, at two crop periods. The trial was carried out at the Plant Production Department of the Federal Institute of Education, Science and Technology of Rondônia, Colorado do Oeste campus, Rondônia, Brazil, and chemical analyses were performed at the Laboratory of Animal Nutrition, at the Federal University of Mato Grosso, Cuiabá campus, Mato Grosso, Brazil. The experimental design used was a randomized block, in split-plot design, with four replicates. The plot treatments consisted of six sorghum cultivars grown for different purposes (grain sorghum: BRS 308 and BRS 310; forage sorghum: BR 655 and BRS 610; sweet sorghum: BRS 506 and CMSXS 647. Split-plot treatments consisted of two cropping seasons (first crop and second crop. The grain sorghum cultivar BRS 310 was the only one that had suitable dry matter content for ensiling; however, it was also the only one that did not show ideal water soluble carbohydrate content for ensiling. Nevertheless, all treatments presented pH below than 4.2 and ammonia nitrogen lower than 12% of total N, which indicates that the fermentation inside the silo had proceeded well. For sweet sorghum cultivars, higher ethanol and butyric acid content were observed for the first crop than for the second crop. All evaluated sorghum cultivars can be used for silage production, but the use of sweet sorghum is recommended at the second crop.

Nutritional value of sorghum silage of different purposes

Directory of Open Access Journals (Sweden)

Arthur Behling Neto

Full Text Available ABSTRACT Sorghum is a crop that stands out as an alternative to corn due to lower soil fertility demand and increased tolerance to drought. Lack of information about the qualitative behaviour of sorghum hinders the recommendation of different purpose sorghum cultivars. The goal was to evaluate the chemical composition and in vitro digestibility of different purpose sorghum cultivar silages, at two cropping seasons. The trial was conducted at the Plant Production Department, Federal Institute of Education, Science and Technology of Rondônia, Colorado do Oeste campus, and chemical analyses and in vitro incubation were performed at the Laboratory of Animal Nutrition, Federal University of Mato Grosso, Cuiabá campus. The experimental design was a randomized block with a split-plot arrangement and four replications. Plot treatments consisted of six different purpose sorghum cultivars (BRS 308 and BRS 310, grain sorghum; BR 655 and BRS 610, forage sorghum; and BRS 506 and CMSXS 647, sweet sorghum. Split-plot treatments consisted of two cropping periods (first crop and second crop. Forage sorghum cultivar BRS 655 demonstrated higher non-fiber carbohydrate content and lower potentially digestible fibre content than the other cultivars did. Sweet sorghum cultivars had higher levels of water soluble carbohydrates and non-protein nitrogen based on protein, lower indigestible neutral detergent fibre content at second crop, and higher in vitro dry matter digestibility than the other cultivars. The silages of sweet sorghum cultivars BRS 506 and CMSXS 647, and forage sorghum cultivar BRS 655 presented higher nutritional values.

OryzaGenome: Genome Diversity Database of Wild Oryza Species

KAUST Repository

Ohyanagi, Hajime

2015-11-18

The species in the genus Oryza, encompassing nine genome types and 23 species, are a rich genetic resource and may have applications in deeper genomic analyses aiming to understand the evolution of plant genomes. With the advancement of next-generation sequencing (NGS) technology, a flood of Oryza species reference genomes and genomic variation information has become available in recent years. This genomic information, combined with the comprehensive phenotypic information that we are accumulating in our Oryzabase, can serve as an excellent genotype-phenotype association resource for analyzing rice functional and structural evolution, and the associated diversity of the Oryza genus. Here we integrate our previous and future phenotypic/habitat information and newly determined genotype information into a united repository, named OryzaGenome, providing the variant information with hyperlinks to Oryzabase. The current version of OryzaGenome includes genotype information of 446 O. rufipogon accessions derived by imputation and of 17 accessions derived by imputation-free deep sequencing. Two variant viewers are implemented: SNP Viewer as a conventional genome browser interface and Variant Table as a textbased browser for precise inspection of each variant one by one. Portable VCF (variant call format) file or tabdelimited file download is also available. Following these SNP (single nucleotide polymorphism) data, reference pseudomolecules/ scaffolds/contigs and genome-wide variation information for almost all of the closely and distantly related wild Oryza species from the NIG Wild Rice Collection will be available in future releases. All of the resources can be accessed through http://viewer.shigen.info/oryzagenome/.

Effect of age of a sorghum-sudangrass hybrid on its allelopathic action Efeito da idade de um híbrido de sorgo com capim-sudão em sua ação alelopática

Directory of Open Access Journals (Sweden)

G. Marchi

2008-01-01

Full Text Available Hybrids of Sorghum sudanensis (sudangrass and Sorghum bicolor genotypes can produce high amounts of biomass, sorgoleone (a long chain hydroquinone, and other phytotoxic substances. Shoots and roots of a sorghum-sudangrass hybrid (cv. Trudan 8 were collected 10, 20, 30, 40, and 50 days after emergence. Four concentrations of aqueous extracts from the shoots and roots (0, 0.4, 2, and 10 g L-1, w/v were used to treat seeds of lettuce (Lactuca sativa, tomato (Lycopersicum sculentum, purslane (Portulaca oleracea, and pigweed (Amaranthus retroflexus. Seed germination of lettuce, tomato, and pigweed was inhibited by extracts from sorghum-sudangrass shoots at 10 g L-1 when made from sorghum-sudangrass plants 20 days or less in age. Seed germination of purslane was not inhibited by any sorghum-sudangrass extract. Growth of the four species evaluated were systematically inhibited when treated with 10 g L-1 extracts from sorghum-sudangrass shoots harvested up to 10 days after emergence.Os capins híbridos obtidos pelo cruzamento entre Sorghum sudanensis (capim-sudão e genótipos de Sorghum bicolor possuem alto potencial para produção de biomassa e para controle de plantas daninhas pela produção de substâncias fitotóxicas, como o sorgoleone (uma hidroquinona de cadeia longa. Sementes de alface (Lactuca sativa, tomate (Lycopersicum sculentum, beldroega (Portulaca oleracea e caruru (Amaranthus retroflexus foram submetidas a tratamentos com extratos aquosos da parte aérea e das raízes do híbrido de sorgo com capim-sudão, cv. Trudan 8, colhido em cinco diferentes estádios de crescimento (10, 20, 30, 40 e 50 dias após a emergência. Os extratos foram preparados em quatro concentrações (0, 0,4, 2 e 10 g L-1, p/v e aplicados em quatro repetições. Após os tratamentos, a germinação e o comprimento de plântulas das espécies foram avaliados. A germinação de sementes de tomate, caruru e alface foi inibida pelos extratos da parte aérea das

Magnesium-induced alterations in the photosynthetic performance and resistance of rice plants infected with Bipolaris oryzae

Directory of Open Access Journals (Sweden)

Wiler Ribas Moreira

2015-08-01

Full Text Available Brown spot (BS, caused by the fungus Bipolaris oryzae, is one of the most important diseases contracted by rice. We investigated the effect of magnesium (Mg on the development of BS, caused by Bipolaris oryzae, and the effects of disease development on the photosynthetic performance of rice (Oryza sativa L. plants (cv. Metica-1 grown in nutrient solutions containing 0.25 or 4.0 mM of Mg. Assessments of BS severity, leaf Mg and pigment concentrations (total chlorophylls and carotenoids, were carried out at 120 h after inoculation, in addition to gas exchange parameters,. Higher leaf concentration of Mg was observed in plants supplied with 4.0 mM Mg than in those supplied with 0.25 mM. The increase in leaf Mg was accompanied by a decrease in BS severity, higher concentration of total chlorophyll and better photosynthetic performance. Plants supplied with 4.0 mM Mg had higher average values for carbon assimilation, stomatal conductance and internal leaf CO2 concentration when compared with plants supplied with 0.25 mM Mg. Conversely, the concentration of carotenoids was lower in plants supplied with the higher Mg rate. These results suggest that Mg suppresses disease severity and preserves photosynthetic performance by allowing for better stomatal conductance and, consequently, greater availability of CO2 at the carboxylation sites.

Development of Perennial Grain Sorghum

Directory of Open Access Journals (Sweden)

Stan Cox

2018-01-01

Full Text Available Perennial germplasm derived from crosses between Sorghum bicolor and either S. halepense or S. propinquum is being developed with the goal of preventing and reversing soil degradation in the world’s grain sorghum-growing regions. Perennial grain sorghum plants produce subterranean stems known as rhizomes that sprout to form the next season’s crop. In Kansas, breeding perennial sorghum involves crossing S. bicolor cultivars or breeding lines to S. halepense or perennial S. bicolorn × S. halepense breeding lines, selecting perennial plants from F2 or subsequent populations, crossing those plants with S. bicolor, and repeating the cycle. A retrospective field trial in Kansas showed that selection and backcrossing during 2002–2009 had improved grain yields and seed weights of breeding lines. Second-season grain yields of sorghum lines regrowing from rhizomes were similar to yields in the first season. Further selection cycles have been completed since 2009. Many rhizomatous lines that cannot survive winters in Kansas are perennial at subtropical or tropical locations in North America and Africa. Grain yield in Kansas was not correlated with rhizomatousness in either Kansas or Uganda. Genomic regions affecting rhizome growth and development have been mapped, providing new breeding tools. The S. halepense gene pool may harbor many alleles useful for improving sorghum for a broad range of traits in addition to perenniality.

CatB is Critical for Total Catalase Activity and Reduces Bactericidal Effects of Phenazine-1-Carboxylic Acid on Xanthomonas oryzae pv. oryzae and X. oryzae pv. oryzicola.

Science.gov (United States)

Pan, Xiayan; Wu, Jian; Xu, Shu; Duan, Yabing; Zhou, Mingguo

2017-02-01

Rice bacterial leaf blight, caused by Xanthomonas oryzae pv. oryzae, and rice bacterial leaf streak, caused by X. oryzae pv. oryzicola, are major diseases of rice. Phenazine-1-carboxylic acid (PCA) is a natural product that is isolated from Pseudomonas spp. and is used to control many important rice diseases in China. We previously reported that PCA disturbs the redox balance, which results in the accumulation of reactive oxygen species in X. oryzae pv. oryzae. In this study, we found that PCA significantly upregulated the transcript levels of catB and katE, which encode catalases, and that PCA sensitivity was reduced when X. oryzae pvs. oryzae and oryzicola were cultured with exogenous catalase. Furthermore, catB deletion mutants of X. oryzae pvs. oryzae and oryzicola showed dramatically decreased total catalase activity, increased sensitivity to PCA, and reduced virulence in rice. In contrast, deletion mutants of srpA and katG, which also encode catalases, exhibited little change in PCA sensitivity. The results indicate that catB in both X. oryzae pvs. oryzae and oryzicola encodes a catalase that helps protect the bacteria against PCA-induced stress.

Plant uptake of MBOCA (4,4'-methylene-bis (2-chloroaniline)). [Brassica oleracea L. ; Phaseolus vulgaris L. ; Beta vulgaris L. ; Sorghum vulgare Pers. ; Dactylis glomerata L. ; Daucus carrota L

Energy Technology Data Exchange (ETDEWEB)

Voorman, R; Penner, D

1986-09-01

(/sup 14/C)-MBOCA was absorbed by cabbage (Brassica oleracea L.), bean (Phaseolus vulgaris L.), and sugar beet (Beta vulgaris L.) leaves, but did not move beyond the absorption point. Radio autographs of bean, sorghum (Sorghum vulgare Pers.), orchard grass (Dactylis glomerata L.) and carrot (Daucus carrota L.) plants exposed to (/sup 14/C)-MBOCA via hydroponic culture showed considerable radioactivity associated with the roots with only limited translocation of (/sup 14/C) into upper plant parts. Bean and cucumber (Cucumis sativa L.) plants grown in (/sup 14/C)-MBOCA amended soil translocated virtually no (/sup 14/C) into aerial parts, but again considerable radioactivity was found on roots. Radioactivity could not be rinsed off roots with water or acetone, and a small amount of radioactivity was observed in the xylem-phloem layer of the carrot root.

Journal of Genetics | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Journal of Genetics; Volume 93; Issue 1. Genomewide survey and characterization of metacaspase gene family in rice (Oryza sativa). Likai Wang Hua Zhang. Research Article Volume 93 Issue 1 April ... Keywords. metacaspases; OsMC gene family; expression profiles; domestication; rice; Oryza sativa.

Interactions of rice (Oryza sativa L.) and PAH-degrading bacteria (Acinetobacter sp.) on enhanced dissipation of spiked phenanthrene and pyrene in waterlogged soil.

Science.gov (United States)

Gao, Y; Yu, X Z; Wu, S C; Cheung, K C; Tam, N F Y; Qian, P Y; Wong, M H

2006-12-15

The effects of cultivation of rice (Oryza sativa L.) and PAH-degrading bacteria (Acinetobacter sp.) separately, and in combination, on the dissipation of spiked phenanthrene and pyrene (0, 50+50, 100+100, 200+200 mg kg(-1)) in waterlogged soil were studied using pot trials. The population of introduced PAH-degrading bacteria remained at 10(5) CFU g(-1) dry soil after 20 days of treatment with Acinetobacter sp. only, but increased to 10(6) when planted with rice simultaneously. Shoot and root biomass of rice when grown alone was adversely affected by spiked PAHs, but significantly increased by 2-55% and 8-409%, respectively, when inoculated with Acinetobacter sp.. Phenanthrene and pyrene concentrations in roots ranged from 1-27 and 20-98 mg kg(-1), respectively, while their concentrations in shoots were generally lower than 0.2 mg kg(-1). The dissipation of phenanthrene was mainly due to abiotic loss as 70-78% phenanthrene was lost from the control soil at the end of 80 days, while removal of 86-87% phenanthrene had been achieved after 40 days in the treatment co-cultivated with Acinetobacter sp. and rice. Compared with the control where only 6-15% of pyrene was removed from soil, a much higher dissipation of pyrene (43-62%) was attained for the treatments co-cultivated with Acinetobacter sp. and rice at the end of 80 days. The results demonstrated that co-cultivation of rice and PAH-degrading bacteria may have a great potential to accelerate the bioremediation process of PAH-contaminated soil under waterlogged conditions.

Breeding for blast-disease-resistant and high-yield Thai jasmine rice (Oryza sativa L. cv. KDML 105) mutants using low-energy ion beams

International Nuclear Information System (INIS)

Mahadtanapuk, S.; Teraarusiri, W.; Phanchaisri, B.; Yu, L.D.; Anuntalabhochai, S.

2013-01-01

Highlights: •N-ion beam bombarded Thai jasmine rice seeds to induce mutation. •Mutants with blast-disease resistance and high yield were screened. •Gene involved in the blast-disease resistance was analyzed. •The gene responsible for the resistance was linked to Spotted leaf protein 11. -- Abstract: Low-energy ion beam was applied on mutation induction for plant breeding of blast-disease-resistant Thai jasmine rice (Oryza sativa L. cv. KDML 105). Seeds of the wild-type rice were bombarded in vacuum by nitrogen ion beam at energy of 60–80 keV to a beam fluence range of 2 × 10 16 –2 × 10 17 ions/cm 2 . The ion-bombarded rice seeds were grown in soil for 2 weeks as transplanted rice in plastic pots at 1 seedling/pot. The seedlings were then screened for blast resistance by Pyricularia grisea inoculation with 10 6 spores/ml concentrations. The blast-resistant rice mutant was planted up to F6 generation with the consistent phenotypic variation. The high percentage of the blast-disease-resistant rice was analyzed with DNA fingerprint. The HAT-RAPD (high annealing temperature-random amplified polymorphic DNA) marker revealed the modified polymorphism fragment presenting in the mutant compared with wild type (KDML 105). The cDNA fingerprints were investigated and the polymorphism fragment was subcloned into pGEM-T easy vector and then sequenced. The sequence of this fragment was compared with those already contained in the database, and the fragment was found to be related to the Spotted leaf protein 11 (Spl11)

Grain Yield, Dry Weight and Phosphorus Accumulation and Translocation in Two Rice (Oryza sativa L. Varieties as Affected by Salt-Alkali and Phosphorus

Directory of Open Access Journals (Sweden)

Zhijie Tian

2017-08-01

Full Text Available Salt-alkali is the main threat to global crop production. The functioning of phosphorus (P in alleviating damage to crops from saline-alkaline stress may be dependent on the variety of crop but there is little published research on the topic. This pot experiment was conducted to study if P has any effect on rice (Oryza sativa L. yield, dry matter and P accumulation and translocation in salt-alkaline soils. Plant dry weight and P content at heading and harvest stages of two contrasting saline-alkaline tolerant (Dongdao-4 and sensitive (Tongyu-315 rice varieties were examined under two saline-alkaline (light versus severe soils and five P supplements (P0, P50, P100, P150 and P200 kg ha−1. The results were: in light saline-alkaline soil, the optimal P levels were found for P150 for Dongdao-4 and for P100 for Tongyu-315 with the greatest grain dry weight and P content. Two rice varieties obtained relatively higher dry weight and P accumulation and translocation in P0. In severe saline-alkaline soil, however, dry weight and P accumulation and translocation, 1000-grain weight, seed-setting rate and grain yield significantly decreased, but effectively increased with P application for Dongdao-4. Tongyu-315 showed lower sensitivity to P nutrition. Thus, a more tolerant variety could have a stronger capacity to absorb and translocate P for grain filling, especially in severe salt-alkaline soils. This should be helpful for consideration in rice breeding and deciding a reasonable P application in saline-alkaline soil.

Ability of Rf5 and Rf6 to Restore Fertility of Chinsurah Boro II-type Cytoplasmic Male Sterile Oryza Sativa (ssp. Japonica) Lines.

Science.gov (United States)

Zhang, Honggen; Che, Jianlan; Ge, Yongshen; Pei, Yan; Zhang, Lijia; Liu, Qiaoquan; Gu, Minghong; Tang, Shuzhu

2017-12-01

Three-line Oryza sativa (ssp. japonica) hybrids have been developed mainly using Chinsurah Boro II (BT)-type cytoplasmic male sterility (CMS). The Rf1 gene restores the fertility of BT-type CMS lines, and is the only fertility restorer gene (Rf) that has been used to produce three-line japonica hybrids. Using more Rf genes to breed BT-type restorer lines may broaden the genetic diversity of the restorer lines, and represents a viable approach to improve the heterosis level of BT-type japonica hybrids. We identified two major Rf genes from '93-11' that are involved in restoring the fertility of BT-type CMS plants. These genes were identified from resequenced chromosome segment substitution lines derived from a cross between the japonica variety 'Nipponbare' and the indica variety '93-11'. Molecular mapping results revealed that these genes were Rf5 and Rf6, which are the Rf genes that restore fertility to Honglian-type CMS lines. The BT-type F 1 hybrids with either Rf5 or Rf6 exhibited normal seed setting rates, but F 1 plants carrying Rf6 showed more stable seed setting rates than those of plants carrying Rf5 under heat-stress conditions. Furthermore, the seed setting rates of F 1 hybrids carrying both Rf5 and Rf6 were more stable than that of F 1 plants carrying only one Rf gene. Rf6 is an important genetic resource for the breeding of BT-type japonica restorer lines. Our findings may be useful for breeders interested in developing BT-type japonica hybrids.

Traditional production, consumption and storage of Kunu--a non alcoholic cereal beverage.

Science.gov (United States)

Gaffa, T; Jideani, I A; Nkama, I

2002-01-01

A survey of the production, consumption and storage of Kunu was carried out. Some of the information included consumption rate, processing techniques and equipment, producer's status and grains used. About 73% consume Kunu daily, 26% occasionally; 1% know it is produced but may or may not be consuming it. Millet (Pennisetum typhoideum), sorghum (Sorghum vulgare), maize (Zea mays), rice (Oryza sativa) and acha (Digitalis exilis) were used in its production in decreasing order of preference. The grains were used singly or combined; sorghum/millet was the most common combination in a ratio of 1:2 (w/w). Steeping was done in ordinary water for 12-72 h, depending on the grain type, in local clay pots, plastic buckets, calabashes or basins or 5-7 h in warm water (60-70 degrees C). The grains were dry or wet milled with or without spices such as ginger, red pepper, black pepper, clove and garlic. Other ingredients introduced included: sweet potatoes, malted rice, malted sorghum and Cadaba farinosa crude extract. Both dry and wet milling was done with grinding mills, mill stones or mortar and pestle, depending on locality. The product was then cooked into a thin free flowing gruel. The various types of kunu were: Kunun zaki, Kunun gyada, Kunun akamu, Kunun tsamiya, Kunun baule, Kunun jiko, Amshau and Kunun gayamba. Kunun zaki was the most commonly consumed. Production and consumption cut across all social classes of the society.

Carbon-14 dynamics in rice: an extension of the ORYZA2000 model

Energy Technology Data Exchange (ETDEWEB)

Galeriu, D.; Melintescu, A. [' ' Horia Hulubei' ' National Institute for Physics and Nuclear Engineering, Life and Environmental Physics Department, 30 Reactorului St., POB MG-6, Bucharest-Magurele (Romania)

2014-03-15

Carbon-14 ({sup 14}C) is a radionuclide of major interest in nuclear power production. The Fukushima accident changed the public attitude on the use of nuclear energy all over the world. In terms of nuclear safety, the need of quality-assured radiological models was emphasized by many international organizations, and for models used by decision-makers (i.e. regulatory environmental models and radiological models), a moderate conservatism, transparency, relative simplicity and user friendliness are required. Because the interaction between crops and the environment is complex and regulated by many feedback mechanisms, however, these requirements are difficult to accomplish. The present study makes a step forward regarding the development of a robust model dealing with food contamination after a short-term accidental emission and considers a single crop species, rice (Oryza sativa), one of the most widely used rice species. Old and more recent experimental data regarding the carbon dynamics in rice plants are reviewed, and a well-established crop growth model, ORYZA2000, is used and adapted in order to assess the dynamics of {sup 14}C in rice after a short-term exposure to {sup 14}CO{sub 2}. Here, the model is used to investigate the role of the genotype, management and weather on the concentration of radiocarbon at harvest. (orig.)

Sorghum yield and associated satellite-derived meteorological ...

African Journals Online (AJOL)

Sorghum yield and associated satellite-derived meteorological parameters in semi-arid Botswana. ... African Crop Science Journal ... Sorghum (Sorghum bicolor) yield for five seasons (2005/6 to 2009/10) from the Botswana Department of Crop ... Key Words: Coefficient of determination, NDVI, Pearson correlation ...

Ortholog Alleles at Xa3/Xa26 Locus Confer Conserved Race-Specific Resistance against Xanthomonas oryzae in Rice

Institute of Scientific and Technical Information of China (English)

Hong-Jing Li; Xiang-Hua Li; Jing-Hua Xiao; Rod A. Wing; Shi-Ping Wang

2012-01-01

The rice disease resistance (R) gene Xa3/Xa26 (having also been named Xa3 and Xa26) against Xanthomonas oryzae pv.oryzae (Xoo),which causes bacterial blight disease,belongs to a multiple gene family clustered in chromosome 11 and is from an AA genome rice cultivar (Oryza sativa L.).This family encodes leucine-rich repeat (LRR) receptor kinasetype proteins.Here,we show that the orthologs (alleles) of Xa3/Xa26,Xa3/Xa26-2,and Xa3/Xa26-3,from wild Oryza species O.officinalis (CC genome) and O.minuta (BBCC genome),respectively,were also R genes against Xoo.Xa3/Xa26-2 and Xa3/Xa26-3 conferred resistance to 16 of the 18 Xoo strains examined.Comparative sequence analysis of the Xa3/Xa26 families in the two wild Oryza species showed that Xa3/Xa26-3 appeared to have originated from the CC genome of O.minuta.The predicted proteins encoded by Xa3/Xa26,Xa3/Xa26-2,and Xa3/Xa26-3 share 91-99％ sequence identity and 94-99％ sequence similarity.Transgenic plants carrying a single copy of Xa3/Xa26,Xa3/Xa26-2,or Xa3/Xa26-3,in the same genetic background,showed a similar resistance spectrum to a set of Xoo strains,although plants carrying Xa3/Xa26-2 or Xa3/Xa26-3 showed lower resistance levels than the plants carrying Xa3/Xa26.These results suggest that the Xa3/Xa26 locus predates the speciation of A and C genome,which is approximately 7.5 million years ago.Thus,the resistance specificity of this locus has been conserved for a long time.

The imprints of the high light and UV-B stresses in Oryza sativa L. 'Kanchana' seedlings are differentially modulated.

Science.gov (United States)

Faseela, Parammal; Puthur, Jos T

2018-01-01

High light and ultraviolet-B radiation (UV-B) are generally considered to have negative impact on photosynthesis and plant growth. The present study evaluates the tolerance potential of three cultivars of Oryza sativa L. (Kanchana, Mattatriveni and Harsha) seedlings towards high light and UV-B stress on the basis of photosynthetic pigment degradation, chlorophyll a fluorescence parameters and rate of lipid peroxidation, expressed by malondialdehyde content. Surprisingly, it was revealed that Kanchana was the most sensitive cultivar towards high light and at the same time it was the most tolerant cultivar towards UV-B stress. This contrasting feature of Kanchana towards high light and UV-B tolerance was further studied by analyzing photosystem (PS) I and II activity, mitochondrial activity, chlorophyll a fluorescence transient, enzymatic and non-enzymatic antioxidant defense system. Due to the occurrence of more PS I and PSII damages, the inhibition of photochemical efficiency and emission of dissipated energy as heat or fluorescence per PSII reaction center was higher upon high light exposure than UV-B treatments in rice seedlings of Kanchana. The mitochondrial activity was also found to be drastically altered upon high light as compared to UV-B treatments. The UV-B induced accumulation of non-enzymatic antioxidants (proline, total phenolics, sugar and ascorbate) and enzymatic antioxidants (ascorbate peroxidase, guaiacol peroxidase, superoxide dismutase and glutathione reductase) in rice seedlings than those subjected to high light exposure afforded more efficient protection against UV-B radiation in rice seedlings. Our results proved that high tolerance of Kanchana towards UV-B than high light treatments, correlated linearly with the protected photosynthetic and mitochondrial machinery which was provided by upregulation of antioxidants particularly by total phenolics, ascorbate and ascorbate peroxidase in rice seedlings. Data presented in this study conclusively

Regulation of glutamine synthetase isoforms in two differentially drought-tolerant rice (Oryza sativa L.) cultivars under water deficit conditions.

Science.gov (United States)

Singh, Kamal Krishna; Ghosh, Shilpi

2013-02-01

KEY MESSAGE : The regulation of GS isoforms by WD was organ specific. Two GS isoforms i.e. OsGS1;1 and OsGS2 were differentially regulated in IR-64 (drought-sensitive) and Khitish (drought-tolerant) cultivars of rice. Water deficit (WD) has adverse effect on rice (Oryza sativa L.) and acclimation requires essential reactions of primary metabolism to continue. Rice plants utilize ammonium as major nitrogen source, which is assimilated into glutamine by the reaction of Glutamine synthetase (GS, EC 6.3.1.2). Rice plants possess one gene (OsGS2) for chloroplastic GS2 and three genes (OsGS1;1, OsGS1;2 and OsGS1;3) for cytosolic GS1. Here, we report the effect of WD on regulation of GS isoforms in drought-sensitive (cv. IR-64) and drought-tolerant (cv. Khitish) rice cultivars. Under WD, total GS activity in root and leaf decreased significantly in IR-64 seedlings in comparison to Khitish seedlings. The reduced GS activity in IR-64 leaf was mainly due to decrease in GS2 activity, which correlated with decrease in corresponding transcript and polypeptide contents. GS1 transcript and polypeptide accumulated in leaf during WD, however, GS1 activity was maintained at a constant level. Total GS activity in stem of both the varieties was insensitive to WD. Among GS1 genes, OsGS1;1 expression was differently regulated by WD in the two rice varieties. Its transcript accumulated more abundantly in IR-64 leaf than in Khitish leaf. Following WD, OsGS1;1 mRNA level in stem and root tissues declined in IR-64 and enhanced in Khitish. A steady OsGS1;2 expression patterns were noted in leaf, stem and root of both the cultivars. Results suggest that OsGS2 and OsGS1;1 expression may contribute to drought tolerance of Khitish cultivar under WD conditions.

Concentrations of arsenic and lead in rice (Oryza sativa L.) in Iran: A systematic review and carcinogenic risk assessment.

Science.gov (United States)

Fakhri, Yadolah; Bjørklund, Geir; Bandpei, Anoushiravan Mohseni; Chirumbolo, Salvatore; Keramati, Hassan; Hosseini Pouya, Rokhsane; Asadi, Anvar; Amanidaz, Nazak; Sarafraz, Mansour; Sheikhmohammad, Amir; Alipour, Mohamadreza; Baninameh, Zahra; Mohseni, Seyed Mohsen; Sarkhosh, Maryam; Ghasemi, Seyed Mehdi

2018-03-01

Exposure to heavy metals such as arsenic (As), lead (Pb), and cadmium (Cd) in either the short or the long term can cause cancers in humans. Dietary intake and consumption of rice (Oryza sativa L.) is increasing in Iran, and several studies on the concentration of heavy metals in rice have been carried out in this country in recent years. In this perspective, the main objective of the present study was to investigate, even via a meta-analysis of the existing literature, the presence of As and Pb in rice from many geographical areas in Iran, as well as to estimate the carcinogenic risk of these heavy metals in rice consumers. The results of the present ten years-spanning systematic review indicate that 21 reports, collecting a total of 2088 samples, were performed between 2008 and October 2017. The minimum and maximum concentration of As was observed in the Golestan area (0.01 ± 0.01 mg/kg d.w) and the Gillan region (3 mg/kg d.w); and Pb in the Shahrekord (0.07 ± 0.02 mg/kg d.w) and Mazandaran (35 mg/kg d.w). The meta-analysis of data showed that pooled concentration of As in the rice was 0.04 (95%CI: 0.02-0.06 mg/kg d.w), which resulted lower than the National Standard (NS) limits. However, the pooled concentration of Pb in the rice was 0.38 (95%CI: 0.25-0.5 mg/kg d.w), i.e., higher than NS limits. The heterogeneity was significant between As (I 2  = 63%, P value = .003) and Pb (I 2  = 96%, P value rice content of As and Pb are at considerable carcinogenesis risk (ILCR > 10 -3 ). Therefore a decreased level of heavy metals in rice cultivation should be encouraged and performed in next planning. Copyright © 2018 Elsevier Ltd. All rights reserved.

Genetic analysis of recombinant inbred lines for Sorghum bicolor × Sorghum propinquum.

Science.gov (United States)

Kong, Wenqian; Jin, Huizhe; Franks, Cleve D; Kim, Changsoo; Bandopadhyay, Rajib; Rana, Mukesh K; Auckland, Susan A; Goff, Valorie H; Rainville, Lisa K; Burow, Gloria B; Woodfin, Charles; Burke, John J; Paterson, Andrew H

2013-01-01

We describe a recombinant inbred line (RIL) population of 161 F5 genotypes for the widest euploid cross that can be made to cultivated sorghum (Sorghum bicolor) using conventional techniques, S. bicolor × Sorghum propinquum, that segregates for many traits related to plant architecture, growth and development, reproduction, and life history. The genetic map of the S. bicolor × S. propinquum RILs contains 141 loci on 10 linkage groups collectively spanning 773.1 cM. Although the genetic map has DNA marker density well-suited to quantitative trait loci mapping and samples most of the genome, our previous observations that sorghum pericentromeric heterochromatin is recalcitrant to recombination is highlighted by the finding that the vast majority of recombination in sorghum is concentrated in small regions of euchromatin that are distal to most chromosomes. The advancement of the RIL population in an environment to which the S. bicolor parent was well adapted (indeed bred for) but the S. propinquum parent was not largely eliminated an allele for short-day flowering that confounded many other traits, for example, permitting us to map new quantitative trait loci for flowering that previously eluded detection. Additional recombination that has accrued in the development of this RIL population also may have improved resolution of apices of heterozygote excess, accounting for their greater abundance in the F5 than the F2 generation. The S. bicolor × S. propinquum RIL population offers advantages over early-generation populations that will shed new light on genetic, environmental, and physiological/biochemical factors that regulate plant growth and development.

A novel epistatic interaction at two loci causing hybrid male sterility in an inter-subspecific cross of rice (Oryza sativa L.).

Science.gov (United States)

Kubo, Takahiko; Yamagata, Yoshiyuki; Eguchi, Maki; Yoshimura, Atsushi

2008-12-01

Postzygotic reproductive isolation (RI) often arises in inter-subspecific crosses as well as inter-specific crosses of rice (Oryza sativa L.). To further understand the genetic architecture of the postzygotic RI, we analyzed genes causing hybrid sterility and hybrid breakdown in a rice inter-subspecific cross. Here we report hybrid male sterility caused by epistatic interaction between two novel genes, S24 and S35, which were identified on rice chromosomes 5 and 1, respectively. Genetic analysis using near-isogenic lines (NILs) carrying IR24 (ssp. indica) segments with Asominori (ssp. japonica) genetic background revealed a complicated aspect of the epistasis. Allelic interaction at the S24 locus in the heterozygous plants caused abortion of male gametes carrying the Asominori allele (S24-as) independent of the S35 genotype. On the other hand, male gametes carrying the Asominori allele at the S35 locus (S35-as) showed abortion only when the IR24 allele at the S24 locus (S24-ir) was concurrently introgressed into the S35 heterozygous plants, indicating that the sterility phenotype due to S35 was dependent on the S24 genotype through negative epistasis between S24-ir and S35-as alleles. Due to the interaction between S24 and S35, self-pollination of the double heterozygous plants produced pollen-sterile progeny carrying the S24-ir/S24-ir S35-as/S35-ir genotype in addition to the S24 heterozygous plants. This result suggests that the S35 gene might function as a modifier of S24. This study presents strong evidence for the importance of epistatic interaction as a part of the genetic architecture of hybrid sterility in rice. In addition, it suggests that diverse systems have been developed as postzygotic RI mechanisms within the rice.

Diurnal oscillation of SBE expression in sorghum endosperm

Energy Technology Data Exchange (ETDEWEB)

Sun, Chuanxin; Mutisya, J.; Rosenquist, S.; Baguma, Y.; Jansson, C.

2009-01-15

Spatial and temporal expression patterns of the sorghum SBEI, SBEIIA and SBEIIB genes, encoding, respectively, starch branching enzyme (SBE) I, IIA and IIB, in the developing endosperm of sorghum (Sorghum bicolor) were studied. Full-length genomic and cDNA clones for sorghum was cloned and the SBEIIA cDNA was used together with gene-specific probes for sorghum SBEIIB and SBEI. In contrast to sorghum SBEIIB, which was expressed primarily in endosperm and embryo, SBEIIA was expressed also in vegetative tissues. All three genes shared a similar temporal expression profile during endosperm development, with a maximum activity at 15-24 days after pollination. This is different from barley and maize where SBEI gene activity showed a significantly later onset compared to that of SBEIIA and SBEIIB. Expression of the three SBE genes in the sorghum endosperm exhibited a diurnal rhythm during a 24-h cycle.

Dhurrin content relates to sorghum (Sorghum bicolor (L) Moench) seedling growth in marginal soils.

Science.gov (United States)

Dhurrin content in leaves of mature sorghum plant is a quantitative measure of the level of pre-and postflowering drought tolerance (Burke et al., 2013). Postflowering drought tolerance in sorghum is linked to the staygreen (delayed senescence) trait (Howarth, 2000; Rosenow et al., 1977) which has b...

Dhurrin content relates to sorghum [sorghum bicolor (L.) Moench] seedling growth in marginal soils

Science.gov (United States)

Dhurrin content in leaves of mature sorghum plant is a quantitative measure of the level of pre-and postflowering drought tolerance (Burke et al., 2013). Postflowering drought tolerance in sorghum is linked to the staygreen (delayed senescence) trait (Howarth, 2000; Rosenow et al., 1977) which has ...

In silico analysis of cis-acting regulatory elements in 5' regulatory regions of sucrose transporter gene families in rice (Oryza sativa Japonica) and Arabidopsis thaliana.

Science.gov (United States)

Ibraheem, Omodele; Botha, Christiaan E J; Bradley, Graeme

2010-12-01

The regulation of gene expression involves a multifarious regulatory system. Each gene contains a unique combination of cis-acting regulatory sequence elements in the 5' regulatory region that determines its temporal and spatial expression. Cis-acting regulatory elements are essential transcriptional gene regulatory units; they control many biological processes and stress responses. Thus a full understanding of the transcriptional gene regulation system will depend on successful functional analyses of cis-acting elements. Cis-acting regulatory elements present within the 5' regulatory region of the sucrose transporter gene families in rice (Oryza sativa Japonica cultivar-group) and Arabidopsis thaliana, were identified using a bioinformatics approach. The possible cis-acting regulatory elements were predicted by scanning 1.5kbp of 5' regulatory regions of the sucrose transporter genes translational start sites, using Plant CARE, PLACE and Genomatix Matinspector professional databases. Several cis-acting regulatory elements that are associated with plant development, plant hormonal regulation and stress response were identified, and were present in varying frequencies within the 1.5kbp of 5' regulatory region, among which are; A-box, RY, CAT, Pyrimidine-box, Sucrose-box, ABRE, ARF, ERE, GARE, Me-JA, ARE, DRE, GA-motif, GATA, GT-1, MYC, MYB, W-box, and I-box. This result reveals the probable cis-acting regulatory elements that possibly are involved in the expression and regulation of sucrose transporter gene families in rice and Arabidopsis thaliana during cellular development or environmental stress conditions. Copyright © 2010 Elsevier Ltd. All rights reserved.

Rate and Timing Effects of Growth Regulating Herbicides Applications on Grain Sorghum (Sorghum bicolor Growth and Yield

Directory of Open Access Journals (Sweden)

Thierry E. Besançon

2016-01-01

Full Text Available Dicamba and 2,4-D are among the most common and inexpensive herbicides used to control broadleaf weeds. However, different studies have pointed the risk of crop injury and grain sorghum yield reduction with postemergence applications of 2,4-D. No research data on grain sorghum response to 2,4-D or dicamba exists in the Southeastern United States. Consequently, a study was conducted to investigate crop growth and yield response to 2,4-D (100, 220, and 330 g acid equivalent ha−1 and dicamba (280 g acid equivalent ha−1 applied on 20 to 65 cm tall sorghum. Greater stunting resulted from 2,4-D applied at 330 g acid equivalent ha−1 or below 45 cm tall sorghum whereas lodging prevailed with 2,4-D at 330 g acid equivalent ha−1 and dicamba applied beyond 35 cm tall crop. Regardless of local environmental conditions, 2,4-D applied up to 35 cm tall did not negatively impact grain yield. There was a trend for yields to be somewhat lower when 2,4-D was applied on 45 or 55 cm tall sorghum whereas application on 65 cm tall sorghum systematically decreased yields. More caution should be taken with dicamba since yield reduction has been reported as early as applications made on 35 cm tall sorghum for a potentially dicamba sensitive cultivar.

Ehd4 encodes a novel and Oryza-genus-specific regulator of photoperiodic flowering in rice.

Directory of Open Access Journals (Sweden)

He Gao

Full Text Available Land plants have evolved increasingly complex regulatory modes of their flowering time (or heading date in crops. Rice (Oryza sativa L. is a short-day plant that flowers more rapidly in short-day but delays under long-day conditions. Previous studies have shown that the CO-FT module initially identified in long-day plants (Arabidopsis is evolutionary conserved in short-day plants (Hd1-Hd3a in rice. However, in rice, there is a unique Ehd1-dependent flowering pathway that is Hd1-independent. Here, we report isolation and characterization of a positive regulator of Ehd1, Early heading date 4 (Ehd4. ehd4 mutants showed a never flowering phenotype under natural long-day conditions. Map-based cloning revealed that Ehd4 encodes a novel CCCH-type zinc finger protein, which is localized to the nucleus and is able to bind to nucleic acids in vitro and transactivate transcription in yeast, suggesting that it likely functions as a transcriptional regulator. Ehd4 expression is most active in young leaves with a diurnal expression pattern similar to that of Ehd1 under both short-day and long-day conditions. We show that Ehd4 up-regulates the expression of the "florigen" genes Hd3a and RFT1 through Ehd1, but it acts independently of other known Ehd1 regulators. Strikingly, Ehd4 is highly conserved in the Oryza genus including wild and cultivated rice, but has no homologs in other species, suggesting that Ehd4 is originated along with the diversification of the Oryza genus from the grass family during evolution. We conclude that Ehd4 is a novel Oryza-genus-specific regulator of Ehd1, and it plays an essential role in photoperiodic control of flowering time in rice.

Metagenome analysis of the root endophytic microbial community of Indian rice (O. sativa L.

Directory of Open Access Journals (Sweden)

Subhadipa Sengupta

2017-06-01

Full Text Available This study reports the root endophytic microbial community profile in rice (Oryza sativa L., the largest food crop of Asia, using 16S rRNA gene amplicon sequencing. Metagenome of OS01 and OS04 consisted of 11,17,900 sequences with 300 Mbp size and average 55.6% G + C content. Data of this study are available at NCBI Bioproject (PRJNA360379. The taxonomic analysis of 843 OTU's showed that the sequences belonged to four major phyla revealing dominance of Proteobacteria, Firmicutes, Cyanobacteria and Actinobacteria. Results reveal the dominance of Bacillus as major endophytic genera in rice roots, probably playing a key role in Nitrogen fixation.

SOME CONSIDERATIONS ON THE PROSPECTS OF SORGHUM CROP

Directory of Open Access Journals (Sweden)

Agatha POPESCU

2014-10-01

Full Text Available The paper purpose was to analyze the sorghum statement at world, EU and Romania level in order to establish the main trends in the future of this crop. Sorghum is an important cereal coming on the 5th position after maize, rice, wheat and barley at world level due to its importance in human nutrition, animal feed, in producing bioethanol and green energy, and due to its good impact on environment. It is cultivated on all the continents, in the tropical, subtropical and temperate areas due to its resistance to drought, production potential, low inputs and production cost. It is an alternative to maize crop being more utilized as substituent in animal diets. The world sorghum production reached 63,811 thousand metric tons in 2014, the main producers being the USA, Mexico, Nigeria, India, Argentina, Ethiopia, Sudan and China. The world consumption of sorghum reached 63,148 thousand metric tons and it is continuously increasing. The sorghum exports accounted for 7,690 thousand metric tons in 2014, of which the USA export represents 4,600 thousand metric tons. Besides the USA, other exporting countries are Argentina, Australia, Ethiopia, India, Nigeria, Uruguay, while the main importing countries are China, Japan, Chile, Colombia, Mexico, the EU, Sudan. In 2014, the EU produced 576 thousand metric tons sorghum, imported 200 thousand metric tons, and consumed 770 thousand metric tons. The main EU producers of sorghum are France, Italy, Romania, Spain and Hungary. In 2012, Romania cultivated 20,000 ha with sorghum crop, 18 times more than in 2077. Also, in 2012, Romania produced 37.5 thousand tons of sorghum grains, by 31 times more than in 2007. The sorghum yield was 1,875 kg/ha by 66% higher in 2012 compared to 2007. Therefore, these figures show the increasing importance of sorghum crop at world level. Because Romania is situated in suitable geographical area for producing sorghum, it could increase production and become a more important supplier

Fermentation and enzyme treatments for sorghum

Directory of Open Access Journals (Sweden)

Patrícia Fernanda Schons

2012-03-01

Full Text Available Sorghum (Sorghum bicolor Moench is the fifth most produced cereal worldwide. However, some varieties of this cereal contain antinutritional factors, such as tannins and phytate that may form stable complexes with proteins and minerals which decreases digestibility and nutritional value. The present study sought to diminish antinutritional tannins and phytate present in sorghum grains. Three different treatments were studied for that purpose, using enzymes tannase (945 U/Kg sorghum, phytase (2640 U/Kg sorghum and Paecilomyces variotii (1.6 X 10(7 spores/mL; A Tannase, phytase and Paecilomyces variotii, during 5 and 10 days; B An innovative blend made of tanase and phytase for 5 days followed by a Pv increase for 5 more days; C a third treatment where the reversed order of B was used starting with Pv for 5 days and then the blend of tannase and phytase for 5 more days. The results have shown that on average the three treatments were able to reduce total phenols and both hydrolysable and condensed tannins by 40.6, 38.92 and 58.00 %, respectively. Phytase increased the amount of available inorganic phosphorous, on the average by 78.3 %. The most promising results concerning tannins and phytate decreases were obtained by the enzymes combination of tannase and phytase. The three treatments have shown effective on diminishing tannin and phytate contents in sorghum flour which leads us to affirm that the proposed treatments can be used to increase the nutritive value of sorghum grains destined for either animal feeds or human nutrition.

Fermentation and enzyme treatments for sorghum.

Science.gov (United States)

Schons, Patrícia Fernanda; Battestin, Vania; Macedo, Gabriela Alves

2012-01-01

Sorghum (Sorghum bicolor Moench) is the fifth most produced cereal worldwide. However, some varieties of this cereal contain antinutritional factors, such as tannins and phytate that may form stable complexes with proteins and minerals which decreases digestibility and nutritional value. The present study sought to diminish antinutritional tannins and phytate present in sorghum grains. Three different treatments were studied for that purpose, using enzymes tannase (945 U/Kg sorghum), phytase (2640 U/Kg sorghum) and Paecilomyces variotii (1.6 X 10(7) spores/mL); A) Tannase, phytase and Paecilomyces variotii, during 5 and 10 days; B) An innovative blend made of tanase and phytase for 5 days followed by a Pv increase for 5 more days; C) a third treatment where the reversed order of B was used starting with Pv for 5 days and then the blend of tannase and phytase for 5 more days. The results have shown that on average the three treatments were able to reduce total phenols and both hydrolysable and condensed tannins by 40.6, 38.92 and 58.00 %, respectively. Phytase increased the amount of available inorganic phosphorous, on the average by 78.3 %. The most promising results concerning tannins and phytate decreases were obtained by the enzymes combination of tannase and phytase. The three treatments have shown effective on diminishing tannin and phytate contents in sorghum flour which leads us to affirm that the proposed treatments can be used to increase the nutritive value of sorghum grains destined for either animal feeds or human nutrition.

A cell wall-degrading esterase of Xanthomonas oryzae requires a unique substrate recognition module for pathogenesis on rice.

Science.gov (United States)

Aparna, Gudlur; Chatterjee, Avradip; Sonti, Ramesh V; Sankaranarayanan, Rajan

2009-06-01

Xanthomonas oryzae pv oryzae (Xoo) causes bacterial blight, a serious disease of rice (Oryza sativa). LipA is a secretory virulence factor of Xoo, implicated in degradation of rice cell walls and the concomitant elicitation of innate immune responses, such as callose deposition and programmed cell death. Here, we present the high-resolution structural characterization of LipA that reveals an all-helical ligand binding module as a distinct functional attachment to the canonical hydrolase catalytic domain. We demonstrate that the enzyme binds to a glycoside ligand through a rigid pocket comprising distinct carbohydrate-specific and acyl chain recognition sites where the catalytic triad is situated 15 A from the anchored carbohydrate. Point mutations disrupting the carbohydrate anchor site or blocking the pocket, even at a considerable distance from the enzyme active site, can abrogate in planta LipA function, exemplified by loss of both virulence and the ability to elicit host defense responses. A high conservation of the module across genus Xanthomonas emphasizes the significance of this unique plant cell wall-degrading function for this important group of plant pathogenic bacteria. A comparison with the related structural families illustrates how a typical lipase is recruited to act on plant cell walls to promote virulence, thus providing a remarkable example of the emergence of novel functions around existing scaffolds for increased proficiency of pathogenesis during pathogen-plant coevolution.

Monitoring expression profiles of rice (Oryza sativa L.) genes under abiotic stresses using cDNA Microarray Analysis (abstract)

International Nuclear Information System (INIS)

Rabbani, M.A.

2005-01-01

Transcript regulation in response to cold, drought, high salinity and ABA application was investigated in rice (Oryza sativa L., Nipponbare) with microarray analysis including approx. 1700 independent DNA elements derived from three cDNA libraries constructed from 15-day old rice seedlings stressed with drought, cold and high salinity. A total of 141 non-redundant genes were identified, whose expression ratios were more than three-fold compared with the control genes for at least one of stress treatments in microarray analysis. However, after RNA gel blot analysis, a total of 73 genes were identified, among them the transcripts of 36, 62, 57 and 43 genes were found increased after cold, drought, high salinity and ABA application, respectively. Sixteen of these identified genes have been reported previously to be stress inducible in rice, while 57 of which are novel that have not been reported earlier as stress responsive in rice. We observed a strong association in the expression patterns of stress responsive genes and found 15 stress inducible genes that responded to all four treatments. Based on Venn diagram analysis, 56 genes were induced by both drought and high salinity, whereas 22 genes were upregulated by both cold and high salinity stress. Similarly 43 genes were induced by both drought stress and ABA application, while only 17 genes were identified as cold and ABA inducible genes. These results indicated the existence of greater cross talk between drought, ABA and high salinity stress signaling processes than those between cold and ABA, and cold and high salinity stress signaling pathways. The cold, drought, high salinity and ABA inducible genes were classified into four gene groups from their expression profiles. Analysis of data enabled us to identify a number of promoters and possible cis-acting DNA elements of several genes induced by a variety of abiotic stresses by combining expression data with genomic sequence data of rice. Comparative analysis of

Population Dynamics Among six Major Groups of the Oryza rufipogon Species Complex, Wild Relative of Cultivated Asian Rice.

Science.gov (United States)

Kim, HyunJung; Jung, Janelle; Singh, Namrata; Greenberg, Anthony; Doyle, Jeff J; Tyagi, Wricha; Chung, Jong-Wook; Kimball, Jennifer; Hamilton, Ruaraidh Sackville; McCouch, Susan R

2016-12-01

Understanding population structure of the wild progenitor of Asian cultivated rice (O. sativa), the Oryza rufipogon species complex (ORSC), is of interest to plant breeders and contributes to our understanding of rice domestication. A collection of 286 diverse ORSC accessions was evaluated for nuclear variation using genotyping-by-sequencing (113,739 SNPs) and for chloroplast variation using Sanger sequencing (25 polymorphic sites). Six wild subpopulations were identified, with 25 % of accessions classified as admixed. Three of the wild groups were genetically and geographically closely related to the O. sativa subpopulations, indica, aus and japonica, and carried O. sativa introgressions; the other three wild groups were genetically divergent, had unique chloroplast haplotypes, and were located at the geographical extremes of the species range. The genetic subpopulations were significantly correlated (r 2  = 0.562) with traditional species designations, O. rufipogon (perennial) and O. nivara (annual), differentiated based on morphology and life history. A wild diversity panel of 95 purified (inbred) accessions was developed for future genetic studies. Our results suggest that the cultivated aus subpopulation is most closely related to an annual wild relative, japonica to a perennial wild relative, and indica to an admixed population of diverse annual and perennial wild ancestors. Gene flow between ORSC and O. sativa is common in regions where rice is cultivated, threatening the identity and diversity of wild ORSC populations. The three geographically isolated ORSC populations harbor variation rarely seen in cultivated rice and provide a unique window into the genetic composition of ancient rice subpopulations.

Breeding for blast-disease-resistant and high-yield Thai jasmine rice (Oryza sativa L. cv. KDML 105) mutants using low-energy ion beams

Energy Technology Data Exchange (ETDEWEB)

Mahadtanapuk, S. [School of Agriculture and Natural Resources, University of Phayao, Phayao 56000 (Thailand); Teraarusiri, W. [Central Laboratory, University of Phayao, Phayao 56000 (Thailand); Phanchaisri, B. [Science and Technology Research Institute, Chiang Mai University, Chiang Mai 50200 (Thailand); Yu, L.D., E-mail: yuld@frnf.science.cmu.ac.th [Plasma and Beam Physics Research Facility, Department of Physics and Materials Science, Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand); Thailand Center of Excellence in Physics, Commission on Higher Education, 328 Si Ayutthaya Road, Bangkok 10400 (Thailand); Anuntalabhochai, S., E-mail: burinka@hotmail.com [Department of Biology, Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand)

2013-07-15

Highlights: •N-ion beam bombarded Thai jasmine rice seeds to induce mutation. •Mutants with blast-disease resistance and high yield were screened. •Gene involved in the blast-disease resistance was analyzed. •The gene responsible for the resistance was linked to Spotted leaf protein 11. -- Abstract: Low-energy ion beam was applied on mutation induction for plant breeding of blast-disease-resistant Thai jasmine rice (Oryza sativa L. cv. KDML 105). Seeds of the wild-type rice were bombarded in vacuum by nitrogen ion beam at energy of 60–80 keV to a beam fluence range of 2 × 10{sup 16}–2 × 10{sup 17} ions/cm{sup 2}. The ion-bombarded rice seeds were grown in soil for 2 weeks as transplanted rice in plastic pots at 1 seedling/pot. The seedlings were then screened for blast resistance by Pyricularia grisea inoculation with 10{sup 6} spores/ml concentrations. The blast-resistant rice mutant was planted up to F6 generation with the consistent phenotypic variation. The high percentage of the blast-disease-resistant rice was analyzed with DNA fingerprint. The HAT-RAPD (high annealing temperature-random amplified polymorphic DNA) marker revealed the modified polymorphism fragment presenting in the mutant compared with wild type (KDML 105). The cDNA fingerprints were investigated and the polymorphism fragment was subcloned into pGEM-T easy vector and then sequenced. The sequence of this fragment was compared with those already contained in the database, and the fragment was found to be related to the Spotted leaf protein 11 (Spl11)

Enhanced ethanol production from stalk juice of sweet sorghum by ...

African Journals Online (AJOL)

Sweet sorghum (sugar sorghum, Sorghum bicolor) is one kind of non-grain energy crops. As a novel green regenerated high-energy crop with high utility value, high yield of biomass, the sweet sorghum is widely used and developed in China. Stalk juice of sweet sorghum was used as the main substrate for ethanol ...

Effect of heat moisture treatment (HMT) on product quality of sorghum starch

Science.gov (United States)

Haryani, Kristinah; Hadiyanto, Handayani, Noera; Nugraheni, Dwi; Suryanto

2015-12-01

Sorghum is a cereal plant that rich of nutrition contents. The high content of carbohydrate in sorghum make this plant can be processed into one of the processed food i.e vermicelli. To give better quality, it is necessary to use flour substitution from sorghum starch. The aim of this study was to evaluate the treatment of natural sorghum starch substitution, the addition of CMC, and a comparison of the natural starch with starch sorghum forage sorghum against solid losses value, rehydration weight and texture profiles. The variable used in this study: amount of natural sorghum starch subtituion (10%, 20%, 30%, 40%, 50%), the addition of CMC (0.1%; 0.2%; 0.3%; 0.4%; 0.5%) and substituting sorghum starch Natural: HMT sorghum starch (1: 1; 1: 2; 1: 3; 1: 4; 1: 5) and the quality parameters were evaluated. The result indicated that to substitute sorghum starch naturally at a rate of 50% had the best results with a value of solid losses 5.1% (white sorghum) 5.83% (red sorghum) and weighing rehydration 301.82% (white sorghums) 293.16% (red sorghum), the addition of CMC with 0.5% concentration of 3.96% solid losses value (red sorghum) 4:21% (white sorghums) and weight rehydration 252.71% (white sorghums) 244.45% (red sorghums).

Nutritive value of diferents silage sorghum (Sorghum bicolor L. Moench cultivares - doi: 10.4025/actascianimsci.v34i2.12853

Directory of Open Access Journals (Sweden)

Luiz Henrique dos Santos Gomes

2012-03-01

Full Text Available Nutrition values of silages from different sorghum cultivars are evaluated. Five 26-kg castrated crossbred lambs, housed in pens equipped with feces and urine collectors for the study of their metabolism, were employed in a 5 x 5 Latin square experimental design. Treatments consisted of silage from five different sorghum cultivars: IPA 1011 and IPA 2564 (grain sorghum, IPA 2502 (dual purpose sorghum, IPA FS-25 and IPA 467 (forage sorghum. Protein level was corrected to 12% by adding a mixture of urea: ammonium sulfate (9:1. Treatments IPA 1011, IPA 2564 and IPA 2502 provided high intake of dry matter, total carbohydrate and total digestible nutrients, and low intake of neutral detergent fiber. Cultivars IPA 1011 and IPA 2564 provided high apparent crude protein digestibility coefficient, whereas cultivars IPA 1011 and IPA 2564 had high total digestible nutrient levels. All cultivars provided positive nitrogen. Owing to nutrient intake and digestibility values, grain sorghum silages evidenced high potential in ruminant nutrition.

Characterization of Nitrogen use efficiency in sweet sorghum

Energy Technology Data Exchange (ETDEWEB)

Dweikat, Ismail [University of Nebraska; Clemente, Thomas [University of Nebrask

2014-09-09

Sweet sorghum (Sorghum bicolor L. Moench) has the potential to augment the increasing demand for alternative fuels and for the production of input efficient, environmentally friendly bioenergy crops. Nitrogen (N) and water availability are considered two of the major limiting factors in crop growth. Nitrogen fertilization accounts for about 40% of the total production cost in sorghum. In cereals, including sorghum, the nitrogen use efficiency (NUE) from fertilizer is approximately 33% of the amount applied. There is therefore extensive concern in relation to the N that is not used by the plant, which is lost by leaching of nitrate, denitrification from the soil, and loss of ammonia to the atmosphere, all of which can have deleterious environmental effects. To improve the potential of sweet sorghum as a leading and cost effective bioenergy crop, the enhancement of NUE must be addressed. To this end, we have identified a sorghum line (SanChi San) that displays about 25% increase in NUE over other sorghum lines. As such, the overarching goal of this project is to employ three complementary strategies to enhance the ability of sweet sorghum to become an efficient nitrogen user. To achieve the project goal, we will pursue the following specific objectives: Objective 1: Phenotypic characterization of SanChi San/Ck60 RILs under low and moderate N-availability including biochemical profiles, vegetative growth and seed yield Objective 2: Conduct quantitative trait loci (QTL) analysis and marker identification for nitrogen use efficiency (NUE) in a grain sorghum RIL population. Objective 3: Identify novel candidate genes for NUE using proteomic and gene expression profiling comparisons of high- and low-NUE RILs. Candidate genes will be brought into the pipeline for transgenic manipulation of NUE This project will apply the latest genomics resources to discover genes controlling NUE, one of the most complex and economically important traits in cereal crops. As a result of the

Phylogeography of Asian wild rice, Oryza rufipogon: a genome-wide view.

Science.gov (United States)

Huang, Pu; Molina, Jeanmaire; Flowers, Jonathan M; Rubinstein, Samara; Jackson, Scott A; Purugganan, Michael D; Schaal, Barbara A

2012-09-01

Asian wild rice (Oryza rufipogon) that ranges widely across the eastern and southern part of Asia is recognized as the direct ancestor of cultivated Asian rice (O. sativa). Studies of the geographic structure of O. rufipogon, based on chloroplast and low-copy nuclear markers, reveal a possible phylogeographic signal of subdivision in O. rufipogon. However, this signal of geographic differentiation is not consistently observed among different markers and studies, with often conflicting results. To more precisely characterize the phylogeography of O. rufipogon populations, a genome-wide survey of unlinked markers, intensively sampled from across the entire range of O. rufipogon is critical. In this study, we surveyed sequence variation at 42 genome-wide sequence tagged sites (STS) in 108 O. rufipogon accessions from throughout the native range of the species. Using Bayesian clustering, principal component analysis and amova, we conclude that there are two genetically distinct O. rufipogon groups, Ruf-I and Ruf-II. The two groups exhibit a clinal variation pattern generally from north-east to south-west. Different from many earlier studies, Ruf-I, which is found mainly in China and the Indochinese Peninsula, shows genetic similarity with one major cultivated rice variety, O. satvia indica, whereas Ruf-II, mainly from South Asia and the Indochinese Peninsula, is not found to be closely related to cultivated rice varieties. The other major cultivated rice variety, O. sativa japonica, is not found to be similar to either O. rufipogon groups. Our results support the hypothesis of a single origin of the domesticated O. sativa in China. The possible role of palaeoclimate, introgression and migration-drift balance in creating this clinal variation pattern is also discussed. © 2012 Blackwell Publishing Ltd.

Silicon treatment to rice (oryza sativa l. cv 'gopumbyeo') plants during different growth periods and its effects on growth and grain yield

International Nuclear Information System (INIS)

Kim, Y.H.; Waqas, M.; Kamran, M.

2012-01-01

Silicon (Si) has been considered a beneficial element for plant growth. We have assessed the effects of Si application on rice (Oryza sativa L.) growth and its grain yield at field level. For this, we performed two experiments. In experiment 1, we applied Si of three different concentrations (liquid Si-10, 25 and 36%) to the seedbed of rice before transplantation into paddy field. The results of this experiment showed that Si application to rice seedbeds did not affected the rice plant height and shoot fresh weight but its application significantly increased the pushing resistance of rice plants from 12.2-16.7% as compared with water applied control plants. The lodging index of Si treated rice plants significantly decreased (13.7% on LS-25) as compared with control. Similarly, Si treated plants had significantly higher yield. Upon Si treatment (LS-36), the grain yield per 10 acre and panicles per plant were 15.1% and 6. 3% higher than the water treated control plants respectively. The best concentration (LS-36%) revealed in the first experiment was foliar applied at 10 days before heading stage, initial tilling stage and panicle initiation stage to the rice leaves and we observed that shoot biomass was not significantly different between control and Si treated plants. However, significantly higher pushing resistance (10.5%-13.8%) and plant height (12.2%-16.7%) were observed while lower lodging index (7.6-7.8%) was recorded for Si treated plants as compared to control plants. Similarly, Si application increased the number of panicles per plant as well as the grain yield per 10 acre as compared to control. In conclusion, the Si application can significantly regulate plant growth and yield if applied at proper time with feasible concentration. (author)

Reactive oxygen species induced by heat stress during grain filling of rice (Oryza sativa L.) are involved in occurrence of grain chalkiness.

Science.gov (United States)

Suriyasak, Chetphilin; Harano, Keisuke; Tanamachi, Koichiro; Matsuo, Kazuhiro; Tamada, Aina; Iwaya-Inoue, Mari; Ishibashi, Yushi

2017-09-01

Heat stress during grain filling increases rice grain chalkiness due to increased activity of α-amylase, which hydrolyzes starch. In rice and barley seeds, reactive oxygen species (ROS) produced after imbibition induce α-amylase activity via regulation of gibberellin (GA) and abscisic acid (ABA) levels during seed germination. Here, we examined whether ROS is involved in induction of grain chalkiness by α-amylase in developing rice grains under heat stress. To elucidate the role of ROS in grain chalkiness, we grew post-anthesis rice plants (Oryza sativa L. cv. Koshihikari) under control (25°C) or heat stress (30°C) conditions with or without antioxidant (dithiothreitol) treatment. The developing grains were analyzed for expression of NADPH oxidases, GA biosynthesis genes (OsGA3ox1, OsGA20ox1), ABA catabolism genes (OsABA8'OH1, OsABA8'OH2) and an α-amylase gene (OsAmy3E), endogenous H 2 O 2 content and the grain quality. In grains exposed to heat stress, the expression of NADPH oxidase genes (especially, OsRbohB, OsRbohD, OsRbohF and OsRbohI) and the ROS content increased. Heat stress also increased the expression of OsGA3ox1, OsGA20ox1, OsABA8'OH1, OsABA8'OH2 and OsAmy3E. On the other hand, dithiothreitol treatment reduced the effects of heat stress on the expression of these genes and significantly reduced grain chalkiness induced by heat stress. These results suggest that, similar to cereal seed germination mechanism, ROS produced under heat stress is involved in α-amylase induction in maturating rice grains through GA/ABA metabolism, and consequently caused grain chalkiness. Copyright © 2017 Elsevier GmbH. All rights reserved.

HrcQ is necessary for Xanthomonas oryzae pv. oryzae HR-induction in non-host tobacco and pathogenicity in host rice

Directory of Open Access Journals (Sweden)

Xiaoping Zhang

2013-12-01

Full Text Available Bacterial blight, caused by Xanthomonas oryzae pv. oryzae (Xoo, is one of the most destructive diseases of rice (Oryza sativa L. worldwide. The type III secretion system (T3SS of Xoo, encoded by the hrp (hypersensitive response and pathogenicity genes, plays critical roles in conferring pathogenicity in host rice and triggering a hypersensitive response (HR in non-host plants. To investigate the major genes conferring the pathogenicity and avirulence of Xoo, we previously constructed a random Tn5-insertion mutant library of Xoo strain PXO99A. We report here the isolation and characterization of a Tn5-insertion mutant PXM69. Tn5-insertion mutants were screened on indica rice JG30, which is highly susceptible to PXO99A, by leaf-cutting inoculation. Four mutants with reduced virulence were obtained after two rounds of screening. Among them, the mutant PXM69 had completely lost virulence to the rice host and ability to elicit HR in non-host tobacco. Southern blotting analysis showed a single copy of a Tn5-insertion in the genome of PXM69. PCR walking and sequencing analysis revealed that the Tn5 transposon was inserted at nucleotide position 70,192–70,201 in the genome of PXO99A, disrupting the type III hrc (hrp-conserved gene hrcQ, the first gene in the D operon of the hrp cluster in Xoo. To confirm the relationship between the Tn5-insertion and the avirulence phenotype of PXM69, we used the marker exchange mutagenesis to create a PXO99A mutant, ΔhrcQ::KAN, in which the hrcQ was disrupted by a kanamycin-encoding gene cassette at the same site as that of the Tn5-insertion. ΔhrcQ::KAN showed the same phenotype as mutant PXM69. Reintroduction of the wild-type hrcQ gene partially complemented the pathogenic function of PXM69. RT-PCR and cellulase secretion assays showed that the Tn5-disruption of hrcQ did not affect transcription of downstream genes in the D operon and function of the type II secretion system. Our results provide new insights into

HrcQ is necessary for Xanthomonas oryzae pv. oryzae HR-induction in non-host tobacco and pathogenicity in host rice

Institute of Scientific and Technical Information of China (English)

Xiaoping; Zhang; Chunlian; Wang; Chongke; Zheng; Jinying; Che; Yanqiang; Li; Kaijun; Zhao

2013-01-01

Bacterial blight, caused by Xanthomonas oryzae pv. oryzae(Xoo), is one of the most destructive diseases of rice(Oryza sativa L.) worldwide. The type III secretion system(T3SS) of Xoo, encoded by the hrp(hypersensitive response and pathogenicity) genes, plays critical roles in conferring pathogenicity in host rice and triggering a hypersensitive response(HR) in non-host plants. To investigate the major genes conferring the pathogenicity and avirulence of Xoo, we previously constructed a random Tn5-insertion mutant library of Xoo strain PXO99A. We report here the isolation and characterization of a Tn5-insertion mutant PXM69. Tn5-insertion mutants were screened on indica rice JG30, which is highly susceptible to PXO99A, by leaf-cutting inoculation.Four mutants with reduced virulence were obtained after two rounds of screening. Among them, the mutant PXM69 had completely lost virulence to the rice host and ability to elicit HR in non-host tobacco. Southern blotting analysis showed a single copy of a Tn5-insertion in the genome of PXM69. PCR walking and sequencing analysis revealed that the Tn5 transposon was inserted at nucleotide position 70,192–70,201 in the genome of PXO99A, disrupting the type III hrc(hrp-conserved) gene hrcQ, the first gene in the D operon of the hrp cluster in Xoo. To confirm the relationship between the Tn5-insertion and the avirulence phenotype of PXM69, we used the marker exchange mutagenesis to create a PXO99Amutant, ΔhrcQ::KAN, in which the hrcQ was disrupted by a kanamycin-encoding gene cassette at the same site as that of the Tn5-insertion. ΔhrcQ::KAN showed the same phenotype as mutant PXM69. Reintroduction of the wild-type hrcQ gene partially complemented the pathogenic function of PXM69. RT-PCR and cellulase secretion assays showed that the Tn5-disruption of hrcQ did not affect transcription of downstream genes in the D operon and function of the type II secretion system. Our results provide new insights into the pathogenic

Cadmium accumulation characteristics of low-cadmium rice (Oryza sativa L.) line and F1 hybrids grown in cadmium-contaminated soils.

Science.gov (United States)

Li, Kun; Yu, Haiying; Li, Tingxuan; Chen, Guangdeng; Huang, Fu

2017-07-01

Cadmium (Cd) pollution has threatened severely to food safety and human health. A pot experiment and a field experiment were conducted to investigate the difference of Cd accumulation between rice (Oryza sativa L.) lines and F 1 hybrids in Cd-contaminated soils. The adverse effect on biomass of rice lines was greater than that of F 1 hybrids under Cd treatments in the pot experiment. The variations of Cd concentration among rice cultivars in different organs were smaller in stem and leaf, but larger in root and ear. Average proportion of Cd in root of F 1 hybrids was 1.39, 1.39, and 1.16 times higher than those of rice lines at the treatment of 1, 2, and 4 mg Cd kg -1 soil, respectively. Cd concentrations in ear of F 1 hybrids were significantly lower than rice lines with the reduction from 29.24 to 50.59%. Cd concentrations in brown rice of all F 1 hybrids were less than 0.2 mg kg -1 at 1 mg Cd kg -1 soil, in which Lu98A/YaHui2816, 5406A/YaHui2816, and C268A/YaHui2816 could be screened out as cadmium-safe cultivars (CSCs) for being safe even at 2 mg Cd kg -1 soil. C268A/YaHui2816 showed the lowest Cd concentration in root among F 1 hybrids, while Lu98A/YaHui2816 and 5406A/YaHui2816 showed lower capability of Cd translocation from root to shoot under Cd exposure, which eventually caused the lower Cd accumulation in brown rice. The lower level of Cd translocation contributed to reducing the accumulation of Cd in brown rice had been validated by the field experiment. Thus, Lu98A/YaHui2816, 5406A/YaHui2816, and C268A/YaHui2816 could be considered as potential CSCs to cultivate in Cd-contaminated soils (<2 mg Cd kg -1 soil).

Analysis of nucleotide diversity among alleles of the major bacterial blight resistance gene Xa27 in cultivars of rice (Oryza sativa) and its wild relatives.

Science.gov (United States)

Bimolata, Waikhom; Kumar, Anirudh; Sundaram, Raman Meenakshi; Laha, Gouri Shankar; Qureshi, Insaf Ahmed; Reddy, Gajjala Ashok; Ghazi, Irfan Ahmad

2013-08-01

Xa27 is one of the important R-genes, effective against bacterial blight disease of rice caused by Xanthomonas oryzae pv. oryzae (Xoo). Using natural population of Oryza, we analyzed the sequence variation in the functionally important domains of Xa27 across the Oryza species. DNA sequences of Xa27 alleles from 27 rice accessions revealed higher nucleotide diversity among the reported R-genes of rice. Sequence polymorphism analysis revealed synonymous and non-synonymous mutations in addition to a number of InDels in non-coding regions of the gene. High sequence variation was observed in the promoter region including the 5'UTR with 'π' value 0.00916 and 'θ w ' = 0.01785. Comparative analysis of the identified Xa27 alleles with that of IRBB27 and IR24 indicated the operation of both positive selection (Ka/Ks > 1) and neutral selection (Ka/Ks ≈ 0). The genetic distances of alleles of the gene from Oryza nivara were nearer to IRBB27 as compared to IR24. We also found the presence of conserved and null UPT (upregulated by transcriptional activator) box in the isolated alleles. Considerable amino acid polymorphism was localized in the trans-membrane domain for which the functional significance is yet to be elucidated. However, the absence of functional UPT box in all the alleles except IRBB27 suggests the maintenance of single resistant allele throughout the natural population.

Genetic, physiological and modelling approaches towards tolerance to salinity and low nitrogen supply in rice (Oryza sativa L.)

NARCIS (Netherlands)

Manneh, B.

2004-01-01

Keywords:   Rice, O ryza sativa , yield potential, yield gap, salinity, nitrogen supply, agro-ecosystems, Recombinant Inbred Line, genotype × environment interaction, yield components, adaptability, molecular markers, QTL, biomass, leaf area, leaf N, dry matter

Modification of Sorghum Starch-Cellulose Bioplastic with Sorghum Stalks Filler

Directory of Open Access Journals (Sweden)

Yuli Darni

2017-05-01

Full Text Available This study evaluated the feasibility of bioplastics production by various ratio of sorghum starch and cellulose from red seaweed Eucheuma spinossum, and the use of glycerol as plasticizer and sorghum stalks as filler. Solid-liquid matrix transition should be far over the operating temperature of gelatinization and extracted at 95oC in order to avoid the loss of conductivity. The analyzed variables were starch and cellulose seaweed Eucheuma spinossum and the addition of variation of filler. Sorghum stalk could be expected to affect the mechanical and physical properties of bioplastics. A thin sheet of plastic (plastic film was obtained as a result that have been tested mechanically to obtain the best condition for the formulation of starch-cellulose 8.5:1.5 (g/g. From the result of morphological studies, the fillers in the mixture composites were more randomly in each product and the addition of filler can increase mechanical properties of bioplastics. Chemical modification had a major effect on the mechanical properties. The phenomena of degradation and thermoplasticization were visible at chemical changes that can be observed in FTIR spectrum test results.

Assessment of genetic diversity of Xanthomonas oryzae pv. oryzae

Institute of Scientific and Technical Information of China (English)

无

2000-01-01

@@Bacterial blight of rice, caused by Xanthomonas oryzae pv. Oryzae(Xoo. ), is one of the major rice diseases in China. Making clear the shift of genetic diversity of the pathogen will provide important information for rice breeding. Strains collected from 11 provinces located in Southern region of the Changjiang River in China were assessed by using inoculation method and IS-PCR(Insertion Sequence-Based Polymerase Chain Reaction) analysis.

Pengaruh Pemberian Kompos Jerami Dan Pupuk Sp-36 Pada Tanah Sulfat Masam Potensial Terhadap Perubahan Sifat Kimia Serta Pertumbuhan Dan Produksi Padi (Oriza Sativa L.)

OpenAIRE

Bhakari, Herlina Eka; Fauzi, Fauzi; Hanum, Hamidah

2013-01-01

The objective of this research was to study the effect of rice straw compost and the application ofphosphorus fertilizer of SP-36 on chemical characteristic of acid sulphate soils, rice growth andproduction (Oryza sativa L). This research was conducted in greenhouse agricultural departments,Universities Northen Sumatera, Medan. This study used a randomized block design factorial, with2 factors : factor 1 : rice straw compost treatment (J) wich consist of : J0 = 0 ton ha-1(0 g straw/pot); J1 =...

Maturation curves of sweet sorghum genotypes

Directory of Open Access Journals (Sweden)

Renan Silva e Souza

2016-02-01

Full Text Available ABSTRACT Sweet sorghum [Sorghum bicolor (L. Moench] stands out as a complementary crop to sugarcane Saccharum spp. for the production of ethanol, since it has juicy stems with directly fermentable sugars. Due to this fact, there is a need for the analysis of sweet sorghum properties in order to meet the agro-industry demand. This work aimed to develop and study the maturation curves of seven sweet sorghum cultivars in ten harvest dates. The results showed a significant difference between cultivars and harvest dates for all parameters analysed (p≤0.01. Regarding the sugar content, the cultivars BRS508, XBWS80147 and CMSX629 showed the highest means for the total reducing sugars (TRS and recoverable sugar (RS. In the production of ethanol per tonne of biomass (EP, the cultivars BRS508 and CMSX629 presented the best results.

Oryza sativa

Indian Academy of Sciences (India)

2014-04-25

Apr 25, 2014 ... Gaps (marked with dashes) have been introduced to ..... Genomi-wide association study of flowering time and grain yield traits in a worldwide ... stages of programmed cell death in maize root cells by using comet assay and ...

SILAGE QUALITY OF CORN AND SORGHUM ADDED WITH FORAGE PEANUTS

Directory of Open Access Journals (Sweden)

WALKÍRIA GUIMARÃES CARVALHO

2016-01-01

Full Text Available Corn and sorghum are standard silage crops because of their fermentative characteristics. While corn and sorghum silages have lower crude protein (CP contents than other crops, intercropping with legumes can increase CP content. Furthermore, one way to increase CP content is the addition of legumes to silage. Consequently, the research objective was to evaluate the fermentative and bromatological characteristics of corn (Zea mays and sorghum (Sorghum bicolor silages added with forage peanuts (Arachis pintoi. The experimental design was completely randomized with four replicates. The treatments consisted of corn silage, sorghum silage, forage peanut silage, corn silage with 30% forage peanut, and sorghum silage with 30% forage peanut. The results showed that the corn and sorghum added with peanut helped to improve the silage fermentative and bromatological characteristics, proving to be an efficient technique for silage quality. The forage peanut silage had lower fermentative characteristics than the corn and sorghum silages. However, the forage peanut silage had a greater CP content, which increased the protein contents of the corn and sorghum silages when intercropped with forage peanuts.

AcEST: DK957741 [AcEST

Lifescience Database Archive (English)

Full Text Available yza sativa subs... 148 3e-34 tr|A2Y2K9|A2Y2K9_ORYSI Putative uncharacterized protein OS=Oryza... 148 3e-34 t...70 SALLKIDVPLMFIGDDASPGL 190 >tr|A2Y2K9|A2Y2K9_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp.

Main: 1EQK [RPSD[Archive

Lifescience Database Archive (English)

Full Text Available 1EQK イネ Rice Oryza sativa L. Cysteine Proteinase Inhibitor-I Oryza Sativa Molecule: Oryzacystatin-I; Chai...n: A; Engineered: Yes Hydrolase Inhibitor K.Nagata, N.Kudo, K.Abe, S.Arai, M.Tanokura ...K.Nagata, N.Kudo, K.Abe, S.Arai, M.Tanokura Three-Dimensional Solution Structure Of Oryzacystatin-I, A Cyste

Influences of nitrogen and potassium top dressing on yield and yield ...

African Journals Online (AJOL)

STORAGESEVER

2010-05-03

May 3, 2010 ... (K) top dressing on grain yield and yield components of rice (Oryza sativa cv. Tarrom) and to ... positive reciprocal effect on crops, and was an important approach in ..... dressing fertilization (Figures 2a, b and c), but nitrogen levels of upper fully .... (Brassica napus L.)–rice (Oryza sativa L.) rotation. Plant Soil ...

Mapping and characterisation of the sorghum cell suspension ...

African Journals Online (AJOL)

Here we reported the first secretomic study of sorghum (Sorghum bicolor), a naturally drought tolerant cereal crop. In this study, we used a gel-based proteomic approach in combination with mass spectrometry to separate and identify proteins secreted into the culture medium of sorghum cell suspensions, a first step ...

Sweet Sorghum Crop. Effect of the Compost Application

International Nuclear Information System (INIS)

Negro, M. J.; Solano, M. L.; Carrasco, J.; Ciria, P.

1998-01-01

A 3 year-plot experiments were performed to determined the possible persistence of the positive effects of treating soil with compost. For this purpose, a sweet sorghum bagasse compost has been used. Experiments were achieved with sweet sorghum (Sorghum bicolor. L. Moench) vr Dale as energy crop. Similar sorghum productivities were obtained both in plots with consecutive compost applications and in plots amended with mineral fertilizers. No residual effect after three years has been detected. It could be due to the low dose of compost application. (Author) 27 refs

A rare sugar, d-allose, confers resistance to rice bacterial blight with upregulation of defense-related genes in Oryza sativa.

Science.gov (United States)

Kano, Akihito; Gomi, Kenji; Yamasaki-Kokudo, Yumiko; Satoh, Masaru; Fukumoto, Takeshi; Ohtani, Kouhei; Tajima, Shigeyuki; Izumori, Ken; Tanaka, Keiji; Ishida, Yutaka; Tada, Yasuomi; Nishizawa, Yoko; Akimitsu, Kazuya

2010-01-01

We investigated responses of rice plant to three rare sugars, d-altrose, d-sorbose, and d-allose, due to establishment of mass production methods for these rare sugars. Root growth and shoot growth were significantly inhibited by d-allose but not by the other rare sugars. A large-scale gene expression analysis using a rice microarray revealed that d-allose treatment causes a high upregulation of many defense-related, pathogenesis-related (PR) protein genes in rice. The PR protein genes were not upregulated by other rare sugars. Furthermore, d-allose treatment of rice plants conferred limited resistance of the rice against the pathogen Xanthomonas oryzae pv. oryzae but the other tested sugars did not. These results indicate that d-allose has a growth inhibitory effect but might prove to be a candidate elicitor for reducing disease development in rice.

Novel storage technologies for raw and clarified syrup biomass feedstocks from sweet sorghum (Sorghum bicolor L. Moench)

Science.gov (United States)

Attention is currently focused on developing sustainable supply chains of sugar feedstocks for new, flexible biorefineries. Fundamental processing needs identified by industry for the large-scale manufacture of biofuels and bioproducts from sweet sorghum (Sorghum bicolor L. Moench) include stabiliz...

Root uptake of 14C leached from the low-level radioactive waste for sub-surface disposal with engineered barriers by Oryza sativa L. (2). Distribution of 14C in rice plant on the case using acetic acid as 14C-source

International Nuclear Information System (INIS)

Suzuki, Hiroyuki; Ishii, Nobuyoshi; Tagami, Keiko; Uchida, Shigeo

2012-01-01

The behavior of 14 C from radioactive waste in paddy rice (Oryza sativa L.) at different stages of plant development was studied using the hydroponic and acetic acid as 14 C-source. For 14 C-application, plant root was soaked for 2 hours in a nutrient solution containing 14 C-acetic acid at the vegetative growth stage (Aug. 2, 2007), heading (flowering) stage (Aug. 30, 2007) and milk-ripe stage (Sep. 13, 2007). In final sampling day (Mar. 5, 2008), 0.88 - 1.96% of the applied radioactivity was recovered from whole plant, however, the ratio of recovered radioactivity was not different at the growth stage. The distribution of 14 C absorbed at each stage to each organ was noted to be highest in the submersed root through all the stages. Therefore the mixing of the root residue at the time of plowing would result in enhancement of the soil persistence of 14 C. (author)

Morphological responses of forage sorghums to salinity and ...

African Journals Online (AJOL)

The response of forage sorghum [Sorghum bicolor (L.) Moench] varieties to salinity and irrigation frequency were studied from December 2007 to December 2009. Two forage sorghum varieties (Speedfeed and KFS4) were grown under salinity levels of 0, 5, 10 and 15 dS m-1 and irrigated when the leaf water potential ...

Effects of timing and severity of salinity stress on rice (Oryza sativa L.) yield, grain composition, and starch functionality.

Science.gov (United States)

Thitisaksakul, Maysaya; Tananuwong, Kanitha; Shoemaker, Charles F; Chun, Areum; Tanadul, Orn-u-ma; Labavitch, John M; Beckles, Diane M

2015-03-04

The aim of this work was to examine agronomic, compositional, and functional changes in rice (Oryza sativa L. cv. Nipponbare) grains from plants grown under low-to-moderate salinity stress in the greenhouse. Plants were grown in sodium chloride-containing soil (2 or 4 dS/m(2) electrical conductivity), which was imposed 4-weeks after transplant (called Seedling EC2 and EC4) or after the appearance of the anthers (called Anthesis EC2 and EC4). The former simulates field conditions while the latter permits observation of the isolated effect of salt on grain filling processes. Key findings of this study are the following: (i) Plants showed adaptive responses to prolonged salt treatment with no negative effects on grain weight or fertility. Seedling EC2 plants had more panicles and enhanced caryopsis dimensions, while surprisingly, Seedling EC4 plants did not differ from the control group in the agronomic parameters measured. (ii) Grain starch increased in Seedling EC4 (32.6%) and Anthesis EC2 (39%), respectively, suggesting a stimulatory effect of salt on starch accumulation. (iii) The salinity treatment of 2 dS/m(2) was better tolerated at anthesis than the 4 dS/m(2) treatment as the latter led to reduced grain weight (28.8%) and seed fertility (19.4%) and compensatory increases in protein (20.1%) and nitrogen (19.8%) contents. (iv) Although some salinity treatments led to changes in starch content, these did not alter starch fine structure, morphology, or composition. We observed no differences in reducing sugar and amylose content or starch granule size distribution among any of the treatments. The only alterations in starch were limited to small changes in thermal properties and glucan chain distribution, which were only seen in the Anthesis EC4 treatment. This similarity of compositional and functional features was supported by multivariate analysis of all variables measured, which suggested that differences due to treatments were minimal. Overall, this study

Authenticity of rice (Oryza sativa L.) geographical origin based on analysis of C, N, O and S stable isotope ratios: a preliminary case report in Korea, China and Philippine.

Science.gov (United States)

Chung, Ill-Min; Kim, Jae-Kwang; Prabakaran, Mayakrishnan; Yang, Jin-Hee; Kim, Seung-Hyun

2016-05-01

Although rice (Oryza sativa L.) is the third largest food crop, relatively fewer studies have been reported on rice geographical origin based on light element isotope ratios in comparison with other foods such as wine, beef, juice, oil and milk. Therefore this study tries to discriminate the geographical origin of the same rice cultivars grown in different Asian countries using the analysis of C, N, O and S stable isotope ratios and chemometrics. The δ(15) NAIR , δ(18) OVSMOW and δ(34) SVCDT values of brown rice were more markedly influenced by geographical origin than was the δ(13) CVPDB value. In particular, the combination of δ(18) OVSMOW and δ(34) SVCDT more efficiently discriminated rice geographical origin than did the remaining combinations. Principal component analysis (PCA) revealed a clear discrimination between different rice geographical origins but not between rice genotypes. In particular, the first components of PCA discriminated rice cultivated in the Philippines from rice cultivated in China and Korea. The present findings suggest that analysis of the light element isotope composition combined with chemometrics can be potentially applicable to discriminate rice geographical origin and also may provide a valuable insight into the control of improper or fraudulent labeling regarding the geographical origin of rice worldwide. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.

The Sorghum bicolor genome and the diversification of grasses

Energy Technology Data Exchange (ETDEWEB)

Paterson, Andrew H.; Bowers, John E.; Bruggmann, Remy; dubchak, Inna; Grimwood, Jane; Gundlach, Heidrun; Haberer, Georg; Hellsten, Uffe; Mitros, Therese; Poliakov, Alexander; Schmutz, Jeremy; Spannagl, Manuel; Tang, Haibo; Wang, Xiyin; Wicker, Thomas; Bharti, Arvind K.; Chapman, Jarrod; Feltus, F. Alex; Gowik, Udo; Grigoriev, Igor V.; Lyons, Eric; Maher, Christopher A.; Martis, Mihaela; Marechania, Apurva; Otillar, Robert P.; Penning, Bryan W.; Salamov, Asaf. A.; Wang, Yu; Zhang, Lifang; Carpita, Nicholas C.; Freeling, Michael; Gingle, Alan R.; hash, C. Thomas; Keller, Beat; Klein, Patricia; Kresovich, Stephen; McCann, Maureen C.; Ming, Ray; Peterson, Daniel G.; ur-Rahman, Mehboob-; Ware, Doreen; Westhoff, Peter; Mayer, Klaus F. X.; Messing, Joachim; Rokhsar, Daniel S.

2008-08-20

Sorghum, an African grass related to sugar cane and maize, is grown for food, feed, fibre and fuel. We present an initial analysis of the approx730-megabase Sorghum bicolor (L.) Moench genome, placing approx98percent of genes in their chromosomal context using whole-genome shotgun sequence validated by genetic, physical and syntenic information. Genetic recombination is largely confined to about one-third of the sorghum genome with gene order and density similar to those of rice. Retrotransposon accumulation in recombinationally recalcitrant heterochromatin explains the approx75percent larger genome size of sorghum compared with rice. Although gene and repetitive DNA distributions have been preserved since palaeopolyploidization approx70 million years ago, most duplicated gene sets lost one member before the sorghum rice divergence. Concerted evolution makes one duplicated chromosomal segment appear to be only a few million years old. About 24percent of genes are grass-specific and 7percent are sorghum-specific. Recent gene and microRNA duplications may contribute to sorghum's drought tolerance.

Agronomic and morphological performance of sorghum (sorghum ...

African Journals Online (AJOL)

SARAH

2013-03-30

Mar 30, 2013 ... occasional frost limits growth and seed set of un- adapted cultivars (Arkel, 1979) making seed multiplication of un-adapted varieties unsuccessful. Previous studies have shown that sorghum cultivars adapted to high altitude, low rainfall areas. Journal of Applied Biosciences 63: 4720 – 4726. ISSN 1997– ...

Rim 2/Hipa CACTA transposon display ; A new genetic marker technique in Oryza species

Directory of Open Access Journals (Sweden)

Lee Ju

2005-03-01

Full Text Available Abstract Background Transposons constitute the major fractions of repetitive sequences in eukaryotes, and have been crucial in the shaping of current genomes. Transposons are generally divided into two classes according to the mechanism underlying their transposition: RNA intermediate class 1 and DNA intermediate class 2. CACTA is a class 2 transposon superfamily, which is found exclusively in plants. As some transposons, including the CACTA superfamily, are highly abundant in plant species, and their nucleotide sequences are highly conserved within a family, they can be utilized as genetic markers, using a slightly modified version of the conventional AFLP protocol. Rim2 /Hipa is a CACTA transposon family having 16 bp consensus TIR sequences to be present in high copy numbers in rice genome. This research was carried out in order to develop a Rim2/Hipa CACTA-AFLP or Rim2/Hipa CACTA-TD (transposon display, hereafter Rim2/Hipa-TD protocol for the study of genetic markers in map construction and the study of genetic diversity in rice. Results Rim2/Hipa-TD generated ample polymorphic profiles among the different rice accessions, and the amplification profiles were highly reproducible between different thermocyclers and Taq polymerases. These amplification profiles allowed for clear distinction between two different ecotypes, Japonica and Indica, of Oryza sativa. In the analysis of RIL populations, the Rim2/Hipa-TD markers were found to be segregated largely in a dominant manner, although in a few cases, non-parental bands were observed in the segregating populations. Upon linkage analysis, the Rim2/Hipa-TD markers were found to be distributed in the regions proximal to the centromeres of the chromosomes. The distribution of the Rim2/Hipa CACTA elements was surveyed in 15 different Oryza species via Rim2/Hipa-TD. While Rim2/Hipa-TD yielded ample amplification profiles between 100 to 700 bp in the AA diploid Oryza species, other species having BB, CC

Assessment of Genetic Variability in Sorghum Accessions (Sorghum ...

African Journals Online (AJOL)

ADOWIE PERE

The polymorphic information content (PIC) of individual primer ranged from 0.34 to 0.70 with a mean value of 0.54 indicating enough ... Keywords: Sorghum; Simple Sequence Repeat markers; Genetic variation; Polymorphic Information Content;. Coefficient of ... based techniques include Restriction Fragment Length.

Productivity and Competitiveness of Sorghum Production in ...

African Journals Online (AJOL)

showed that sorghum production in the study areas yielded profitable returns ... Keywords: Sorghum, Profitability, Competitiveness, Investment Potential, .... Guinness Ghana Brewery Limited to estimate cost and returns at the marketing sector ...

Bio-protective microbial agents from rhizosphere eco-systems trigger plant defense responses provide protection against sheath blight disease in rice (Oryza sativa L.).

Science.gov (United States)

Singh, Udai B; Malviya, Deepti; Wasiullah; Singh, Shailendra; Pradhan, Jatindra K; Singh, Bhanu P; Roy, Manish; Imram, Mohd; Pathak, Neelam; Baisyal, B M; Rai, Jai P; Sarma, B K; Singh, Rajiv K; Sharma, P K; Kaur, Saman Deep; Manna, M C; Sharma, Sushil K; Sharma, Arun K

2016-11-01

Sheath blight of rice (Oryza sativa L.) caused by Rhizoctonia solani is a major disease and attempts are being made to develop microbe based technologies for biocontrol of this pathogen. However, the mechanisms of biocontrol are not fully understood and still require indepth study in the backdrop of emerging concepts in biological systems. The present investigation was aimed at deciphering the mechanisms of biocontrol of sheath blight of rice employing Pseudomonas fluorescens and Trichoderma harzianum as model agents for biocontrol. Initially 25, 5 and 5 strains of P. fluorescens, T. viride and T. harzianum, respectively, were screened for their biocontrol potential. Out of which, six strains with higher value of percent inhibition of fungal mycelium in dual plate assay were selected. The role of P. fluorescens, T. viride and T. harzianum were investigated in induction and bioaccumulation of natural antioxidants, defence-related biomolecules and other changes in plant which lead not only to growth promotion but also protection from pathogenic stress conditions in rice. The two most promising strains, P. fluorescens PF-08 and T. harzianum UBSTH-501 selected on the basis of in planta evaluation, when applied individually or in combination, significantly enhanced the accumulation of defence-related biomolecules, enzymes and exhibited biocontrol potential against R. solani. A modified/newly developed delivery system was applied for the first time in the experiments involving inoculation of plants with both bioagents, viz. P. fluorescens PF-08 and T. harzianum UBSTH-501. Results suggested that application of P. fluorescens PF-08 and T. harzianum UBSTH-501 alone or in combination, not only helps in control of the disease but also increases plant growth along with reduction in application of toxic chemical pesticides. Copyright © 2016 Elsevier GmbH. All rights reserved.

A model explaining genotypic and ontogenetic variation of leaf photosynthetic rate in rice (Oryza sativa) based on leaf nitrogen content and stomatal conductance.

Science.gov (United States)

Ohsumi, Akihiro; Hamasaki, Akihiro; Nakagawa, Hiroshi; Yoshida, Hiroe; Shiraiwa, Tatsuhiko; Horie, Takeshi

2007-02-01

Identification of physiological traits associated with leaf photosynthetic rate (Pn) is important for improving potential productivity of rice (Oryza sativa). The objectives of this study were to develop a model which can explain genotypic variation and ontogenetic change of Pn in rice under optimal conditions as a function of leaf nitrogen content per unit area (N) and stomatal conductance (g(s)), and to quantify the effects of interaction between N and g(s) on the variation of Pn. Pn, N and g(s) were measured at different developmental stages for the topmost fully expanded leaves in ten rice genotypes with diverse backgrounds grown in pots (2002) and in the field (2001 and 2002). A model of Pn that accounts for carboxylation and CO diffusion processes, and assumes that the ratio of internal conductance to g(s) is constant, was constructed, and its goodness of fit was examined. Considerable genotypic differences in Pn were evident for rice throughout development in both the pot and field experiments. The genotypic variation of Pn was correlated with that of g(s) at a given stage, and the change of Pn with plant development was closely related to the change of N. The variation of g(s) among genotypes was independent of that of N. The model explained well the variation in Pn of the ten genotypes grown under different conditions at different developmental stages. Conclusions The response of Pn to increased N differs with g(s), and the increase in Pn of genotypes with low g(s) is smaller than that of genotypes with high g(s). Therefore, simultaneous improvements of these two traits are essential for an effective breeding of rice genotypes with increased Pn.

A sorghum (Sorghum bicolor mutant with altered carbon isotope ratio.

Directory of Open Access Journals (Sweden)

Govinda Rizal

Full Text Available Recent efforts to engineer C4 photosynthetic traits into C3 plants such as rice demand an understanding of the genetic elements that enable C4 plants to outperform C3 plants. As a part of the C4 Rice Consortium's efforts to identify genes needed to support C4 photosynthesis, EMS mutagenized sorghum populations were generated and screened to identify genes that cause a loss of C4 function. Stable carbon isotope ratio (δ13C of leaf dry matter has been used to distinguishspecies with C3 and C4 photosynthetic pathways. Here, we report the identification of a sorghum (Sorghum bicolor mutant with a low δ13C characteristic. A mutant (named Mut33 with a pale phenotype and stunted growth was identified from an EMS treated sorghum M2 population. The stable carbon isotope analysis of the mutants showed a decrease of 13C uptake capacity. The noise of random mutation was reduced by crossing the mutant and its wildtype (WT. The back-cross (BC1F1 progenies were like the WT parent in terms of 13C values and plant phenotypes. All the BC1F2 plants with low δ13C died before they produced their 6th leaf. Gas exchange measurements of the low δ13C sorghum mutants showed a higher CO2 compensation point (25.24 μmol CO2.mol-1air and the maximum rate of photosynthesis was less than 5μmol.m-2.s-1. To identify the genetic determinant of this trait, four DNA pools were isolated; two each from normal and low δ13C BC1F2 mutant plants. These were sequenced using an Illumina platform. Comparison of allele frequency of the single nucleotide polymorphisms (SNPs between the pools with contrasting phenotype showed that a locus in Chromosome 10 between 57,941,104 and 59,985,708 bps had an allele frequency of 1. There were 211 mutations and 37 genes in the locus, out of which mutations in 9 genes showed non-synonymous changes. This finding is expected to contribute to future research on the identification of the causal factor differentiating C4 from C3 species that can be used

Genetic Diversity and Phenotypic Variation in an Introgression Line Population Derived from an Interspecific Cross between Oryza glaberrima and Oryza sativa.

Directory of Open Access Journals (Sweden)

Caijin Chen

Full Text Available The introduction of closely related species genomic fragments is an effective way to enrich genetic diversity and creates new germplasms in crops. Here, we studied the genetic diversity of an introgression line (IL population composed of 106 ILs derived from an interspecific tetra cross between O. glaberrima and O. sativa (RAM3/Jin23B//Jin23B///YuetaiB. The proportion of O. glaberrima genome (PGG in the ILs ranged from 0.3% to 36.7%, with an average value of 12.32% which is close to the theoretically expected proportion. A total of 250 polymorphic alleles were amplified by 21 AFLP primer combinations with an average of 12 alleles per primer. Population structure analysis revealed that the IL population can be divided into four genetically distinct subpopulations. Both principal component analysis and neighbor-joining tree analysis showed that ILs with a higher PGG displayed greater genetic diversity. Canonical discriminant analysis identified six phenotypic traits (plant height, yield per plant, filled grain percentage, panicle length, panicle number and days to flowering as the main discriminatory traits among the ILs and between the subpopulations and showed significant phenotypic distances between subpopulations. The effects of PGG on phenotypic traits in the ILs were estimated using a linear admixed model, which showed a significant positive effect on grain yield per plant (0.286±0.117, plant height (0.418 ± 0.132, panicle length (0.663 ± 0.107, and spikelet number per panicle (0.339 ± 0.128, and a significant negative effect on filled grain percentage (-0.267 ± 0.123 and days to flowering (-0.324 ± 0.075. We found that an intermediate range (10% - 20% of PGG was more effective for producing ILs with favorable integrated agronomic traits. Our results confirm that construction of IL population carrying O. glaberrima genomic fragments could be an effective approach to increase the genetic diversity of O. sativa genome and an appropriate

Determination of supplier-to-supplier and lot-to-lot variability in glycation of recombinant human serum albumin expressed in Oryza sativa.

Directory of Open Access Journals (Sweden)

Grant E Frahm

Full Text Available The use of different expression systems to produce the same recombinant human protein can result in expression-dependent chemical modifications (CMs leading to variability of structure, stability and immunogenicity. Of particular interest are recombinant human proteins expressed in plant-based systems, which have shown particularly high CM variability. In studies presented here, recombinant human serum albumins (rHSA produced in Oryza sativa (Asian rice (OsrHSA from a number of suppliers have been extensively characterized and compared to plasma-derived HSA (pHSA and rHSA expressed in yeast (Pichia pastoris and Saccharomyces cerevisiae. The heterogeneity of each sample was evaluated using size exclusion chromatography (SEC, reversed-phase high-performance liquid chromatography (RP-HPLC and capillary electrophoresis (CE. Modifications of the samples were identified by liquid chromatography-mass spectrometry (LC-MS. The secondary and tertiary structure of the albumin samples were assessed with far U/V circular dichroism spectropolarimetry (far U/V CD and fluorescence spectroscopy, respectively. Far U/V CD and fluorescence analyses were also used to assess thermal stability and drug binding. High molecular weight aggregates in OsrHSA samples were detected with SEC and supplier-to-supplier variability and, more critically, lot-to-lot variability in one manufactures supplied products were identified. LC-MS analysis identified a greater number of hexose-glycated arginine and lysine residues on OsrHSA compared to pHSA or rHSA expressed in yeast. This analysis also showed supplier-to-supplier and lot-to-lot variability in the degree of glycation at specific lysine and arginine residues for OsrHSA. Both the number of glycated residues and the degree of glycation correlated positively with the quantity of non-monomeric species and the chromatographic profiles of the samples. Tertiary structural changes were observed for most OsrHSA samples which

The productive potentials of sweet sorghum ethanol in China

International Nuclear Information System (INIS)

Zhang, Caixia; Xie, Gaodi; Li, Shimei; Ge, Liqiang; He, Tingting

2010-01-01

As one of the important non-grain energy crops, sweet sorghum has attracted the attention of scientific community and decision makers of the world since decades. But insufficient study has been done about the spatial suitability distribution and ethanol potential of sweet sorghum in China. This paper attempts to probe into the spatial distribution and ethanol potential of sweet sorghum in China by ArcGIS methods. Data used for the analysis include the spatial data of climate, soil, topography and land use, and literatures relevant for sweet sorghum studies. The results show that although sweet sorghum can be planted in the majority of lands in China, the suitable unused lands for large-scale planting (unit area not less than 100 hm 2 ) are only as much as 78.6 x 10 4 hm 2 ; and the productive potentials of ethanol from these lands are 157.1 x 10 4 -294.6 x 10 4 t/year, which can only meet 24.8-46.4% of current demand for E10 (gasoline mixed with 10% ethanol) in China (assumption of the energy efficiency of E10 is equivalent to that of pure petroleum). If all the common grain sorghum at present were replaced by sweet sorghum, the average ethanol yield of 244.0 x 10 4 t/year can be added, and thus the productive potentials of sweet sorghum ethanol can satisfy 63.2-84.9% of current demand for E10 of China. In general, Heilongjiang, Jilin, Inner Mongolia and Liaoning rank the highest in productive potentials of sweet sorghum ethanol, followed by Hebei, Shanxi, Sichuan, and some other provinces. It is suggested that these regions should be regarded as the priority development zones for sweet sorghum ethanol in China.

Genetic diversity in sorghum transpiration efficiency

Science.gov (United States)

Sorghum is the fifth most important grain crop and is becoming increasingly important as a biofuel feedstock due to its superior tolerance to water deficit stress. Sorghum is commonly grown under rain-fed conditions in the Southern Plains and other semi-arid regions in the world. Thus, its product...

Chemical control of wild sorghum (sorghum arundinaceum Del. Stapf. in faba bean (vicia faba L.) in the Northern State of Sudan

International Nuclear Information System (INIS)

Bedry, K. A. M.; Elamin, A. E. M.

2011-01-01

An experiment was conducted at Merowe Research Station farm, in the Northern State, Sudan, during 2008/2009 and 2009/2010 seasons. The objectives of the experiment were to determine the damage inflicted by a wild sorghum species (Sorghum arundinaceum (Del.) Stapf. ) on the yield of faba bean (Vicia faba L.) and to evaluate the efficacy of the post-emergence herbicide clodinafop-propargyl (Topik) on wild sorghum and its effect on faba bean yield. The wild sorghum reduced faba bean crop stand and straw and seed yields by 53% - 76%, 76% - 79% and 88% - 91%, respectively, compared with the hand-weeded control. Faba bean was tolerant to the herbicide. The herbicide, at all rates, effected complete (100%) and persistent control of the wild sorghum and resulted in faba bean seed yield comparable to the hand-weeded control. The lowest dose (0.075 kg a.i/ha) of the herbicide used was equal to 75% of the dose recommended for the control of wild sorghum in wheat. It is concluded that clodinafop-propargyl at 0.075 kg a.e/ha could be used in controlling wild sorghum in faba bean. At this rate, the marginal rate of return was about 35 which indicating that every monetary unit (SDG 1) invested in the mentioned treatment would be returned back, plus additional amount of 35 SDG.(Author)

sativa L.) Cultivars

African Journals Online (AJOL)

Abstract. Ten rice cultivars from the International Rice Germplasm Centre originating from Bangladesh were analysedfor the~r genetics of resistance to bacterial blight. The test cultivars were selected on the basis of their high level ofresistance to races IV & VI ofXanthomonas oryzae pv. oryzae. The mode ofinheri- tance was ...

Pyramiding of blast and bacterial leaf blight resistance genes into ...

African Journals Online (AJOL)

Blast caused by the fungus Magnaporthe oryzae (Hebert) Barr. and bacterial leaf blight (BLB) caused by Xanthomonas oryzae pv. oryzae (Xoo) are two major diseases of rice (Oryza sativa). The use of varietal resistance is the most appropriate strategy for controlling the diseases, and molecular assisted selection can ...

The defense-responsive genes showing enhanced and repressed expression after pathogen infection in rice (Oryza sativa L.)

Institute of Scientific and Technical Information of China (English)

ZHOU; Bin(周斌); PENG; Kaiman(彭开蔓); CHU; Zhaohui(储昭晖); WANG; Shiping(王石平); ZHANG; Qifa(张启发)

2002-01-01

Despite large numbers of studies about defense response, processes involved in the resistance of plants to incompatible pathogens are still largely uncharacterized. The objective of this study was to identify genes involved in defense response by cDNA array analysis and to gain knowledge about the functions of the genes involved in defense response. Approximately 20000 rice cDNA clones were arrayed on nylon filters. RNA samples isolated from different rice lines after infection with incompatible strains or isolates of Xanthomonas oryzae pv. oryzae or Pyricularia grisea, respectively, were used to synthesize cDNA as probes for screening the cDNA arrays. A total of 100 differentially expressed unique sequences were identified from 5 pathogen-host combinations. Fifty-three sequences were detected as showing enhanced expression and 47 sequences were detected as showing repressed expression after pathogen infection. Sequence analysis revealed that most of the 100 sequences had various degrees of homology with genes in databases which encode or putatively encode transcription regulating proteins, translation regulating proteins, transport proteins, kinases, metabolic enzymes, and proteins involved in other functions. Most of the genes have not been previously reported as being involved in the disease resistance response in rice. The results from cDNA arrays, reverse transcription-polymerase chain reaction, and RNA gel blot analysis suggest that activation or repression of most of these genes might occur commonly in the defense response.

Inheritance of Resistance to Sorghum Shoot Fly, Atherigona soccata in Sorghum, Sorghum bicolor (L. Moench

Directory of Open Access Journals (Sweden)

Mohammed eRiyazaddin

2016-04-01

Full Text Available Host plant resistance is one of the major components to control sorghum shoot fly, Atherigona soccata. To understand the nature of gene action for inheritance of shoot fly resistance, we evaluated 10 parents, 45 F1’s and their reciprocals in replicated trials during the rainy and postrainy seasons. Genotypes ICSV 700, Phule Anuradha, ICSV 25019, PS 35805, IS 2123, IS 2146 and IS 18551 exhibited resistance to shoot fly damage across seasons. Crosses between susceptible parents were preferred for egg laying by the shoot fly females, resulting in a susceptible reaction. ICSV 700, ICSV 25019, PS 35805, IS 2123, IS 2146 and IS 18551 exhibited significant and negative general combining ability (gca effects for oviposition, deadheart incidence, and overall resistance score. The plant morphological traits associated with expression of resistance/ susceptibility to shoot fly damage such as leaf glossiness, plant vigor, and leafsheath pigmentation also showed significant gca effects by these genotypes, suggesting the potential for use as a selection criterion to breed for resistance to shoot fly, A. soccata. ICSV 700, Phule Anuradha, IS 2146 and IS 18551 with significant positive gca effects for trichome density can also be utilised in improving sorghums for shoot fly resistance. The parents involved in hybrids with negative specific combining ability (sca effects for shoot fly resistance traits can be used in developing sorghum hybrids with adaptation to postrainy season. The significant reciprocal effects of combining abilities for oviposition, leaf glossy score and trichome density suggested the influence of cytoplasmic factors in inheritance of shoot fly resistance. Higher values of variance due to sca (σ2s, dominance variance (σ2d, and lower predictability ratios than the variance due to gca (σ2g and additive variance (σ2a for shoot fly resistance traits indicated the predominance of dominance type of gene action, whereas trichome density, leaf

7339 BASELINE SURVEY ON FACTORS AFFECTING SORGHUM ...

African Journals Online (AJOL)

muuicathy

2013-01-01

Jan 1, 2013 ... factors affecting sorghum production and the sorghum farming ... The informal seed system includes methods such as retaining seed on-farm from ..... Jaetzold R and H Schmidt Farm Management Handbook of Kenya, Ministry.

Bioactive spirans and other constituents from the leaves of Cannabis sativa f. sativa.

Science.gov (United States)

Guo, Tian-Tian; Zhang, Jian-Chun; Zhang, Hai; Liu, Qing-Chao; Zhao, Yong; Hou, Yu-Fei; Bai, Lu; Zhang, Li; Liu, Xue-Qiang; Liu, Xue-Ying; Zhang, Sheng-Yong; Bai, Nai-Sheng

2017-08-01

In this paper, 17 compounds (1-17) were isolated from the leaves of Hemp (Cannabis sativa f. sativa). Among the isolates, two were determined to be new spirans: cannabispirketal (1), and α-cannabispiranol 4'-O-β-D-glucopyranose (2) by 1D and 2D NMR spectroscopy, LC-MS, and HRESIMS. The known compounds 7, 8, 10, 13, 15, and 16 were isolated from Hemp (C. sativa f. sativa) for the first time. Furthermore, compounds 8 and 13 were isolated from the nature for the first time. All isolated compounds were evaluated for cytotoxicity on different tissue-derived passage cancer cell lines through cell viability and apoptosis assay. Among these compounds, compounds 5, 9 and 16 exhibited a broad-spectrum antitumor effect via inhibiting cell proliferation and promoting apoptosis. These results obtained have provided valuable clues to the understanding of the cytotoxic profile for these isolated compounds from Hemp (C. sativa f. sativa).

Effects of Sorghum [Sorghum bicolor (L. Moench] Crude Extracts on Starch Digestibility, Estimated Glycemic Index (EGI, and Resistant Starch (RS Contents of Porridges

Directory of Open Access Journals (Sweden)

Dilek Lemlioglu-Austin

2012-09-01

Full Text Available Bran extracts (70% aqueous acetone of specialty sorghum varieties (tannin, black, and black with tannin were used to investigate the effects of sorghum phenolic compounds on starch digestibility, Estimated Glycemic Index (EGI, and Resistant Starch (RS of porridges made with normal corn starch, enzyme resistant high amylose corn starch, and ground whole sorghum flours. Porridges were cooked with bran extracts in a Rapid Visco-analyser (RVA. The cooking trials indicated that bran extracts of phenolic-rich sorghum varieties significantly reduced EGI, and increased RS contents of porridges. Thus, there could be potential health benefits associated with the incorporation of phenolic-rich sorghum bran extracts into foods to slow starch digestion and increase RS content.

Genetic architecture of kernel composition in global sorghum germplasm

Science.gov (United States)

Sorghum [Sorghum bicolor (L.) Moench] is an important cereal crop for dryland areas in the United States and for small-holder farmers in Africa. Natural variation of sorghum grain composition (protein, fat, and starch) between accessions can be used for crop improvement, but the genetic controls are...

De novo transcriptome assembly of Sorghum bicolor variety Taejin

Directory of Open Access Journals (Sweden)

Yeonhwa Jo

2016-06-01

Full Text Available Sorghum (Sorghum bicolor, also known as great millet, is one of the most popular cultivated grass species in the world. Sorghum is frequently consumed as food for humans and animals as well as used for ethanol production. In this study, we conducted de novo transcriptome assembly for sorghum variety Taejin by next-generation sequencing, obtaining 8.748 GB of raw data. The raw data in this study can be available in NCBI SRA database with accession number of SRX1715644. Using the Trinity program, we identified 222,161 transcripts from sorghum variety Taejin. We further predicted coding regions within the assembled transcripts by the TransDecoder program, resulting in a total of 148,531 proteins. We carried out BLASTP against the Swiss-Prot protein sequence database to annotate the functions of the identified proteins. To our knowledge, this is the first transcriptome data for a sorghum variety derived from Korea, and it can be usefully applied to the generation of genetic markers.

Coordination of Leaf Photosynthesis, Transpiration, and Structural Traits in Rice and Wild Relatives (Genus Oryza).

Science.gov (United States)

Giuliani, Rita; Koteyeva, Nuria; Voznesenskaya, Elena; Evans, Marc A; Cousins, Asaph B; Edwards, Gerald E

2013-07-01

The genus Oryza, which includes rice (Oryza sativa and Oryza glaberrima) and wild relatives, is a useful genus to study leaf properties in order to identify structural features that control CO(2) access to chloroplasts, photosynthesis, water use efficiency, and drought tolerance. Traits, 26 structural and 17 functional, associated with photosynthesis and transpiration were quantified on 24 accessions (representatives of 17 species and eight genomes). Hypotheses of associations within, and between, structure, photosynthesis, and transpiration were tested. Two main clusters of positively interrelated leaf traits were identified: in the first cluster were structural features, leaf thickness (Thick(leaf)), mesophyll (M) cell surface area exposed to intercellular air space per unit of leaf surface area (S(mes)), and M cell size; a second group included functional traits, net photosynthetic rate, transpiration rate, M conductance to CO(2) diffusion (g(m)), stomatal conductance to gas diffusion (g(s)), and the g(m)/g(s) ratio.While net photosynthetic rate was positively correlated with gm, neither was significantly linked with any individual structural traits. The results suggest that changes in gm depend on covariations of multiple leaf (S(mes)) and M cell (including cell wall thickness) structural traits. There was an inverse relationship between Thick(leaf) and transpiration rate and a significant positive association between Thick(leaf) and leaf transpiration efficiency. Interestingly, high g(m) together with high g(m)/g(s) and a low S(mes)/g(m) ratio (M resistance to CO(2) diffusion per unit of cell surface area exposed to intercellular air space) appear to be ideal for supporting leaf photosynthesis while preserving water; in addition, thick M cell walls may be beneficial for plant drought tolerance.

Transcriptomic Analysis and the Expression of Disease-Resistant Genes in Oryza meyeriana under Native Condition.

Directory of Open Access Journals (Sweden)

Bin He

Full Text Available Oryza meyeriana (O. meyeriana, with a GG genome type (2n = 24, accumulated plentiful excellent characteristics with respect to resistance to many diseases such as rice shade and blast, even immunity to bacterial blight. It is very important to know if the diseases-resistant genes exist and express in this wild rice under native conditions. However, limited genomic or transcriptomic data of O. meyeriana are currently available. In this study, we present the first comprehensive characterization of the O. meyeriana transcriptome using RNA-seq and obtained 185,323 contigs with an average length of 1,692 bp and an N50 of 2,391 bp. Through differential expression analysis, it was found that there were most tissue-specifically expressed genes in roots, and next to stems and leaves. By similarity search against protein databases, 146,450 had at least a significant alignment to existed gene models. Comparison with the Oryza sativa (japonica-type Nipponbare and indica-type 93-11 genomes revealed that 13% of the O. meyeriana contigs had not been detected in O. sativa. Many diseases-resistant genes, such as bacterial blight resistant, blast resistant, rust resistant, fusarium resistant, cyst nematode resistant and downy mildew gene, were mined from the transcriptomic database. There are two kinds of rice bacterial blight-resistant genes (Xa1 and Xa26 differentially or specifically expressed in O. meyeriana. The 4 Xa1 contigs were all only expressed in root, while three of Xa26 contigs have the highest expression level in leaves, two of Xa26 contigs have the highest expression profile in stems and one of Xa26 contigs was expressed dominantly in roots. The transcriptomic database of O. meyeriana has been constructed and many diseases-resistant genes were found to express under native condition, which provides a foundation for future discovery of a number of novel genes and provides a basis for studying the molecular mechanisms associated with disease

A Sorghum bicolor expression atlas reveals dynamic genotype-specific expression profiles for vegetative tissues of grain, sweet and bioenergy sorghums

Energy Technology Data Exchange (ETDEWEB)

Shakoor, N; Nair, R; Crasta, O; Morris, G; Feltus, A; Kresovich, S

2014-01-23

Background: Effective improvement in sorghum crop development necessitates a genomics-based approach to identify functional genes and QTLs. Sequenced in 2009, a comprehensive annotation of the sorghum genome and the development of functional genomics resources is key to enable the discovery and deployment of regulatory and metabolic genes and gene networks for crop improvement. Results: This study utilizes the first commercially available whole-transcriptome sorghum microarray (Sorgh-WTa520972F) to identify tissue and genotype-specific expression patterns for all identified Sorghum bicolor exons and UTRs. The genechip contains 1,026,373 probes covering 149,182 exons (27,577 genes) across the Sorghum bicolor nuclear, chloroplast, and mitochondrial genomes. Specific probesets were also included for putative non-coding RNAs that may play a role in gene regulation (e. g., microRNAs), and confirmed functional small RNAs in related species (maize and sugarcane) were also included in our array design. We generated expression data for 78 samples with a combination of four different tissue types (shoot, root, leaf and stem), two dissected stem tissues (pith and rind) and six diverse genotypes, which included 6 public sorghum lines (R159, Atlas, Fremont, PI152611, AR2400 and PI455230) representing grain, sweet, forage, and high biomass ideotypes. Conclusions: Here we present a summary of the microarray dataset, including analysis of tissue-specific gene expression profiles and associated expression profiles of relevant metabolic pathways. With an aim to enable identification and functional characterization of genes in sorghum, this expression atlas presents a new and valuable resource to the research community.

Biological and water-use efficiencies of sorghum-groundnut intercrop

African Journals Online (AJOL)

In order to compare water-use efficiency of sole crops and intercrops, 2 experiments were conducted in 2 consecutive years with sorghum (Sorghum bicolor L. Moench) and groundnut (Arachis hypogaea L.) on a loamy, Grossarenic Paleudult. In a randomized block, split-plot design, sorghum (SS), groundnut (GG), ...

Pengujian Parameter Biji Sorghum dan Pengaruh Analisa Total Asam Laktat dan pH pada Tepung Sorghum Terfermentasi Menggunakan Baker’s Yeast (Saccharomyces Cereviceae

Directory of Open Access Journals (Sweden)

Amelinda Angelina

2013-09-01

Full Text Available Sorghum, Sorghum bicolor (L Moench, adalah sereal paling penting kelima setelah beras, jagung, barley dan gandum. Hasil penelitian menunjukkan bahwa kemampuan substitusi biji sorghum terhadap tepung terigu bisa mencapai 50-75%, walaupun nilai protein pembentuk glutennya tidak dapat menyamai tepung terigu. Tujuan dari penelitian ini adalah mempelajari pengaruh waktu fermentasi terhadap penurunan total asam laktat, nilai pH, dan jumlah total khamir (baker’s yeast tanpa menggunakan nutrient kimia tambahan . Analisa komposisi biji sorghum yang diinvestigasi dalam keadaan wet basis dari laboratorium menghasilkan kadar air, lemak, serat, protein, karbohidrat, dan abu masing-masing sebesar 12.85%, 3.10%, 0.56%, 5.87%, 75.82%, dan 1.79%. Untuk nilai energi total dengan metode bomb kalori didapatkan 4375.94 kcal/kg. Pengujian biji sorghum menghasilkan C-organik sebesar 12,47%. Berdasarkan analisa didapatkan hasil optimal dalam membuat tepung sorghum terfermentasi pada proses fermentasi 60 jam dengan jumlah yeast yang dihasilkan 1,7 x 105 sel/ml dengan kondisi yield % asam laktat 0,214%.

Isolation and characterization of a Ds-tagged rice (Oryza sativa L.) GA-responsive dwarf mutant defective in an early step of the gibberellin biosynthesis pathway.

Science.gov (United States)

Margis-Pinheiro, Marcia; Zhou, Xue-Rong; Zhu, Qian-Hao; Dennis, Elizabeth S; Upadhyaya, Narayana M

2005-03-01

We have isolated a severe dwarf transposon (Ds) insertion mutant in rice (Oryza sativa L.), which could be differentiated early in the seedling stage by reduced shoot growth and dark green leaves, and later by severe dwarfism and failure to initiate flowering. These mutants, however, showed normal seed germination and root growth. One of the sequences flanking Ds, rescued from the mutant, was of a chromosome 4-located putative ent-kaurene synthase (KS) gene, encoding the enzyme catalyzing the second step of the gibberellin (GA) biosynthesis pathway. Dwarf mutants were always homozygous for this Ds insertion and no normal plants homozygous for this mutation were recovered in the segregating progeny, indicating that the Ds insertion mutation is recessive. As mutations in three recently reported rice GA-responsive dwarf mutant alleles and the dwarf mutation identified in this study mapped to the same locus, we designate the corresponding gene OsKS1. The osks1 mutant seedlings were responsive to exogenous gibberellin (GA3). OsKS1 transcripts of about 2.3 kb were detected in leaves and stem of wild-type plants, but not in germinating seeds or roots, suggesting that OsKS1 is not involved in germination or root growth. There are at least five OsKS1-like genes in the rice genome, four of which are also represented in rice expressed sequence tag (EST) databases. All OsKS1-like genes are transcribed with different expression patterns. ESTs corresponding to all six OsKS genes are represented in other cereal databases including barley, wheat and maize, suggesting that they are biologically active.

Polihidroxialcanoatos de cepas de Azospirillum spp. aisladas de raíces de Lycopersicon esculentum Mill. “tomate” y Oryza sativa L. “arroz” en Lambayeque

Directory of Open Access Journals (Sweden)

Katty Baca

2010-01-01

Full Text Available En este trabajo se determinó la concentración de polihidroxialcanoatos (PH As de cepas de Azospirillum aisladas de raíces de Lycopersicon esculentum Mill. “tomate” y Oryza sativa L. “arroz”, como una alternativa ante la acumulación de plásticos derivados del petróleo. R aíces previamente desinfectadas se sembraron en medio Nfb se misólido, donde las bacterias fijadoras de nitrógeno se reconocieron por una película blanquecina bajo la superficie y el viraje del indicador al azul. El género Azospirillum se identificó en medio rojo de Congo, obteniéndose 96 cepas de A. lipoferum y A. brasilense en tomate y arroz. Se realizó una fermentación discontinua con caldo Azotobacter modificado, alimentando con una solución saturada de ácido málico cada 12 horas y se realizaron tinciones con Sudán Negro B. Se seleccionaron las cepas con mayor nú mero de gránulos de PHAs (en tomate , 18 de A. lipoferum y 2 de A. brasilense y en arroz, 10 de A. lipoferum y 10 de A. brasilense y se cuantificó la biomasa y PHAs. La concentración de PHAs alcanzó 0 . 661 gL - 1 en A. lipoferum KM(T - 73 y 0 . 738 gL - 1 en A. br asilense KM(T - 19. Las cepas de A. lipoferum y A. brasilense aisladas de tomate alcanzaron una mayor concentración de biomasa y PHAs frente a las cepas aisladas de arroz.

microRNAs targeting DEAD-box helicases are involved in salinity stress response in rice (Oryza sativa L.

Directory of Open Access Journals (Sweden)

Macovei Anca

2012-10-01

Full Text Available Abstract Background Rice (Oryza sativa L., one of the most important food crop in the world, is considered to be a salt-sensitive crop. Excess levels of salt adversely affect all the major metabolic activities, including cell wall damage, cytoplasmic lysis and genomic stability. In order to cope with salt stress, plants have evolved high degrees of developmental plasticity, including adaptation via cascades of molecular networks and changes in gene expression profiles. Posttranscriptional regulation, through the activity of microRNAs, also plays an important role in the plant response to salinity conditions. MicroRNAs are small endogenous RNAs that modulate gene expression and are involved in the most essential physiological processes, including plant development and adaptation to environmental changes. Results In the present study, we investigated the expression profiles of osa-MIR414, osa-MIR408 and osa-MIR164e along with their targeted genes, under salinity stress conditions in wild type and transgenic rice plants ectopically expressing the PDH45 (Pea DNA Helicase gene. The present miRNAs were predicted to target the OsABP (ATP-Binding Protein, OsDSHCT (DOB1/SK12/helY-like DEAD-box Helicase and OsDBH (DEAD-Box Helicase genes, included in the DEAD-box helicase family. An in silico characterization of the proteins was performed and the miRNAs predicted targets were validated by RLM-5′RACE. The qRT-PCR analysis showed that the OsABP, OsDBH and OsDSHCT genes were up-regulated in response to 100 and 200 mM NaCl treatments. The present study also highlighted an increased accumulation of the gene transcripts in wild type plants, with the exception of the OsABP mRNA which showed the highest level (15.1-fold change compared to control in the transgenic plants treated with 200 mM NaCl. Salinity treatments also affected the expression of osa-MIR414, osa-MIR164e and osa-MIR408, found to be significantly down-regulated, although the changes in mi

Optimization of extraction of polyphenols from Sorghum Moench ...

African Journals Online (AJOL)

phenolic acid were assayed using high performance liquid (HPLC). ... quantification of antioxidants and phenolic compounds from Sorghum M, ... Keywords: Response surface methodology, Sorghum moench, Polyphenols, Antioxidants.

Peculiarities in covering the requirements for seed material of sorghum crops

Directory of Open Access Journals (Sweden)

С. І. Мельник

2017-12-01

Full Text Available Purpose. To assess the demand for sorghum seed material and sufficiency of domestic seeds. Results. The analysis of the State register for the period of 2002–2012 showed that there was the tendency not only towards increasing quantity of sorghum crops in general but their substitution by hybrids of foreign breeding. During the period from 2002 to 2017, 72 sorghum varieties were entered on the State register in total, among them only 12 varieties were of domestic breeding, the rest 60 was presented by foreign breeding institutions. Investigation results allowed to determine that the production of base and prebase seeds of sorghum in 2010 amounted to 1,3 t, in 2016 was 43 t. During the same period the production of sugar sorghum increased from 0,2 to 12,0 t, grass sorghum – from 4,0 to 83 t. In 2017, requirements of acreage of such crops as grass sorghum and broomcorn were completely satisfied by the amount of grown seeds. At the same time, the need for seeds of sorghum and sugar sorghum can not be covered completely at the expense of domestic varieties reproduction. In 2017, general demand for sorghum seeds was 400,5 t, among which only 42,0 t was of domestic production. The rest demand for seeds will be met at the expense of import of foreign breeding seeds into the country to be grown and prepared for sowing abroad. Conclusions. In the Register of plant varieties suitable for dissemination in Ukraine, there are 72 sorghum varieties among them only 12 varieties were of domestic breeding, that is 17%, as compared to 83% of recommended great sorghum varieties of foreign breeding. In Ukraine, the area occupied by sorghum cultivation was 22,8 thou ha in 2005, up to 2017 it increased to 89,0 thou ha, and accordingly the demand for seeds run up from 102,6 to 400,5 t. The area occupied by the sugar sorghum in 2005 amounted to only 2,6 thou ha, in 2017 – 20,0 thou ha, that accordingly determined increase of demand for seed material from 13,0 to 99

Kajian Sifat Kimia Tanah, Pertumbuhan dan Produksi Padi (Oryiza sativa L.) Pada Tanah Sulfat Masam Potensial Akibat Pemberian Kompos Tandan Kosong Kelapa Sawit dan Pupuk SP-36

OpenAIRE

Tambunan, Sri Wahyuni

2013-01-01

This research aims to compost give effect empty palm bunch studies and fertilizer SP-36 to improve chemistry characteristic, growing and rice production (Oryza sativa L.) in acidic sulfate soil. This research was conducted in greenhouse agricultural departments, universities northern Sumatra, Medan. This study used a randomized block design (RAK) factorial, with 2 factors: factor 1: compost TKS treatment factor (B) are : B0 = 0 ton ha-1 (0 g TKS/pot) ; B1 = 10 ton ha-1 (40 g TKS/pot); B2 = 20...

The Perennial Ryegrass GenomeZipper: Targeted Use of Genome Resources for Comparative Grass Genomics1[C][W

Science.gov (United States)

Pfeifer, Matthias; Martis, Mihaela; Asp, Torben; Mayer, Klaus F.X.; Lübberstedt, Thomas; Byrne, Stephen; Frei, Ursula; Studer, Bruno

2013-01-01

Whole-genome sequences established for model and major crop species constitute a key resource for advanced genomic research. For outbreeding forage and turf grass species like ryegrasses (Lolium spp.), such resources have yet to be developed. Here, we present a model of the perennial ryegrass (Lolium perenne) genome on the basis of conserved synteny to barley (Hordeum vulgare) and the model grass genome Brachypodium (Brachypodium distachyon) as well as rice (Oryza sativa) and sorghum (Sorghum bicolor). A transcriptome-based genetic linkage map of perennial ryegrass served as a scaffold to establish the chromosomal arrangement of syntenic genes from model grass species. This scaffold revealed a high degree of synteny and macrocollinearity and was then utilized to anchor a collection of perennial ryegrass genes in silico to their predicted genome positions. This resulted in the unambiguous assignment of 3,315 out of 8,876 previously unmapped genes to the respective chromosomes. In total, the GenomeZipper incorporates 4,035 conserved grass gene loci, which were used for the first genome-wide sequence divergence analysis between perennial ryegrass, barley, Brachypodium, rice, and sorghum. The perennial ryegrass GenomeZipper is an ordered, information-rich genome scaffold, facilitating map-based cloning and genome assembly in perennial ryegrass and closely related Poaceae species. It also represents a milestone in describing synteny between perennial ryegrass and fully sequenced model grass genomes, thereby increasing our understanding of genome organization and evolution in the most important temperate forage and turf grass species. PMID:23184232

The perennial ryegrass GenomeZipper: targeted use of genome resources for comparative grass genomics.

Science.gov (United States)

Pfeifer, Matthias; Martis, Mihaela; Asp, Torben; Mayer, Klaus F X; Lübberstedt, Thomas; Byrne, Stephen; Frei, Ursula; Studer, Bruno

2013-02-01

Whole-genome sequences established for model and major crop species constitute a key resource for advanced genomic research. For outbreeding forage and turf grass species like ryegrasses (Lolium spp.), such resources have yet to be developed. Here, we present a model of the perennial ryegrass (Lolium perenne) genome on the basis of conserved synteny to barley (Hordeum vulgare) and the model grass genome Brachypodium (Brachypodium distachyon) as well as rice (Oryza sativa) and sorghum (Sorghum bicolor). A transcriptome-based genetic linkage map of perennial ryegrass served as a scaffold to establish the chromosomal arrangement of syntenic genes from model grass species. This scaffold revealed a high degree of synteny and macrocollinearity and was then utilized to anchor a collection of perennial ryegrass genes in silico to their predicted genome positions. This resulted in the unambiguous assignment of 3,315 out of 8,876 previously unmapped genes to the respective chromosomes. In total, the GenomeZipper incorporates 4,035 conserved grass gene loci, which were used for the first genome-wide sequence divergence analysis between perennial ryegrass, barley, Brachypodium, rice, and sorghum. The perennial ryegrass GenomeZipper is an ordered, information-rich genome scaffold, facilitating map-based cloning and genome assembly in perennial ryegrass and closely related Poaceae species. It also represents a milestone in describing synteny between perennial ryegrass and fully sequenced model grass genomes, thereby increasing our understanding of genome organization and evolution in the most important temperate forage and turf grass species.

Enhanced ethanol production from stalk juice of sweet sorghum by ...

African Journals Online (AJOL)

user

2012-03-15

Mar 15, 2012 ... Sweet sorghum (sugar sorghum, Sorghum bicolor) is one kind of non-grain energy ... government that only ''non-grain” materials can be used ... In this work, ... inoculated (10%, v/v) into fermentation medium prepared with the.

Enhanced UV-B radiation has little effect on growth, delta13C values and pigments of pot-grown rice (Oryza sativa) in the field

International Nuclear Information System (INIS)

Kim, H.Y.; Kobayashi, K.; Nouchi, I.; Yoneyama, T.

1996-01-01

Predicted increase in ultraviolet-B (UV-B: 280–320 mn) radiation may have adverse impacts on growth and yield of rice (Oryza sativa L.), as has been found in studies hitherto. However, most of the studies were conducted in growth chambers or greenhouses where the plants are generally more sensitive to UV-B than in the field, presumably because of the distorted balance between UV-B and ultraviolet-A as well as PAR. This study was conducted to address the effects of enhanced UV-B on growth and yield of rice under a realistic spectral balance in the field. Three cultivars, “Koshihikari”,‘IR 45’and‘IR 74’were pot-grown and irradiated with enhanced UV-B for most of the growing season in the field at Tsukuba, Japan (36°01′N, 140°07′E). The UV-B enhancement simulated ca 38% depletion of stratospheric ozone at Tsukuba. The results showed no UV-B effects on plant height, numbers of tillers and panicles, dry weight of the plant parts or the grain yield for any of the 3 cultivars. Natural abundance of 13 C in the flag leaves was not altered by the UV-B enhancement either. While UV-absorbing compounds showed no response to the UV-B enhancement, chlorophyll contents decreased with enhanced UV-B. However, the decrease of chlorophyll was limited to an early growth stage with no effect later. We thus found no extraordinary impact of the nearly doubled UV-B radiation on rice in the field, and it would appear that a reliable prediction of the effects of UV-B will require experiments carried out over a number of years under various climatic and solar UV-B regimes. (author)

Effect of Fungicide Applications on Grain Sorghum (Sorghum bicolor L. Growth and Yield

Directory of Open Access Journals (Sweden)

Dan D. Fromme

2017-01-01

Full Text Available Field studies were conducted in the upper Texas Gulf Coast and in central Louisiana during the 2013 through 2015 growing seasons to evaluate the effects of fungicides on grain sorghum growth and development when disease pressure was low or nonexistent. Azoxystrobin and flutriafol at 1.0 L/ha and pyraclostrobin at 0.78 L/ha were applied to the plants of two grain sorghum hybrids (DKS 54-00, DKS 53-67 at 25% bloom and compared with the nontreated check for leaf chlorophyll content, leaf temperature, and plant lodging during the growing season as well as grain mold, test weight, yield, and nitrogen and protein content of the harvested grain. The application of a fungicide had no effect on any of the variables tested with grain sorghum hybrid responses noted. DKS 53-67 produced higher yield, greater test weight, higher percent protein, and N than DKS 54-00. Results of this study indicate that the application of a fungicide when little or no disease is present does not promote overall plant health or increase yield.

Next-generation sequencing technology for genetics and genomics of sorghum

DEFF Research Database (Denmark)

Luo, Hong; Mocoeur, Anne Raymonde Joelle; Jing, Hai-Chun

2014-01-01

and grain sorghum. NGS has also been used to examine the transcriptomes of sorghum under various stress conditions. Besides identifying interesting transcriptonal adpatation to stress conditions, these study show that sugar could potentially act as an osmitic adjusting factor via transcriptional regulation....... Furthermore, miRNAs are found to be important adaptation to both biotic and abiotic stresses in sorghum. We discuss the use of NGS for further genetic improvement and breeding in sorghum....

The effect of cover crop and crop rotation on soil water storage and on sorghum yield Efeito de cultura de cobertura e de rotação de cultura no armazenamento de água do solo e no rendimento de sorgo

Directory of Open Access Journals (Sweden)

Demóstenes Marcos Pedrosa de Azevedo

1999-03-01

Full Text Available Crop rotation and cover crop can be important means for enhancing crop yield in rainfed areas such as the lower Coastal Bend Region of Texas, USA. A trial was conducted in 1995 as part of a long-term cropping experiment (7 years to investigate the effect of oat (Avena sativa L. cover and rotation on soil water storage and yield of sorghum (Sorghum bicolor L.. The trial design was a RCB in a split-plot arrangement with four replicates. Rotation sequences were the main plots and oat cover crop the subplots. Cover crop reduced sorghum grain yield. This effect was attributed to a reduced concentration of available soil N and less soil water storage under this treatment. By delaying cover termination, the residue with a high C/N acted as an N sink through competition and/or immobilization instead of an N source to sorghum plants. Crop rotation had a significantly positive effect on sorghum yield and this effect was attributed to a significantly larger amount of N concentration under these rotation sequences.Rotação de cultura e cultura de cobertura constituem importantes meios para melhoria do rendimento de culturas em áreas de sequeiro como a região "Coastal Bend" do Estado do Texas. Um ensaio foi conduzido em 1995, como parte de um experimento de longa duração (7 anos, com o objetivo de investigar o efeito da aveia (Avena sativa L. como cultura de cobertura, e da rotação de cultura, no armazenamento da água do solo e no rendimento do sorgo (Sorghum bicolor L.. O delineamento experimental adotado foi o de blocos ao acaso, em parcelas subdivididas, com quatro repetições. As rotações foram alocadas nas parcelas, e a cultura de cobertura, nas subparcelas. A cultura de cobertura reduziu o rendimento do sorgo. Este efeito foi atribuído à reduzida concentração de N disponível do solo. Por atraso no extermínio e incorporação da aveia, seu resíduo, com elevada relação C/N, atuou como dreno, pela imobilização, em lugar de ser fonte

Nutrient and carbohydrate partitioning in sorghum stover

International Nuclear Information System (INIS)

Powell, J.M.; Hons, F.M.; McBee, G.G.

1991-01-01

Sorghum [Sorghum bicolor (L.) Moench] stover has been demonstrated to be a potential biomass energy source. Complete aboveground crop removal, however, can result in soil degradation. Differential dry matter, nutrient, and carbohydrate partitioning by sorghum cultivars may allow management strategies that return certain parts to the field while removing other portions for alternative uses, such as energy production. A field study was conducted to determine N,P,K, nonstructural carbohydrate, cellulose hemicellulose, and lignin distributions in stover of three diverse sorghum cultivars of differing harvest indices. Determinations were based on total vegetative biomass; total blades; total stalks; and upper middle, and lower blades and stalks. Concentrations of N and P were higher in blades than stalks and generally declines from upper to lower stover parts. Large carbohydrate and lignin concentration differences were observed on the basis of cultivar and stover part. Greater nutrient partitioning to the upper third of the intermediate and forage-type sorghum stovers was observed as compared to the conventional grain cultivar. Stover carbohydrates for all cultivars were mainly contained in the lower two-thirds of the stalk fraction. A system was proposed for returning upper stover portion to soil, while removing remaining portions for alternative uses

Tapping the US sweet sorghum collection to identify biofuel germplasm

Science.gov (United States)

The narrow genetic base in sweet sorghum [Sorghum bicolor (L.) Moench] breeding programs is limiting the development of new varieties for biofuel production. Therefore, the identification of genetically diverse sweet sorghum germplasm in the U.S. National Plant Germplasm System (NPGS) collection is...

Combining ability and mode of inheritance of stem thickness in forage sorghum (Sorghum bicolor L. Moench F1 hybrids

Directory of Open Access Journals (Sweden)

Pataki Imre

2011-01-01

Full Text Available Aim of this research was determination of mode of inheritance, gene effects components of genetic variance, combining abilities, average contribution of lines and testers and their interactions in expression of stem thickness in forage sorghum F1 generation. Method line x tester was applied. Material comprised of eight genetically divergent A-inbred lines of grain sorghum three R lines-testers of Sudan grass and twenty-four F1 hybrids obtained by crossing lines with testers. Among tested genotypes there were significant differences in mean values of stem thickness. Analysis of variance of combining abilities showed that there were highly significant differences for general combining abilities (GCA and specific combining abilities (SCA non-additive component of genetic variance (dominance and epistasis had greater portion in total genetic variance for stem thickness. During the first research year, interaction between inbred maternal line with testers had the largest contribution in expression of stem thickness of F1 hybrid at both locations, while in the second year at location Rimski Šančevi the largest contribution belongs to lines and at location Mačvanski Prnjavor the largest contribution belongs to testers. Assessment of combining abilities showed that these inbred lines of grain sorghum can be used as mothers: SS-1 646, SS-1 688 and S-8 682 in breeding forage sorghum for thicker stem. According to SCA, promising forage sorghum hybrids are S-8 682 x ST-R lin H and P-21 656 x C-198. This research can be of importance for developing new high-yielding forage sorghum hybrids.

An investigative study of indigenous sweet sorghum varieties for bioethanol production: the case of Kenya local sorghum varieties

Energy Technology Data Exchange (ETDEWEB)

Wangai, L.K.; Mbeo, C.O. [Kenya Industrial Research and Development Inst., Nairobi (Kenya); Kamau, C.K. [Kenya Agricurtural Research Inst.(s), Machakos (Kenya)

2012-11-01

There are over 500 sorghum genotypes grown locally in Kenya. This study was an investigation and selection of suitable sorghum genotypes for sustainable bio-ethanol production in Kenya. For the study, 500 genotypes of sorghum were planted and grown using the recommended agricultural practices. Random sampling of 230 genotypes was done and the samples analysed for juice and sugar content. The 26 best yielding genotypes were selected and grown again in duplicate for further detailed study. Data on date of flowering, pest resistance, {sup 0}brix, wet and dry weight, plant population, ratooning, grain yield and juice yield and juice sugar content were recorded and analyzed using GENstat. Sampling was done for each genotype when about 50% of the crop had flowered and there after, every 2 weeks until the grains dried. Crushing was done with a three roller mill crusher [8]. The sugar content was measured using a digital refractometer. Sugar yield obtained ranged between 10.3{sup 0}Brix and 19.3{sup 0}Brix and juice yield between 268 litres/hectare and 11390 litres/hectare. Five indigenous sorghum varieties, GBK-007130, GBK-007076, GBK-007102, GBK-007296, GBK-007098 were found to have the highest sugar and juice yields and were considered the most suitable sweet sorghum genotypes among those studied, for bio-ethanol production in Kenya.

Study of radio-restoration by various mineral salts and silice wich products (Tuf and Pouzzolane) of rice embryos (oryza-sativa L, Cigalon variety) exposed to cobalt 60 gamma rays

International Nuclear Information System (INIS)

Mouthia-Khadija.

1981-12-01

Mutagenic treatments produce a large number of mutants per unit time and are used for plant improvement. However these treatments cause damage to cells. To counteract this radio-induced damage 2 methods are being tried: - Protection, which consists in the supply of an active product before application of mutagenic agents; - Restoration, which tries to repair the damage after mutagenic treatment. This work is devoted to restoration processes. Technique for the isolation and culture on a suitable nutrient of rice embryos (oryza sativa L, Cigalon variety) separated from non-irradiated caryopses were developed first. By separating out the embryo in this way it is possible to study in vitro the interactions between the embryo and the rest of the caryopsis (albumin + pericarp). The effects of radiations on embryos from caryopses exposed to cobalt 60 gamma rays were measured next, then the action of certain inorganic elements contained in the caryopsis tissues was analysed. On the basis of the first results obtained the differences in response between plantlets from embryos irradiated or otherwise treated or not either by zinc sulphate or by very silice-rich volcanic products (Tuf and Pouzzolane), were examined by chemical analysis techniques. These tests have allowed the detection of ionic changes induced by irradiation during the different stages of plant development and led to a better estimate of the radio-restoration mechanisms brought about by the various chemical compounds used [fr

In Vitro Screening for Drought Tolerance in Different Sorghum (Sorghum bicolor (L. Moench Varieties

Directory of Open Access Journals (Sweden)

Yohannes Tsago

2013-08-01

Full Text Available Drought is one of the complex environmental factors affecting growth and yield of sorghum in arid and semi-arid areas of the world. Sixteen elite sorghum (Sorghum bicolor (L Moench genotypes were evaluated for their genetic potential to drought tolerance at callus induction and plant regeneration stage for drought tolerance. The non-ionic water soluble polymer polyethylene glycol (PEG of molecular weight 6000 was used as osmoticum to simulate water stress. The factorial experiment was laid down in a completely randomized design which comprised of a combination of two factors (genotypes and five PEG stress level; 0, 0.5, 1.0, 1.5, and 2.0% (w/v treatments. Data were recorded for callus induction efficiency, callus fresh weight, embryogenic callus percentage and plant regeneration percentage. Significant differences were observed among the genotypes, treatments and their interactions for the evaluated plant traits suggesting a great amount of variability for drought tolerance in sorghum. The correlation analysis also revealed strong and significant association between embryogenic callus percent and plant regeneration percent as well as between embryogenic callus percent and plant regeneration percent. By taking into consideration all the measured traits, Mann Whitney rank sum test revealed that 76T1#23 and Teshale followed by Meko, Gambella-1107 and Melkam showed better drought stress tolerance. Therefore they are recommended to be used as parents for genetic analysis, gene mapping and improvement of drought tolerance while Chelenko, Hormat and Raya appear to be drought sensitive.

Structure and chemistry of the sorghum grain

Science.gov (United States)

Sorghum is grown around the world and often under harsh and variable environmental conditions. Combined with the high degree of genetic diversity present in sorghum, this can result in substantial variability in grain composition and grain quality. While similar to other cereal grains such as maize ...

EVALUATION OF TWO VARIETIES OF SORGHUM FOR STARCH EXTRACTION

Directory of Open Access Journals (Sweden)

Leyanis Rodríguez Rodríguez

2015-01-01

Full Text Available In Cuba, the wet milling process for the extraction of starch is made from corn, cereal which is currently imported, that is why it is required to substitute it for another grain of national production as it is the case of sorghum. Given the similarities of the two grains in their starch content and considering the potential of sorghum for the food industry, it is developed in this work an assessment process, taking into account two sorghum varieties: red (CIAPR-132 and white (UDG-110. In this sense, a factorial design of the type 2k-1 is made, where the independent variables of most influence in the laboratory process are considered, such as: (x1 type of sorghum, (x2 soaking time and (x3 solution concentration. It is considered that there is no interaction between them and it is taken as the response variable the starch yield in the extraction process. We conclude that the type of sorghum and soaking time are the most influential variables, obtaining the best results for white sorghum subjected for 48 hours to soak in a solution of SO2 at a concentration of 1800 ppm.

Performance of Sorghum Varieties under Variable Rainfall in Central Tanzania.

Science.gov (United States)

Msongaleli, Barnabas M; Tumbo, S D; Kihupi, N I; Rwehumbiza, Filbert B

2017-01-01

Rainfall variability has a significant impact on crop production with manifestations in frequent crop failure in semiarid areas. This study used the parameterized APSIM crop model to investigate how rainfall variability may affect yields of improved sorghum varieties based on long-term historical rainfall and projected climate. Analyses of historical rainfall indicate a mix of nonsignificant and significant trends on the onset, cessation, and length of the growing season. The study confirmed that rainfall variability indeed affects yields of improved sorghum varieties. Further analyses of simulated sorghum yields based on seasonal rainfall distribution indicate the concurrence of lower grain yields with the 10-day dry spells during the cropping season. Simulation results for future sorghum response, however, show that impacts of rainfall variability on sorghum will be overridden by temperature increase. We conclude that, in the event where harms imposed by moisture stress in the study area are not abated, even improved sorghum varieties are likely to perform poorly.

Proteomic analysis of seed storage proteins in wild rice species of the Oryza genus.

Science.gov (United States)

Jiang, Chunmiao; Cheng, Zaiquan; Zhang, Cheng; Yu, Tengqiong; Zhong, Qiaofang; Shen, J Qingxi; Huang, Xingqi

2014-01-01

The total protein contents of rice seeds are significantly higher in the three wild rice species (Oryza rufipogon Grill., Oryza officinalis Wall. and Oryza meyeriana Baill.) than in the cultivated rice (Oryza sativa L.). However, there is still no report regarding a systematic proteomic analysis of seed proteins in the wild rice species. Also, the relationship between the contents of seed total proteins and rice nutritional quality has not been thoroughly investigated. The total seed protein contents, especially the glutelin contents, of the three wild rice species were higher than those of the two cultivated rice materials. Based on the protein banding patterns of SDS-PAGE, O. rufipogon was similar to the two cultivated rice materials, followed by O. officinalis, while O. meyeriana exhibited notable differences. Interestingly, O. meyeriana had high contents of glutelin and low contents of prolamine, and lacked 26 kDa globulin band and appeared a new 28 kDa protein band. However, for O. officinali a 16 kDa protein band was absent and a row of unique 32 kDa proteins appeared. In addition, we found that 13 kDa prolamine band disappeared while special 14 kDa and 12 kDa protein bands were present in O. officinalis. Two-dimensional gel electrophoresis (2-DE) analysis revealed remarkable differences in protein profiles of the wild rice species and the two cultivated rice materials. Also, the numbers of detected protein spots of the three wild rice species were significantly higher than those of two cultivated rice. A total of 35 differential protein spots were found for glutelin acidic subunits, glutelin precursors and glutelin basic subunits in wild rice species. Among those, 18 protein spots were specific and 17 major spots were elevated. Six differential protein spots for glutelin acidic subunits were identified, including a glutelin type-A 2 precursor and five hypothetical proteins. This was the first report on proteomic analysis of the three wild rice species

Evaluation of the multi-seeded (msd) mutant of sorghum for ethanol production

Science.gov (United States)

Grain sorghum [Sorghum bicolor (L.) Moench], a cost effective crop in semiarid regions, is an underestimated supplement to corn in starch based ethanol production. Twenty three multi-seeded (msd) mutant sorghums and one wild type sorghum BTx623 were evaluated for ethanol production and effect of che...

In Situ Evaluation of Crop Productivity and Bioaccumulation of Heavy Metals in Paddy Soils after Remediation of Metal-Contaminated Soils.

Science.gov (United States)

Kim, Shin Woong; Chae, Yooeun; Moon, Jongmin; Kim, Dokyung; Cui, Rongxue; An, Gyeonghyeon; Jeong, Seung-Woo; An, Youn-Joo

2017-02-15

Soils contaminated with heavy metals have been reused for agricultural, building, and industrial uses following remediation. This study assesses plant growth and bioaccumulation of heavy metals following remediation of industrially contaminated soil. The soil was collected from a field site near a nonferrous smelter and was subjected to laboratory- and field-scale studies. Soil from the contaminated site was remediated by washing with acid or mixed with soil taken from a distant uncontaminated site. The activities of various soil exoenzymes, the rate of plant growth, and the bioaccumulations of six heavy metals were measured to assess the efficacy of these bioremediation techniques. Growth of rice (Oryza sativa) was unaffected in acid-washed soil or the amended soil compared to untreated soil from the contaminated site. The levels of heavy metals in the rice kernels remained within safe limits in treated and untreated soils. Rice, sorghum (Sorghum bicolor), and wheat (Triticum aestivum) cultivated in the same soils in the laboratory showed similar growth rates. Soil exoenzyme activities and crop productivity were not affected by soil treatment in field experiments. In conclusion, treatment of industrially contaminated soil by acid washing or amendment did not adversely affect plant productivity or lead to increased bioaccumulation of heavy metals in rice.

Dye characteristics of Zingiber officinale var rubrum, Cinnamomum zaylanicum, Curcuma longa L., Oryza sativa L. Indica in dye sensitized solar cell (DSSC)

Science.gov (United States)

Cari; Mahfudli Fadli, U.; Bayu Prasada, A.; Supriyanto, A.

2017-01-01

The aims of the research to were know performance of DSSC using the dye of Zingiber, Cinnamomum, Curcuma, and Oryza as a photosensitizer with a variation of dye deposition area with spin coating techniques. The structure of the samples as a sandwich consisting of the working electrode (TiO2), dye, electrodes of platinum (Pt) and the electrolyte sandwiched between two electrodes. Test absorbance dye using UV-Visible Spectrophotometer Lambda 25, using a two-point conductivity test probes El Kahfi 100 and characterization test IV using a Keithley 2602A. For Zingiber results showed that absorbance at 243 nm and 279 nm, photoconductivity of 0.29 Ω-1m-1 and the efficiency is 0.015% on 0.5 cm2. Cinnamomum results showed that absorbance at 253 nm and 403 nm, photoconductivity of 0.11 Ω-1m-1 and the efficiency is 0.002% on 3 cm2. Curcuma results showed that absorbance at 243 nm and 422 nm, photoconductivity of 0.177 Ω-1m-1 and the efficiency is 0.072% on 3 cm2. Oryza results showed that absorbance at 240 nm and 423 nm, photoconductivity of 0.21 Ω-1m-1 and the efficiency is 0.04% on 2.25 cm2. Best absorbance value was obtained from Oryza dye; the highest photoconductivity was obtained from Zingiber dye, and the highest efficiency was obtained from Curcuma dye.

Dye characteristics of Zingiber officinale var rubrum, Cinnamomum zaylanicum, Curcuma longa L., Oryza sativa L. Indica in dye sensitized solar cell (DSSC)

International Nuclear Information System (INIS)

Cari; Fadli, U. Mahfudli; Prasada, A. Bayu; Supriyanto, A.

2017-01-01

The aims of the research to were know performance of DSSC using the dye of Zingiber , Cinnamomum , Curcuma , and Oryza as a photosensitizer with a variation of dye deposition area with spin coating techniques. The structure of the samples as a sandwich consisting of the working electrode (TiO 2 ), dye, electrodes of platinum (Pt) and the electrolyte sandwiched between two electrodes. Test absorbance dye using UV-Visible Spectrophotometer Lambda 25, using a two-point conductivity test probes El Kahfi 100 and characterization test IV using a Keithley 2602A. For Zingiber results showed that absorbance at 243 nm and 279 nm, photoconductivity of 0.29 Ω -1 m -1 and the efficiency is 0.015% on 0.5 cm 2 . Cinnamomum results showed that absorbance at 253 nm and 403 nm, photoconductivity of 0.11 Ω -1 m -1 and the efficiency is 0.002% on 3 cm 2 . Curcuma results showed that absorbance at 243 nm and 422 nm, photoconductivity of 0.177 Ω -1 m -1 and the efficiency is 0.072% on 3 cm 2 . Oryza results showed that absorbance at 240 nm and 423 nm, photoconductivity of 0.21 Ω -1 m -1 and the efficiency is 0.04% on 2.25 cm 2 . Best absorbance value was obtained from Oryza dye; the highest photoconductivity was obtained from Zingiber dye, and the highest efficiency was obtained from Curcuma dye. (paper)

Bioethanol production from dried sweet sorghum stalk

Energy Technology Data Exchange (ETDEWEB)

Almodares, A.; Etemadifar, Z.; Ghoreishi, F.; Yosefi, F. [Biology Dept. Univ. of Isfahan, Isfahan (Iran, Islamic Republic of)], e-mail: aalmodares@yahoo.com

2012-11-01

Bioethanol as a renewable transportation fuel has a great potential for energy and clean environment. Among crops sweet sorghum is one of the best feedstock for ethanol production under hot and dry climatic conditions. Because it has higher tolerance to salt and drought comparing to sugarcane and corn that are currently used for bio-fuel production in the world. Generally mills are used to extract the juice from sweet sorghum stalks. Three roller mills extract around nearly 50 percent of the juice and more mills is needed to extract higher percentage of the juice. More over under cold weather the stalks become dry and juice is not extracted from the stalk, therefore reduce harvesting period. In this study stalks were harvested, leaves were stripped from the stalks and the stalks were chopped to nearly 4 mm length and sun dried. The dry stalks were grounded to 60 mesh powder by a mill. Fermentation medium consists of 15-35% (w/w) sweet sorghum powder, micronutrients and active yeast inoculum from 0.5-1% (w/w) by submerge fermentation method. The fermentation time and temperature were 48-72 hours and 30 deg, respectively. The results showed the highest amount of ethanol (14.5 % w/w sorghum) was produced with 10% sweet sorghum powder and 1% of yeast inoculum, three day fermentation at 30 deg.

Sorghum stem yield and soluble carbohydrates under different ...

African Journals Online (AJOL)

STORAGESEVER

2008-11-19

Nov 19, 2008 ... Key words: Sweet sorghum, grain sorghum, salinity, stem yield, ... The effect of salinity on the stem yield and sucrose was .... growth and polyamine metabolism in two citrus rootstocks with ... Growth and osmoregulation in two.

qEMF3, a novel QTL for the early-morning flowering trait from wild rice, Oryza officinalis, to mitigate heat stress damage at flowering in rice, O. sativa.

Science.gov (United States)

Hirabayashi, Hideyuki; Sasaki, Kazuhiro; Kambe, Takashi; Gannaban, Ritchel B; Miras, Monaliza A; Mendioro, Merlyn S; Simon, Eliza V; Lumanglas, Patrick D; Fujita, Daisuke; Takemoto-Kuno, Yoko; Takeuchi, Yoshinobu; Kaji, Ryota; Kondo, Motohiko; Kobayashi, Nobuya; Ogawa, Tsugufumi; Ando, Ikuo; Jagadish, Krishna S V; Ishimaru, Tsutomu

2015-03-01

A decline in rice (Oryza sativa L.) production caused by heat stress is one of the biggest concerns resulting from future climate change. Rice spikelets are most susceptible to heat stress at flowering. The early-morning flowering (EMF) trait mitigates heat-induced spikelet sterility at the flowering stage by escaping heat stress during the daytime. We attempted to develop near-isogenic lines (NILs) for EMF in the indica-type genetic background by exploiting the EMF locus from wild rice, O. officinalis (CC genome). A stable quantitative trait locus (QTL) for flower opening time (FOT) was detected on chromosome 3. A QTL was designated as qEMF3 and it shifted FOT by 1.5-2.0 h earlier for cv. Nanjing 11 in temperate Japan and cv. IR64 in the Philippine tropics. NILs for EMF mitigated heat-induced spikelet sterility under elevated temperature conditions completing flower opening before reaching 35°C, a general threshold value leading to spikelet sterility. Quantification of FOT of cultivars popular in the tropics and subtropics did not reveal the EMF trait in any of the cultivars tested, suggesting that qEMF3 has the potential to advance FOT of currently popular cultivars to escape heat stress at flowering under future hotter climates. This is the first report to examine rice with the EMF trait through marker-assisted breeding using wild rice as a genetic resource. © The Author 2014. Published by Oxford University Press on behalf of the Society for Experimental Biology.

Increased growth and root Cu accumulation of Sorghum sudanense by endophytic Enterobacter sp. K3-2: Implications for Sorghum sudanense biomass production and phytostabilization.

Science.gov (United States)

Li, Ya; Wang, Qi; Wang, Lu; He, Lin-Yan; Sheng, Xia-Fang

2016-02-01

Endophytic bacterial strain K3-2 was isolated from the roots of Sorghum sudanense (an bioenergy plant) grown in a Cu mine wasteland soils and characterized. Strain K3-2 was identified as Enterobacter sp. based on 16S rRNA gene sequence analysis. Strain K3-2 exhibited Cu resistance and produced 1-aminocyclopropane-1-carboxylate (ACC) deaminase, indole-3-acetic acid (IAA), siderophores, and arginine decarboxylase. Pot experiments showed that strain K3-2 significantly increased the dry weight and root Cu accumulation of Sorghum sudanense grown in the Cu mine wasteland soils. Furthermore, increase in total Cu uptake (ranging from 49% to 95%) of the bacterial inoculated-Sorghum sudanense was observed compared to the control. Notably, most of Cu (83-86%) was accumulated in the roots of Sorghum sudanense. Furthermore, inoculation with strain K3-2 was found to significantly increase Cu bioconcentration factors and the proportions of IAA- and siderophore-producing bacteria in the root interiors and rhizosphere soils of Sorghum sudanense compared with the control. Significant decrease in the available Cu content was also observed in the rhizosphere soils of the bacterial-inoculated Sorghum sudanense. The results suggest that the endophytic bacterial strain K3-2 may be exploited for promoting Sorghum sudanense biomass production and Cu phytostabilization in the Cu mining wasteland soils. Copyright © 2015 Elsevier Inc. All rights reserved.

Radiation balance in the sweet sorghum crop

International Nuclear Information System (INIS)

Assis, F.N. de; Mendez, M.E.G.; Martins, S.R.; Verona, L.A.

1987-01-01

The fluxes of incident solar radiation, reflected and net radiation were measured during the growing cicle of two fields of sweet sorghum (Sorghum bicolor L.), cus. BR-501 and BR-503, maintained under convenient irrigation level. Resultant data allowed to estimate the crop albedo as well as the estimates of Rn. (M.A.C.) [pt

Genetic variation and population structure in Oryza ...

Indian Academy of Sciences (India)

Oryza malampuzhaensis Krish. et Chand. ( 2 n = 4 x = 48 ; Poaceae, Oryza) is endemic to Western Ghats, South India, and shows a highly localized distribution over a small geographical area in this region. This is the most poorly understood taxon in genus Oryza and is often misidentified as O. officinalis owing to their close ...

Evaluation of sweet sorghum (Sorghum bicolor L. [Moench]) on several population density for bioethanol production

Science.gov (United States)

Suwarti; Efendi, R.; Massinai, R.; Pabendon, M. B.

2018-03-01

Sweet sorghum (Sorghum bicolor L. [Moench]) crop management that is use for raw source of bioethanol for industrial purpose in Indonesia is less developed. The aim of this research was to evaluated sweet sorghum variety at several population to determine optimum density for juice production. Experiment design was set on split-plot design with three replications, conducted on August to December 2016 at the Indonesian Cereals Research Institute Research Station, Maros South Sulawesi. Main plot were six variation of plant row, and sub plot were three sweet sorghum varieties. Result of the study showed that plant population was high significanty affect to stalk weight, total biomass yield, leaf weight, and also significantly affect bagass weight and juice volume. Varieties were high significantly different in plant height, juice volume, and number of nodes. Super 1 variety on population at 166,667 plants/ha (P1) was obtained the highest juice volume (19,445 lHa-1), meanwhile the highest brix value obtained from Numbu at the same plants population. Furthermore juice volume had significant correlation with biomass weight at the r=0.73. Based on ethanol production, Super 2 and Numbu had the highest volume at 83.333 plants/ha density (P3) and Super 1 at 166.667 plants/ha density with the ethanol volume were 827.68 l Ha-1, 1116.50 l/ha and 993.62 l Ha-1 respectively.

EFFECT OF MECHANICAL CONDITIONING ON THIN-LAYER DRYING OF ENERGY SORGHUM (Sorghum bicolor (L.) Moench)

Energy Technology Data Exchange (ETDEWEB)

Ian J. Bonner; Kevin L. Kenney

2012-10-01

Cellulosic energy varieties of Sorghum bicolor (L.) Moench show promise as a bioenergy feedstock, however, high moisture content at the time of harvest results in unacceptable levels of degradation when stored in aerobic conditions. To safely store sorghum biomass for extended periods in baled format, the material must be dried to inhibit microbial growth. One possible solution is allowing the material to dry under natural in-field conditions. This study examines the differences in thin-layer drying rates of intact and conditioned sorghum under laboratory-controlled temperatures and relative humidity levels (20 degrees C and 30 degrees C from 40% to 85% relative humidity), and models experimental data using the Page’s Modified equation. The results demonstrate that conditioning drastically accelerates drying times. Relative humidity had a large impact on the time required to reach a safe storage moisture content for intact material (approximately 200 hours at 30 degrees C and 40% relative humidity and 400 hours at 30 degrees C and 70% relative humidity), but little to no impact on the thin-layer drying times of conditioned material (approximately 50 hours for all humidity levels < 70% at 30 degrees C). The drying equation parameters were influenced by temperature, relative humidity, initial moisture content, and material damage, allowing drying curves to be empirically predicted. The results of this study provide valuable information applicable to the agricultural community and to future research on drying simulation and management of energy sorghum.

Multifunctionality and diversity of GDSL esterase/lipase gene family in rice (Oryza sativa L. japonica genome: new insights from bioinformatics analysis

Directory of Open Access Journals (Sweden)

Chepyshko Hanna

2012-07-01

Full Text Available Abstract Background GDSL esterases/lipases are a newly discovered subclass of lipolytic enzymes that are very important and attractive research subjects because of their multifunctional properties, such as broad substrate specificity and regiospecificity. Compared with the current knowledge regarding these enzymes in bacteria, our understanding of the plant GDSL enzymes is very limited, although the GDSL gene family in plant species include numerous members in many fully sequenced plant genomes. Only two genes from a large rice GDSL esterase/lipase gene family were previously characterised, and the majority of the members remain unknown. In the present study, we describe the rice OsGELP (Oryza sativa GDSL esterase/lipase protein gene family at the genomic and proteomic levels, and use this knowledge to provide insights into the multifunctionality of the rice OsGELP enzymes. Results In this study, an extensive bioinformatics analysis identified 114 genes in the rice OsGELP gene family. A complete overview of this family in rice is presented, including the chromosome locations, gene structures, phylogeny, and protein motifs. Among the OsGELPs and the plant GDSL esterase/lipase proteins of known functions, 41 motifs were found that represent the core secondary structure elements or appear specifically in different phylogenetic subclades. The specification and distribution of identified putative conserved clade-common and -specific peptide motifs, and their location on the predicted protein three dimensional structure may possibly signify their functional roles. Potentially important regions for substrate specificity are highlighted, in accordance with protein three-dimensional model and location of the phylogenetic specific conserved motifs. The differential expression of some representative genes were confirmed by quantitative real-time PCR. The phylogenetic analysis, together with protein motif architectures, and the expression profiling were

Seed-borne endophytic Bacillus amyloliquefaciens RWL-1 produces gibberellins and regulates endogenous phytohormones of Oryza sativa.

Science.gov (United States)

Shahzad, Raheem; Waqas, Muhammad; Khan, Abdul Latif; Asaf, Sajjad; Khan, Muhammad Aaqil; Kang, Sang-Mo; Yun, Byung-Wook; Lee, In-Jung

2016-09-01

Some microorganisms are adapted to an endophytic mode, living symbiotically with plants through vertical transmission in seeds. The role of plant growth-promoting endophytes has been well studied, but those of seed-associated endophytic bacteria are less understood. The current study aimed to isolate and identify bacterial endophytes associated with rice (Oryza sativa L. 'Jin so mi') seeds, their potential to produce gibberellins (GAs), and role in improving host-plant physiology. The isolated bacterial endophyte RWL-1 was identified as Bacillus amyloliquefaciens by using 16S rRNA sequencing and phylogenetic analysis. The pure culture of B. amyloliquefaciens RWL-1, supplied with deuterated internal standards, was subjected to gas chromatography and mass spectrometric selected ion monitoring (GC-MS/SIM) for quantification of GAs. Results showed the presence of GAs in various quantities (ng/mL) viz., GA20 (17.88 ± 4.04), GA36 (5.75 ± 2.36), GA24 (5.64 ± 2.46), GA4 (1.02 ± 0.16), GA53 (0.772 ± 0.20), GA9 (0.12 ± 0.09), GA19 (0.093 ± 0.13), GA5 (0.08 ± 0.04), GA12 (0.014 ± 0.34), and GA8 (0.013 ± 0.01). Since endogenous seed GAs are essential for prolonged seed growth and subsequent plant development, we used exogenous GA3 as a positive control and water as a negative control for comparative analysis of the application of B. amyloliquefaciens RWL-1 to rice plants. The growth parameters of rice plants treated with endophytic bacterial cell application was significantly increased compared to the plants treated with exogenous GA3 and water. This was also revealed by the significant up-regulation of endogenous GA1 (17.54 ± 2.40 ng), GA4 (310 ± 5.41 ng), GA7 (192.60 ± 3.32 ng), and GA9 (19.04 ± 2.49 ng) as compared to results of the positive and negative control treatments. Rice plants inoculated with B. amyloliquefaciens RWL-1 exhibited significantly higher endogenous salicylic acid (1615.06 ± 10.81 μg), whereas

Allelic variants of OsHKT1;1 underlie the divergence between indica and japonica subspecies of rice (Oryza sativa for root sodium content.

Directory of Open Access Journals (Sweden)

Malachy T Campbell

2017-06-01

Full Text Available Salinity is a major factor limiting crop productivity. Rice (Oryza sativa, a staple crop for the majority of the world, is highly sensitive to salinity stress. To discover novel sources of genetic variation for salt tolerance-related traits in rice, we screened 390 diverse accessions under 14 days of moderate (9 dS·m-1 salinity. In this study, shoot growth responses to moderate levels of salinity were independent of tissue Na+ content. A significant difference in root Na+ content was observed between the major subpopulations of rice, with indica accessions displaying higher root Na+ and japonica accessions exhibiting lower root Na+ content. The genetic basis of the observed variation in phenotypes was elucidated through genome-wide association (GWA. The strongest associations were identified for root Na+:K+ ratio and root Na+ content in a region spanning ~575 Kb on chromosome 4, named Root Na+ Content 4 (RNC4. Two Na+ transporters, HKT1;1 and HKT1;4 were identified as candidates for RNC4. Reduced expression of both HKT1;1 and HKT1;4 through RNA interference indicated that HKT1;1 regulates shoot and root Na+ content, and is likely the causal gene underlying RNC4. Three non-synonymous mutations within HKT1;1 were present at higher frequency in the indica subpopulation. When expressed in Xenopus oocytes the indica-predominant isoform exhibited higher inward (negative currents and a less negative voltage threshold of inward rectifying current activation compared to the japonica-predominant isoform. The introduction of a 4.5kb fragment containing the HKT1;1 promoter and CDS from an indica variety into a japonica background, resulted in a phenotype similar to the indica subpopulation, with higher root Na+ and Na+:K+. This study provides evidence that HKT1;1 regulates root Na+ content, and underlies the divergence in root Na+ content between the two major subspecies in rice.

Changes in protein and starch digestibility in sorghum flour during heat-moisture treatments.

Science.gov (United States)

Vu, Thanh-Hien; Bean, Scott; Hsieh, Chao-Feng; Shi, Yong-Cheng

2017-11-01

Heat-moisture treatment (HMT) has been used to modify properties of sorghum starches. However, information is limited on the effects of HMT on the digestibility of starch and the concurrent changes in protein in sorghum flour. The objectives of this research were to identify heat-moisture conditions to increase the resistant starch (RS) content of sorghum flour and investigate changes in sorghum proteins and starch structure. Sorghum flours with different moisture contents (0, 125, 200, and 300 g kg -1 w.b.) were heated at three temperatures (100, 120 and 140 °C) and times (1, 2 and 4 h). HMT of sorghum flour increased its RS level. The flour treated at 200 g kg -1 moisture and 100 °C for 4 h had a high RS content (221 g kg -1 vs. 56 g kg -1 for the untreated flour). Starch was not gelatinized when sorghum flours heated at moisture content of 200 g kg -1 or below. Sorghum protein digestibility and solubility decreased during HMT. The increase in RS of sorghum flour upon HMT was attributed to enhanced amylose-lipid complexes and heat induced structural changes in its protein fraction. HMT can be used to increase RS content in sorghum flour without gelatinizing its starch, thereby providing sorghum flour with unique food applications. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

Sorghum as a renewable feedstock for production of fuels and industrial chemicals

Directory of Open Access Journals (Sweden)

Nhuan P. Nghiem

2016-01-01

Full Text Available Considerable efforts have been made in the USA and other countries to develop renewable feedstocks for production of fuels and chemicals. Among these, sorghum has attracted strong interest because of its many good characteristics such as rapid growth and high sugar accumulation, high biomass production potential, excellent nitrogen usage efficiency, wide adaptability, drought resistance, and water lodging tolerance and salinity resistance. The ability to withstand severe drought conditions and its high water usage efficiency make sorghum a good renewable feedstock suitable for cultivation in arid regions, such as the southern US and many areas in Africa and Asia. Sorghum varieties include grain sorghum, sweet sorghum, and biomass sorghum. Grain sorghum, having starch content equivalent to corn, has been considered as a feedstock for ethanol production. Its tannin content, however, may cause problems during enzyme hydrolysis. Sweet sorghum juice contains sucrose, glucose and fructose, which are readily fermentable by Saccharomyces cerevisiae and hence is a good substrate for ethanol fermentation. The enzyme invertase, however, needs to be added to convert sucrose to glucose and fructose if the juice is used for production of industrial chemicals in fermentation processes that employ microorganisms incapable of metabolizing sucrose. Biomass sorghum requires pretreatment prior to enzymatic hydrolysis to generate fermentable sugars to be used in the subsequent fermentation process. This report reviews the current knowledge on bioconversion of sorghum to fuels and chemicals and identifies areas that deserve further studies.

Effect of sowing date on grain quality of sorghum ( Sorghum bicolor ...

African Journals Online (AJOL)

IVHAA) while minerals; iron and zinc were determined using Atomic Absorption Spectrophotometry. Significant site by variety by sowing date interactions at P < 0.05 level of probability were obtained for protein, iron and zinc content of sorghum ...

Efficacy of herbicide seed treatments for controlling Striga infestation of Sorghum

NARCIS (Netherlands)

Tuinstra, M.R.; Soumana, S.; Al-Khatib, K.; Kapran, I.; Toure, A.; Ast, van A.; Bastiaans, L.; Ochanda, N.W.; Salami, I.; Kayentao, M.; Dembele, S.

2009-01-01

Witchweed (Striga spp.) infestations are the greatest obstacle to sorghum [Sorghum bicolor (L.) Moench] grain production in many areas in Africa. The objective of this study was to evaluate the efficacy of herbicide seed treatments for controlling Striga infestation of sorghum. Seeds of an

Evaluation of sorghum genotypes under drought stress conditions ...

African Journals Online (AJOL)

Seven genotypes of sorghum (Sorghum bicolour (L.) Moench) were studied in both drought and normal conditions. In each condition, the genotypes were evaluated using a split plot based randomized complete block design with three replications. Drought tolerance indices including stability tolerance index (STI), mean ...

Performance of Broiler Chicks Fed Irradiated Sorghum Grains

International Nuclear Information System (INIS)

Farag, M.D.D.; Farag, M.F. S. El-D.; Afify, A.S.

2003-01-01

Substitution of yellow corn with raw sorghum grains in chick diets resulted in decreases in live body weight, accumulative feed consumption and efficiency of feed utilization as compared with reference diet. Relative to raw sorghum diet, inclusion of sorghum grains irradiated at 60 and 100 kGy and/or supplemented with PEG in chick diets resulted in increases in accumulative feed consumption an efficiency feed utilization. The study suggested that irradiation treatment up to 100 kGy up grade broiler chicks performance and the combinations between radiation and PEG treatments sustain the effect of each other

Crystallization and preliminary crystallographic studies of LipA, a secretory lipase/esterase from Xanthomonas oryzae pv. oryzae

Energy Technology Data Exchange (ETDEWEB)

Aparna, Gudlur; Chatterjee, Avradip; Jha, Gopaljee; Sonti, Ramesh V.; Sankaranarayanan, Rajan, E-mail: sankar@ccmb.res.in [Centre for Cellular and Molecular Biology, Uppal Road, Hyderabad 500 007 (India)

2007-08-01

The crystallization and preliminary crystallographic studies of LipA, a lipase/esterase secreted by X. oryzae pv. oryzae during its infection of rice plants, are reported. Xanthomonas oryzae pv. oryzae is the causal agent of bacterial leaf blight, a serious disease of rice. Several enzymes that are secreted through the type II secretion system of this bacterium play an important role in the plant–microbe interaction, being important for virulence and also being able to induce potent host defence responses. One of these enzymes is a secretory lipase/esterase, LipA, which shows a very weak homology to other bacterial lipases and gives a positive tributyrin plate assay. In this study, LipA was purified from the culture supernatant of an overexpressing clone of X. oryzae pv. oryzae and two types of crystals belonging to space group C2 but with two different unit-cell parameters were obtained using the hanging-drop vapour-diffusion method. Type I crystals diffract to a maximum resolution of 1.89 Å and have unit-cell parameters a = 93.1, b = 62.3, c = 66.1 Å, β = 90.8°. Type II crystals have unit-cell parameters a = 103.6, b = 54.6, c = 66.3 Å, β = 92.6° and diffract to 1.86 Å. Solvent-content analysis shows one monomer in the asymmetric unit in both the crystal forms.

Tapping the US historic sweet sorghum collection to identify biofuel germplasm

Science.gov (United States)

Sweet sorghum [Sorghum bicolor (L.) Moench] has gained an important role as a viable alternative to fossil fuels and a more profitable option than maize and sugarcane. Nevertheless, the actual narrow genetic base in sweet sorghum breeding programs is limiting the development of new biofuel varietie...

PAV markers in Sorghum bicolour

DEFF Research Database (Denmark)

Shen, Xin; Liu, Zhiquan; Mocoeur, Anne Raymonde Joelle

2015-01-01

Abstract Genic presence/absence variants (PAVs) correlate closely to the phenotypic variation, impacting plant genome sizes and the adaption to the environment. To shed more light on their genome-wide patterns, functions and to test the possibility of using them as molecular markers, we analyzed...... enriched in stress responses and protein modification. We used 325 polymorphic PAVs in two sorghum inbred lines Ji2731 and E-Tian, together with 49 SSR markers, and constructed a genetic map, which consisted of 10 linkage groups corresponding to the 10 chromosomes of sorghum and spanned 1430.3 cM in length...

Short-chain chlorinated paraffins in soil, paddy seeds (Oryza sativa) and snails (Ampullariidae) in an e-waste dismantling area in China: Homologue group pattern, spatial distribution and risk assessment.

Science.gov (United States)

Yuan, Bo; Fu, Jianjie; Wang, Yawei; Jiang, Guibin

2017-01-01

Short-chain chlorinated paraffins (SCCPs) in multi-environmental matrices are studied in Taizhou, Zhejiang Province, China, which is a notorious e-waste dismantling area. The investigated matrices consist of paddy field soil, paddy seeds (Oryza sativa, separated into hulls and rice unpolished) and apple snails (Ampullariidae, inhabiting the paddy fields). The sampling area covered a 65-km radius around the contamination center. C 10 and C 11 are the two predominant homologue groups in the area, accounting for about 35.7% and 33.0% of total SCCPs, respectively. SCCPs in snails and hulls are generally higher than in soil samples (30.4-530 ng/g dw), and SCCPs in hulls are approximate five times higher than in corresponding rice samples (4.90-55.1 ng/g dw). Homologue pattern analysis indicates that paddy seeds (both hull and rice) tend to accumulate relatively high volatile SCCP homologues, especially the ones with shorter carbon chain length, while snails tend to accumulate relatively high lipophilic homologues, especially the ones with more substituted chlorines. SCCPs in both paddy seeds and snails are linearly related to those in the soil. The e-waste dismantling area, which covers a radius of approximate 20 km, shows higher pollution levels for SCCPs according to their spatial distribution in four matrices. The preliminary assessment indicates that SCCP levels in local soils pose no significant ecological risk for soil dwelling organisms, but higher risks from dietary exposure of SCCPs are suspected for people living in e-waste dismantling area. Copyright © 2016 Elsevier Ltd. All rights reserved.

Genetic dissection of bioenerrgy traits in sorghum

Energy Technology Data Exchange (ETDEWEB)

Vermerris, Wilfred; Kresovich, Stephen; Murray, Seth; Pedersen, Jeffery; Rooney, William; Sattler, Scott.

2012-06-15

Specific Objectives: 1. To identify the gene(s) underlying a major QTL for stem sugar concentration located on chromosome 3. 2. To identify QTL for stem juice volume and stalk sugar concentration and to identify the underlying genes. 3. To classify 60 novel sorghum bmr mutants from the USDA TILLING population in allelic groups based on cell wall chemistry and allelism tests. 4. To select representative bmr mutants from each allelic group and selected NIR spectral mutants for their potential value as feedstock for ethanol production. 5. To clone and characterize those Bmr genes that represent loci other than Bmr12 and Bmr6 using a mapping and a candidate gene approach. Objective 1 The experiments for this objective are largely complete and the data have been analyzed. Data interpretation and follow-up experiments are still in progress. A manuscript is in preparation (Vermerris et al.; see publication list for full details). The main results are: 1) 16 cDNA libraries were prepared and sequenced at Cornell University. The libraries represent internode tissue and flag leaf tissue at booting, internode tissue and peduncle at soft-dough stage, from two plants per sampling time with the Rio allele for the QTL on chromosome 3, and two plants with the BTx623 allele on chromosome 3 (4 tissues x 2 genotypes x 2 replicates) 2) 480 million 86-nucleotide reads were generated from four lanes of Illuminia HiSeqII 3) 74% of the reads could be mapped to the sorghum transcriptome, indicative of good sequence quality 4) Of the 216 genes within the QTL, 17 genes were differentially expressed among plants with and without the Rio QTL. None of these 17 genes had obvious roles in sucrose metabolism 5) Clustering algorithms identified a group of 721 co-expressed genes. One of these genes is a sucrose synthase gene. This cluster also contains 10 genes from the QTL. 6) Among these co-expressed genes are regulatory genes for which knock-out lines in Arabidopsis have been obtained. Analysis of

Study on genotypic variation for ethanol production from sweet sorghum juice

Energy Technology Data Exchange (ETDEWEB)

Ratnavathi, C.V.; Suresh, K.; Kumar, B.S. Vijay; Pallavi, M.; Komala, V.V.; Seetharama, N. [Directorate of Sorghum Research, Rajendranagar, Hyderabad 500030, Andhra Pradesh (India)

2010-07-15

Sugarcane molasses is the main source for ethanol production in India. Sweet sorghum with its juicy stem containing sugars equivalent to that of sugarcane is a very good alternative for bio-ethanol production to meet the energy needs of the country. Sweet sorghum is drought resistant, water logging resistant and saline-alkaline tolerant. Growing sweet sorghum for ethanol production is relatively easy and economical and ethanol produced from sweet sorghum is eco-friendly. In view of this, it is important to identify superior genotypes for ethanol production in terms of percent juice brix, juice extractability, total fermentable sugars, ethanol yield and fermentation efficiency. This paper presents the study on the variability observed for the production of ethanol by various sweet sorghum genotypes in a laboratory fermentor. Five Sweet Sorghum (Sorghum bicolor L. Moench) genotypes were evaluated for ethanol production from stalk juice (Keller, SSV 84, Wray, NSSH 104 and BJ 248). Sweet sorghum juice differs from cane juice mainly in its higher content of starch and aconitic acid. Data were collected for biomass yield; stalk sugar yield and ethanol production in five genotypes. Maximum ethanol production of 9.0%w/v ethanol was obtained with Keller variety (20% sugar concentration was used), and decreased for other genotypes. A distiller's strain of Saccharomyces cerevisiae (gifted by Seagram Distilleries Ltd.) was employed for fermentation. The fermentation efficiency (FE) was 94.7% for this strain. High biomass of yeast was obtained with BJ 248 variety. When the similar experiments were conducted with unsterile sweet sorghum juice (15% sugar concentration) 6.47%w/v ethanol was produced. (author)

Elusive Origins of the Extra Genes in Aspergillus oryzae

Science.gov (United States)

Khaldi, Nora; Wolfe, Kenneth H.

2008-01-01

The genome sequence of Aspergillus oryzae revealed unexpectedly that this species has approximately 20% more genes than its congeneric species A. nidulans and A. fumigatus. Where did these extra genes come from? Here, we evaluate several possible causes of the elevated gene number. Many gene families are expanded in A. oryzae relative to A. nidulans and A. fumigatus, but we find no evidence of ancient whole-genome duplication or other segmental duplications, either in A. oryzae or in the common ancestor of the genus Aspergillus. We show that the presence of divergent pairs of paralogs is a feature peculiar to A. oryzae and is not shared with A. nidulans or A. fumigatus. In phylogenetic trees that include paralog pairs from A. oryzae, we frequently find that one of the genes in a pair from A. oryzae has the expected orthologous relationship with A. nidulans, A. fumigatus and other species in the subphylum Eurotiomycetes, whereas the other A. oryzae gene falls outside this clade but still within the Ascomycota. We identified 456 such gene pairs in A. oryzae. Further phylogenetic analysis did not however indicate a single consistent evolutionary origin for the divergent members of these pairs. Approximately one-third of them showed phylogenies that are suggestive of horizontal gene transfer (HGT) from Sordariomycete species, and these genes are closer together in the A. oryzae genome than expected by chance, but no unique Sordariomycete donor species was identifiable. The postulated HGTs from Sordariomycetes still leave the majority of extra A. oryzae genes unaccounted for. One possible explanation for our observations is that A. oryzae might have been the recipient of many separate HGT events from diverse donors. PMID:18725939

Elusive origins of the extra genes in Aspergillus oryzae.

Directory of Open Access Journals (Sweden)

Nora Khaldi

Full Text Available The genome sequence of Aspergillus oryzae revealed unexpectedly that this species has approximately 20% more genes than its congeneric species A. nidulans and A. fumigatus. Where did these extra genes come from? Here, we evaluate several possible causes of the elevated gene number. Many gene families are expanded in A. oryzae relative to A. nidulans and A. fumigatus, but we find no evidence of ancient whole-genome duplication or other segmental duplications, either in A. oryzae or in the common ancestor of the genus Aspergillus. We show that the presence of divergent pairs of paralogs is a feature peculiar to A. oryzae and is not shared with A. nidulans or A. fumigatus. In phylogenetic trees that include paralog pairs from A. oryzae, we frequently find that one of the genes in a pair from A. oryzae has the expected orthologous relationship with A. nidulans, A. fumigatus and other species in the subphylum Eurotiomycetes, whereas the other A. oryzae gene falls outside this clade but still within the Ascomycota. We identified 456 such gene pairs in A. oryzae. Further phylogenetic analysis did not however indicate a single consistent evolutionary origin for the divergent members of these pairs. Approximately one-third of them showed phylogenies that are suggestive of horizontal gene transfer (HGT from Sordariomycete species, and these genes are closer together in the A. oryzae genome than expected by chance, but no unique Sordariomycete donor species was identifiable. The postulated HGTs from Sordariomycetes still leave the majority of extra A. oryzae genes unaccounted for. One possible explanation for our observations is that A. oryzae might have been the recipient of many separate HGT events from diverse donors.

Effect of Feeding High Gamma-Aminobutyric Acid-Containing Giant Embryo Black Sticky Rice (Oryza sativa L.) on Anxiety-Related Behavior of C57BL/6 Mice.

Science.gov (United States)

Jung, Woo-Young; Kim, Sung-Gon; Lee, Jin-Seong; Kim, Hyeon-Kyeong; Son, Beung-Gu; Kim, Jong-Woo; Suh, Jae-Won

2017-08-01

The aim of this study was to determine the effect of feeding high gamma-aminobutyric acid (GABA)-containing black sticky rice giant embryo (BSRGE, Oryza sativa L.) on anxiety-related behavior of C57BL/6 mice. Experimental feedstuff (BSRGE with high GABA+AIN-76A) and control (AIN-76A) were provided to C57BL/6 mouse for 10 days. Antianxiety effects of BSRGE with high GABA were measured using an elevated plus maze. On day 8, the number of open arm entries by GABA and control groups were 1.10 ± 1.60 (mean ± SD) and 0.00 ± 0.00 (P = .030). On day 10, the number of open arm entries by the GABA group was 2.00 ± 1.89, which was significantly (P = .025) higher than that in the control group (0.40 ± 0.84). On day 8, the time the mice spent in open arm in the GABA group and control group was 3.60 ± 7.06 and 0.00 ± 0.00 sec (P = .068), respectively. On day 10, the time the mice in the GABA and control groups spent in open arm was 6.20 ± 5.35 sec and 1.80 ± 3.82 sec (P = .042), respectively. In repeated analysis of variance for the number of entries into open arm and time spent in open arm, significant differences were found between the two groups. Therefore, BSRGE with high GABA content might have an antianxiety effect. This study can serve as a preliminary study so that further antianxiety effects of BSRGE can be determined in more extended animal or clinical research studies in the future.

Emerging Importance of Helicases in Plant Stress Tolerance: Characterization of Oryza sativa Repair Helicase XPB2 Promoter and Its Functional Validation in Tobacco under Multiple Stresses.

Science.gov (United States)

Raikwar, Shailendra; Srivastava, Vineet K; Gill, Sarvajeet S; Tuteja, Renu; Tuteja, Narendra

2015-01-01

Genetic material always remains at the risk of spontaneous or induced damage which challenges the normal functioning of DNA molecule, thus, DNA repair is vital to protect the organisms against genetic damage. Helicases, the unique molecular motors, are emerged as prospective molecules to engineer stress tolerance in plants and are involved in nucleic acid metabolism including DNA repair. The repair helicase, XPB is an evolutionary conserved protein present in different organisms, including plants. Availability of few efficient promoters for gene expression in plants provoked us to study the promoter of XPB for better understanding of gene regulation under stress conditions. Here, we report the in silico analysis of novel stress inducible promoter of Oryza sativa XPB2 (OsXPB2). The in vivo validation of functionality/activity of OsXPB2 promoter under abiotic and hormonal stress conditions was performed by Agrobacterium-mediated transient assay in tobacco leaves using OsXPB2::GUS chimeric construct. The present research revealed that OsXPB2 promoter contains cis-elements accounting for various abiotic stresses (salt, dehydration, or cold) and hormone (Auxin, ABA, or MeJA) induced GUS expression/activity in the promoter-reporter assay. The promoter region of OsXPB2 contains CACG, GTAACG, CACGTG, CGTCA CCGCCGCGCT cis acting-elements which are reported to be salt, dehydration, cold, MeJA, or ABA responsive, respectively. Functional analysis was done by Agrobacterium-mediated transient assay using agroinfiltration in tobacco leaves, followed by GUS staining and fluorescence quantitative analyses. The results revealed high induction of GUS activity under multiple abiotic stresses as compared to mock treated control. The present findings suggest that OsXPB2 promoter is a multi-stress inducible promoter and has potential applications in sustainable crop production under abiotic stresses by regulating desirable pattern of gene expression.

Small kernel 1 encodes a pentatricopeptide repeat protein required for mitochondrial nad7 transcript editing and seed development in maize (Zea mays) and rice (Oryza sativa).

Science.gov (United States)

Li, Xiao-Jie; Zhang, Ya-Feng; Hou, Mingming; Sun, Feng; Shen, Yun; Xiu, Zhi-Hui; Wang, Xiaomin; Chen, Zong-Liang; Sun, Samuel S M; Small, Ian; Tan, Bao-Cai

2014-09-01

RNA editing modifies cytidines (C) to uridines (U) at specific sites in the transcripts of mitochondria and plastids, altering the amino acid specified by the DNA sequence. Here we report the identification of a critical editing factor of mitochondrial nad7 transcript via molecular characterization of a small kernel 1 (smk1) mutant in Zea mays (maize). Mutations in Smk1 arrest both the embryo and endosperm development. Cloning of Smk1 indicates that it encodes an E-subclass pentatricopeptide repeat (PPR) protein that is targeted to mitochondria. Loss of SMK1 function abolishes the C → U editing at the nad7-836 site, leading to the retention of a proline codon that is edited to encode leucine in the wild type. The smk1 mutant showed dramatically reduced complex-I assembly and NADH dehydrogenase activity, and abnormal biogenesis of the mitochondria. Analysis of the ortholog in Oryza sativa (rice) reveals that rice SMK1 has a conserved function in C → U editing of the mitochondrial nad7-836 site. T-DNA knock-out mutants showed abnormal embryo and endosperm development, resulting in embryo or seedling lethality. The leucine at NAD7-279 is highly conserved from bacteria to flowering plants, and analysis of genome sequences from many plants revealed a molecular coevolution between the requirement for C → U editing at this site and the existence of an SMK1 homolog. These results demonstrate that Smk1 encodes a PPR-E protein that is required for nad7-836 editing, and this editing is critical to NAD7 function in complex-I assembly in mitochondria, and hence to embryo and endosperm development in maize and rice. © 2014 The Authors The Plant Journal © 2014 John Wiley & Sons Ltd.

Factors influencing beta-amylase activity in sorghum malt

CSIR Research Space (South Africa)

Taylor, JRN

1993-09-01

Full Text Available isozyme of pI approximately 4.4-4.5, unlike the many isozymes all of higher pI in barley. However, like barley, sorghum beta-amylase was more temperature-labile than its alpha-amylase. Beta-amylase activity in sorghum malt was increased by germination time...

The environment strongly affects estimates of heterosis in hybrid sweet sorghum

Science.gov (United States)

Sweet sorghum (Sorghum bicolor (L.) Moench) has potential as a biofuel feedstock but hybrid cultivars are needed to support an industry based on this crop. The purpose of this study was to compare five inbred sweet sorghum lines and 15 hybrids derived from them, and to determine the extent of envir...

Oryza sativa L.

Indian Academy of Sciences (India)

inheritance of quantitative characters, such as yield and its components are ... A critical analysis of genetic variability is necessary for ini- ... Journal of Genetics, Vol. 95, No. ..... Science and Technology, New Delhi for their financial assistance.

Oryza sativa L.

African Journals Online (AJOL)

Jane

2011-07-11

Jul 11, 2011 ... Disease resistance in plants is a desirable economic trait. Many disease ... in BRGA-1(blast resistant gene analogue-1), putative retro-elements and putative retro-transposons proteins in ... with approximately 150 described in the Colombia ecotype of .... molecular basis of NBS2-Pi9 in broad-spectrum blast.

Characterization of Cannabis sativa allergens.

Science.gov (United States)

Nayak, Ajay P; Green, Brett J; Sussman, Gordon; Berlin, Noam; Lata, Hemant; Chandra, Suman; ElSohly, Mahmoud A; Hettick, Justin M; Beezhold, Donald H

2013-07-01

Allergic sensitization to Cannabis sativa is rarely reported, but the increasing consumption of marijuana has resulted in an increase in the number of individuals who become sensitized. To date, little is known about the causal allergens associated with C sativa. To characterize marijuana allergens in different components of the C sativa plant using serum IgE from marijuana sensitized patients. Serum samples from 23 patients with a positive skin prick test result to a crude C sativa extract were evaluated. IgE reactivity was variable between patients and C sativa extracts. IgE reactivity to C sativa proteins in Western blots was heterogeneous and ranged from 10 to 70 kDa. Putative allergens derived from 2-dimensional gels were identified. Prominent IgE reactive bands included a 23-kDa oxygen-evolving enhancer protein 2 and a 50-kDa protein identified to be the photosynthetic enzyme ribulose-1,5-bisphosphate carboxylase/oxygenase. Additional proteins were identified in the proteomic analysis, including those from adenosine triphosphate synthase, glyceraldehyde-3-phosphate dehydrogenase, phosphoglycerate kinase, and luminal binding protein (heat shock protein 70), suggesting these proteins are potential allergens. Deglycosylation studies helped refine protein allergen identification and demonstrated significant IgE antibodies against plant oligosaccharides that could help explain cross-reactivity. Identification and characterization of allergens from C sativa may be helpful in further understanding allergic sensitization to this plant species. Copyright © 2013 American College of Allergy, Asthma & Immunology. Published by Elsevier Inc. All rights reserved.

Estimation of in situ mating systems in wild sorghum (Sorghum ...

Indian Academy of Sciences (India)

The high outcrossing rates of wild/weedy sorghum populations in Ethiopia indicate a high potential for crop genes (including transgenes) to spread within the wild pool. Therefore, effective risk management strategies may be needed if the introgression of transgenes or other crop genes from improved cultivars into wild or ...

Lactic acid fermentation of two sorghum varieties is not affected by ...

African Journals Online (AJOL)

The study was conducted to investigate sorghum grain variety differences in lactic acid fermentation based on their differences in phenolic contents. The study wa s conductedas a 2 x 5 x 4 factorial design with three factors: Factor 1: Sorghum variety (white and red sorghum); Factor 2: Control treatment without lactic acid ...

Epicoccum nigrum the new pathogen of sorghum seed in Serbia

Directory of Open Access Journals (Sweden)

Ristić Danijela

2012-01-01

Full Text Available Sixteen samples of sorghum seed (Sorghum bicolor (L. Moench. 'Alba', 'Gold', 'Prima' and 'Reform' were analyzed in the localities of Bački Petrovac and Čantavir in the period 2009-2011. Tipresence of species belonging to the genera Epicoccum, Fusarium, Alternaria, Aspergillus and Penicillium was established in single and mixed infections. From the infected sorghum seed, monosporial cultures identified as Epicoccum nigrum based on morphology, proved their pathogenicity on artificially inoculated sorghum seedlings. Molecular identification was performed by PCR and amplification of the ITS region of ribosomal DNA. Gene sequences of selected isolates 291-09 (JQ619838 and 315-09 (JQ619839 exhibited 99-100% nucleotide identity with the sequences of 31 isolates of E. nigrum deposited in the GenBank. It obtained results represent the first detailed characterization of E. nigrum in Serbia. The presence of a large number of phytopathogenic fungi on sorghum seed should be further investigated in order to clarify their relationships and relative significance.

African Journal of Biotechnology - Vol 7, No 23 (2008)

African Journals Online (AJOL)

Oryza sativa) and Tog5681 (Oryza glaberrima) · EMAIL FREE FULL TEXT EMAIL ... Perceptions and attitudes of geography teachers to biotechnology: A study focusing on genetically modified (GM) foods · EMAIL FREE FULL TEXT EMAIL FREE ...

Incorporating a Sorghum Habitat for Enhancing Lady Beetles (Coleoptera: Coccinellidae in Cotton

Directory of Open Access Journals (Sweden)

P. G. Tillman

2012-01-01

Full Text Available Lady beetles (Coleoptera: Coccinellidae prey on insect pests in cotton. The objective of this 2 yr on-farm study was to document the impact of a grain sorghum trap crop on the density of Coccinellidae on nearby cotton. Scymnus spp., Coccinella septempunctata (L., Hippodamia convergens Guérin-Méneville, Harmonia axyridis (Pallas, Coleomegilla maculata (De Geer, Cycloneda munda (Say, and Olla v-nigrum (Mulsant were found in sorghum over both years. Lady beetle compositions in sorghum and cotton and in yellow pyramidal traps were similar. For both years, density of lady beetles generally was higher on cotton with sorghum than on control cotton. Our results indicate that sorghum was a source of lady beetles in cotton, and thus incorporation of a sorghum habitat in farmscapes with cotton has great potential to enhance biocontrol of insect pests in cotton.

Economic feasibility of producing sweet sorghum as an ethanol feedstock in the southeastern United States

International Nuclear Information System (INIS)

Linton, Joseph A.; Miller, J. Corey; Little, Randall D.; Petrolia, Daniel R.; Coble, Keith H.

2011-01-01

This study examines the feasibility of producing sweet sorghum (Sorghum bicolor (L.) Moench) as an ethanol feedstock in the southeastern United States through representative counties in Mississippi. We construct enterprise budgets along with estimates of transportation costs to estimate sweet sorghum producers' breakeven costs for producing and delivering sweet sorghum biomass. This breakeven cost for the sweet sorghum producer is used to estimate breakeven costs for the ethanol producer based on wholesale ethanol price, production costs, and transportation and marketing costs. Stochastic models are developed to estimate profits for sweet sorghum and competing crops in two representative counties in Mississippi, with sweet sorghum consistently yielding losses in both counties. -- Highlights: → We examine the economic feasibility of sweet sorghum as an ethanol feedstock. → We construct enterprise budgets along with estimates of transportation costs. → We estimate breakeven costs for producing and delivering sweet sorghum biomass. → Stochastic models determine profits for sweet sorghum in two Mississippi counties.

The application of secondary metabolites in the study of sorghum insect resistance

Science.gov (United States)

Chunming, Bai; Yifei, Liu; Xiaochun, Lu

2018-03-01

Insect attack is one of the main factors for limiting the production of rice and sorghum. To improve resistance to pests of rice and sorghum will be of great significance for meliorating their production and quality. However, the source and material of anti-pest was scarce. In this study, we will study on the expression patterns of hydrocyanic acid biosynthesis relative genes in sorghum firstly. And we will also genetically transform them into rice and sorghum by specific and constitutive promoters and verify their pest-resistant ability. Finally, high pest-resistant genetically modified new sorghum cultivars will be bred with favorable comprehensive agronomic traits.

PHYTOCHEMICAL STUDY OF A TINCTORIAL PLANT OF BENIN TRADITIONAL PHARMACOPOEIA: THE RED SORGHUM (Sorghum caudatum) OF BENIN

OpenAIRE

PASCAL D. C. AGBANGNAN; CHRISTINE TACHON; HELENE BONIN; ANNA CHROSTOWKA; ERIC FOUQUET; DOMINIQUE C. K. SOHOUNHLOUE

2012-01-01

The full phytochemical screening of red sorghum from Benin (Sorghum caudatum) achieved in this work reveals the presence of leucoanthocyanins, flavonoides, free quinones, combined anthracene derivatives, sterols and terpenes in higher concentration in the leaf sheath and marrow of stem than in the seed. Catechin tannin content is 11.4% in the leaf sheath (slightly higher than that of red wine), 5.8% in the marrow and 2.8% in the seed. Gallic tannins, saponins and the mucilage present in the l...

Grain sorghum is a viable feedstock for ethanol production.

Science.gov (United States)

Wang, D; Bean, S; McLaren, J; Seib, P; Madl, R; Tuinstra, M; Shi, Y; Lenz, M; Wu, X; Zhao, R

2008-05-01

Sorghum is a major cereal crop in the USA. However, sorghum has been underutilized as a renewable feedstock for bioenergy. The goal of this research was to improve the bioconversion efficiency for biofuels and biobased products from processed sorghum. The main focus was to understand the relationship among "genetics-structure-function-conversion" and the key factors impacting ethanol production, as well as to develop an energy life cycle analysis model (ELCAM) to quantify and prioritize the saving potential from factors identified in this research. Genetic lines with extremely high and low ethanol fermentation efficiency and some specific attributes that may be manipulated to improve the bioconversion rate of sorghum were identified. In general, ethanol yield increased as starch content increased. However, no linear relationship between starch content and fermentation efficiency was found. Key factors affecting the ethanol fermentation efficiency of sorghum include protein digestibility, level of extractable proteins, protein and starch interaction, mash viscosity, amount of phenolic compounds, ratio of amylose to amylopectin, and formation of amylose-lipid complexes in the mash. A platform ELCAM with a base case showed a positive net energy value (NEV) = 25,500 Btu/gal EtOH. ELCAM cases were used to identify factors that most impact sorghum use. For example, a yield increase of 40 bu/ac resulted in NEV increasing from 7 million to 12 million Btu/ac. An 8% increase in starch provided an incremental 1.2 million Btu/ac.

Characterizing Sorghum Panicles using 3D Point Clouds

Science.gov (United States)

Lonesome, M.; Popescu, S. C.; Horne, D. W.; Pugh, N. A.; Rooney, W.

2017-12-01

To address demands of population growth and impacts of global climate change, plant breeders must increase crop yield through genetic improvement. However, plant phenotyping, the characterization of a plant's physical attributes, remains a primary bottleneck in modern crop improvement programs. 3D point clouds generated from terrestrial laser scanning (TLS) and unmanned aerial systems (UAS) based structure from motion (SfM) are a promising data source to increase the efficiency of screening plant material in breeding programs. This study develops and evaluates methods for characterizing sorghum (Sorghum bicolor) panicles (heads) in field plots from both TLS and UAS-based SfM point clouds. The TLS point cloud over experimental sorghum field at Texas A&M farm in Burleston County TX were collected using a FARO Focus X330 3D laser scanner. SfM point cloud was generated from UAS imagery captured using a Phantom 3 Professional UAS at 10m altitude and 85% image overlap. The panicle detection method applies point cloud reflectance, height and point density attributes characteristic of sorghum panicles to detect them and estimate their dimensions (panicle length and width) through image classification and clustering procedures. We compare the derived panicle counts and panicle sizes with field-based and manually digitized measurements in selected plots and study the strengths and limitations of each data source for sorghum panicle characterization.

Sorghum as an alternative of cultivation to maize; Sorghumhirse als Anbaualternative zum Mais

Energy Technology Data Exchange (ETDEWEB)

Jaekel, Kerstin; Theiss, Markus; Poetzschke, Karen [Saechsisches Landesamt fuer Umwelt, Landwirtschaft und Geologie (LfULG), Dresden (Germany)] [and others

2013-10-01

Due to their high dry matter yield potential Sorghum bicolor and Sorghum bicolor x sudanense are well fitted as feedstock for biogas production. Similar to maize, both species show a high efficiency in their use of water (C4-plants). However, Sorghum has a higher drought tolerance in comparison with maize but is more sensitive to low temperatures. Hence a cultivation of Sorghum is recommendable especially in dry and relatively warm regions, including recultivated areas and even on loess soil, provided that the required temperatures are given. Due to the fact that Sorghum is not affected by the corn root worm, it also could gain relevance in regions were the cultivation of maize is restricted. Furthermore, Sorghum is usable as a catch crop as well as a main crop because of its variable sowing time. Catch crop cultivation, however, yields a significantly lower amount of dry matter and -quality which is a result of its shorter vegetation period. Owing to its higher crude fiber concentration Sorghum achieves a lower theoretically attainable specific methane yield (Weissbach) than maize. Thus only on rare occasions Sorghum does achieve methane yields per hectare that are comparable to maize. Eventually, the competitiveness of Sorghum greatly depends on provision of enhanced cultivars achieved through genetic improvement. (orig.)

Effects of main traits of sweet sorghum irradiated by carbon ions

International Nuclear Information System (INIS)

Li Wenjian; He Jingyu; Liu Qingfang; Yu Lixia; Dong Xicun

2009-01-01

To investigate the influence of carbon ion irradiation on important agronomic characters of sweet sorghum, dry seeds of Sweet Sorghum BJ0601 and BJ0602 were irradiated by 100 MeV/u 12 C +6 ion beam to different doses at Heavy Ion Accelerator National Laboratory in Lanzhou (HIANLL). When matured, the main traits of sweet sorghum were measured. The correlation coefficient of five main agronomic characters, i.e. number of node, plant height, stalk diameter, sugar content and stem weight per plant, were analyzed using the SPSS 13.0 software. The results indicated that the obvious influence of sweet sorghum irradiated by carbon ion beam was observed. In addition, the correlation of main traits was studied. This study may provide rudimental data to select novel variety of sweet sorghum suited for fuel ethanol production. In addition, the average of sugar content of early mutant BJ0601-1 is higher than BJ0601 in M2, and the sugar content of sweet sorghum may be improved by carbon ion beam irradiation. (authors)

Impact of mine waste dumps on growth and biomass of economically important crops.

Science.gov (United States)

Mathiyazhagan, Narayanan; Natarajan, Devarajan

2012-11-01

The present study aimed to investigate the effect of magnesite and bauxite waste dumps on growth and biochemical parameters of some edible and economically important plants such as Vigna radiata, V. mungo, V. unguiculata, Eleusine coracana, Cajanus cajan, Pennisetum glaucum, Macrotyloma uniflorum, Oryza sativa, Sorghum bicolour, Sesamum indicum, Ricinus communis, Brassica juncea, Gossypium hirsutum and Jatropha curcas. The growth rate of all the crops was observed in the range of 75 to 100% in magnesite and 15 to 100% in bauxite mine soil. The moisture content of roots and shoots of all the crops were in the range of 24 to 77, 20 to 88% and 42 to 87, 59 to 88% respectively. The height of the crops was in the range of 2.6 to 48 cm in magnesite soil and 3 to 33 cm in bauxite soil. Thus the study shows that both mine soils reflects some physical and biomolecule impact on selected crops.

Contamination of rice (Oryza sativa L) with Cadmium and Arsenic by irrigation with the Bogota River water in rice soils of the Lower Basin

International Nuclear Information System (INIS)

Montenegro, Omar; Mejia L

2001-01-01

In this study, field and greenhouse experiments were simultaneously carried out with rice (oryza sativa l., variedad oryzica-1) in soils of the Bogota River lower basin (Los Manueles Series, a member of the clayed, mixed, isohipertermic family of the Fluventic Vertic Haplustepts) to evaluate the effect of Cd and As content of the irrigation waters (of the Bogota River and greenhouse) on soils and: 1) rice growth physiological parameters; 2) Cd and As accumulated in different parts of rice plants; 3) yields and other aspects and properties of rice crop. The results lead to the following conclusions: 1) The Cd and As content of the Bogota River water, increased during the driest months and was minimum in those with the highest precipitation; Cd and As concentrations in both seasons surpassed the maximum permissible limits. 2) Rice height was highest when irrigation water does have neither Cd nor As. Effects of both elements showed an inverse lineal tendency. 3) The gradual increase of Cd in irrigation water reduced in 12.5% the number of grains per panicle; the increase of As induced a 10% reduction. 4) The highest concentration of Cd and As in irrigation waters significantly reduced yields; maximum yields l were obtained when Cd and As were absent from irrigation waters. 5) For any concentration of As in irrigation water the highest concentration of Cd was accumulated in rice leafs when concentration of Cd 2 was 2mg/l; above this value Cd accumulation in leafs el decreased with the gradual increase of As concentration. 6) Cd and As accumulated in rice grains increased with the gradual increment of both elements in the irrigation waters; Cd and As accumulated were respectively 50 and 15 times higher than the maximum critical levels proposed for rice grains. 7) Cd and As accumulated progressively on soils with gradual increase of both elements in irrigation waters 8) Cd and As concentration in irrigation waters apparently does not affect the rice mill behavior

Expression of salt-induced 2-Cys peroxiredoxin from Oryza sativa increases stress tolerance and fermentation capacity in genetically engineered yeast Saccharomyces cerevisiae.

Science.gov (United States)

Kim, Il-Sup; Kim, Young-Saeng; Yoon, Ho-Sung

2013-04-01

Peroxiredoxins (Prxs), also termed thioredoxin peroxidases (TPXs), are a family of thiol-specific antioxidant enzymes that are critically involved in cell defense and protect cells from oxidative damage. In this study, a putative chloroplastic 2-Cys thioredoxin peroxidase (OsTPX) was identified by proteome analysis from leaf tissue samples of rice (Oryza sativa) seedlings exposed to 0.1 M NaCl for 3 days. To investigate the relationship between the OsTPX gene and the stress response, OsTPX was cloned into the yeast expression vector p426GPD under the control of the glyceraldehyde-3-phosphate dehydrogenase (GPD1) promoter, and the construct was transformed into Saccharomyces cerevisiae cells. OsTPX expression was confirmed by semi-quantitative reverse transcription-polymerase chain reaction and western blot analyses. OsTPX contained two highly conserved cysteine residues (Cys114 and Cys236) and an active site region (FTFVCPT), and it is structurally very similar to human 2-Cys Prx. Heterologous OsTPX expression increased the ability of the transgenic yeast cells to adapt and recover from reactive oxygen species (ROS)-induced oxidative stresses, such as a reduction of cellular hydroperoxide levels in the presence of hydrogen peroxide and menadione, by improving redox homeostasis. OsTPX expression also conferred enhanced tolerance to tert-butylhydroperoxide, heat shock, and high ethanol concentrations. Furthermore, high OsTPX expression improved the fermentation capacity of the yeast during glucose-based batch fermentation at a high temperature (40 °C) and at the general cultivation temperature (30 °C). The alcohol yield in OsTPX-expressing transgenic yeast increased by approximately 29 % (0.14 g g(-1)) and 21 % (0.12 g g(-1)) during fermentation at 40 and 30 °C, respectively, compared to the wild-type yeast. Accordingly, OsTPX-expressing transgenic yeast showed prolonged cell survival during the environmental stresses produced during fermentation. These

PHYTOCHEMICAL STUDY OF A TINCTORIAL PLANT OF BENIN TRADITIONAL PHARMACOPOEIA: THE RED SORGHUM (Sorghum caudatum OF BENIN

Directory of Open Access Journals (Sweden)

PASCAL D. C. AGBANGNAN

2012-06-01

Full Text Available The full phytochemical screening of red sorghum from Benin (Sorghum caudatum achieved in this work reveals the presence of leucoanthocyanins, flavonoides, free quinones, combined anthracene derivatives, sterols and terpenes in higher concentration in the leaf sheath and marrow of stem than in the seed. Catechin tannin content is 11.4% in the leaf sheath (slightly higher than that of red wine, 5.8% in the marrow and 2.8% in the seed. Gallic tannins, saponins and the mucilage present in the leaf sheath and marrow, are virtually absent in the seed. Marrow and leaf sheath extracts (1 g/50 mL showed a concentration of anthocyanins (147 mg/L and 213.5 mg/L similar to that of rosy wine and red wine with short maceration. The grain of sorghum is four times, respectively two times less rich in phenolic compounds than the leaf sheath and the marrow of stem.

Main: 1FWO [RPSD[Archive

Lifescience Database Archive (English)

Full Text Available 1FWO イネ Rice Oryza sativa L. Oryzain Beta Chain Precursor Oryza Sativa Molecule: Oryzain Beta Chain; Chai...eered: Yes; Mutation: Yes Hydrolase 3.4.22.- (Oryzain Beta Chain) D.Tolkatchev, P.Xu, F.Ni D.Tolkatchev, P.X...olds Into A Stack Of Two Beta-Hairpins, A Scaffold Present In The Emerging Family Of Granulin-Like Growth Fa...ctors J.Pept.Res. V. 57 227 2001 Beta-Hairpin Stack Fold, Granulin/Epithelin-Like Protein Repeats SWS:ORYB_O

Mutation breeding in sorghum (sorghum bicolor L.) for improving plant as ruminant feed

International Nuclear Information System (INIS)

H, Soeranto

1998-01-01

Mutation breeding using gamma irradiation in sorghum was aimed at improving the quality and production of sorghum plant as ruminant feed. Seeds of local sorghum variety Keris with moisture of about 14% were irradiated with gamma rays from Cobalt-60 source using the dose levels up to 0.5 kgy. The MI plant were grown in Pasar Jumat, the M2 and M3 were grown in Citayam experimental station. The M2 plants were harvested 40 days after sowing by cutting plants 20 cm above ground surface. Two weeks later observations for the ability of plants to produce new buds (buds variable). The plants green products in green products in from of their dry weight (product variable) were collected 40 days after harvesting and drying process in oven at 105 0 C for 24 hours. Plant selections with intensity of 20% were done for the bud variable among samples of M2 plants. Selection responses in the M3 were found to vary from the lowest at 0.5 kgy population (R s = 0.8507). The share of genetic factors to selection responses in bud variable varied from 7.25% at 0,5 kgy population to 22.35% at 0.3 kgy population. Selection for bud variable gave directly impact in increasing product variable in the M3. (author)

Sorghum bi-color

African Journals Online (AJOL)

sunny

2014-11-12

Nov 12, 2014 ... Biomass materials require reduction and densification for the purpose of handling and space requirements. Guinea corn (Sorghum bi-color) is a major source of biomass material in the tropic regions. The densification process involves some ... a closed-end die, the temperature and the use of binder.

NDVI to Detect Sugarcane Aphid Injury to Grain Sorghum.

Science.gov (United States)

Elliott, N C; Backoulou, G F; Brewer, M J; Giles, K L

2015-06-01

Multispectral remote sensing has potential to provide quick and inexpensive information on sugarcane aphid, Melanaphis sacchari (Zehntner), pest status in sorghum fields. We describe a study conducted to determine if injury caused by sugarcane aphid to sorghum plants in fields of grain sorghum could be detected using multispectral remote sensing from a fixed wing aircraft. A study was conducted in commercial grain sorghum fields in the Texas Gulf Coast region in June 2014. Twenty-six commercial grain sorghum fields were selected and rated for the level of injury to sorghum plants in the field caused by sugarcane aphid. Plant growth stage ranged from 5.0 (watery ripe) to 7.0 (hard dough) among fields; and plant injury rating from sugarcane aphid ranged from 1.0 (little or no injury) to 4.0 (>40% of plants displaying injury) among fields. The normalized differenced vegetation index (NDVI) is calculated from light reflectance in the red and near-infrared wavelength bands in multispectral imagery and is a common index of plant stress. High NDVI indicates low levels of stress and low NDVI indicates high stress. NDVI ranged from -0.07 to 0.26 among fields. The correlation between NDVI and plant injury rating was negative and significant, as was the correlation between NDVI and plant growth stage. The negative correlation of NDVI with injury rating indicated that plant stress increased with increasing plant injury. Reduced NDVI with increasing plant growth probably resulted from reduced photosynthetic activity in more mature plants. The correlation between plant injury rating and plant growth stage was positive and significant indicating that plant injury from sugarcane aphid increased as plants matured. The partial correlation of NDVI with plant injury rating was negative and significant indicating that NDVI decreased with increasing plant injury after adjusting for its association with plant growth stage. We demonstrated that remotely sensed imagery acquired from grain

Electrochemical evaluation of sweet sorghum fermentable sugar bioenergy feedstock

Science.gov (United States)

Redox active constituents of sorghum, e.g., anthocyanin, flavonoids, and aconitic acid, putatively contribute to its pest resistance. Electrochemical reactivity of sweet sorghum stem juice was evaluated using cyclic voltammetry (CV) for five male (Atlas, Chinese, Dale, Isidomba, N98) and three fema...

OsLOL1, a C2C2-type zinc finger protein, interacts with OsbZIP58 to promote seed germination through the modulation of gibberellin biosynthesis in Oryza sativa.

Science.gov (United States)

Wu, Jiahe; Zhu, Chuanfeng; Pang, Jinhuan; Zhang, Xiangrong; Yang, Chunlin; Xia, Guixian; Tian, Yingchuan; He, Chaozu

2014-12-01

Seed germination is a key developmental process in the plant life cycle that is influenced by various environmental cues and phytohormones through gene expression and a series of metabolism pathways. In the present study, we investigated a C2C2-type finger protein, OsLOL1, which promotes gibberellin (GA) biosynthesis and affects seed germination in Oryza sativa (rice). We used OsLOL1 antisense and sense transgenic lines to explore OsLOL1 functions. Seed germination timing in antisense plants was restored to wild type when exogenous GA3 was applied. The reduced expression of the GA biosynthesis gene OsKO2 and the accumulation of ent-kaurene were observed during germination in antisense plants. Based on yeast two-hybrid and firefly luciferase complementation analyses, OsLOL1 interacted with the basic leucine zipper protein OsbZIP58. The results from electrophoretic mobility shift and dual-luciferase reporter assays showed that OsbZIP58 binds the G-box cis-element of the OsKO2 promoter and activates LUC reporter gene expression, and that interaction between OsLOL1 and OsbZIP58 activates OsKO2 gene expression. In addition, OsLOL1 decreased SOD1 gene expression and accelerated programmed cell death (PCD) in the aleurone layer of rice grains. These findings demonstrate that the interaction between OsLOL1 and OsbZIP58 influences GA biosynthesis through the activation of OsKO2 via OsbZIP58, thereby stimulating aleurone PCD and seed germination. © 2014 The Authors The Plant Journal © 2014 John Wiley & Sons Ltd.

Utilization of Iles-Iles and Sorghum Starch for Bioethanol Production

Directory of Open Access Journals (Sweden)

Kusmiyati Kusmiyati

2014-05-01

Full Text Available The aims of this study were to convert the starches from iles-iles tubers (Amorphophalus campanulatus and sorghum grains (Sorghum bicolor L into bioethanol as an alternative energy. Both of these agricultural products contains a high content starches and they do not use as the major foods in Indonesia. To find out the maximum ethanol concentration and yield, both the raw materials were converted to ethanol on various process variables including the concentration of flour substrate solution (100-300 g/L, β-amylase enzyme concentration (0.8 - 6.4 ml/kg of flour , the  concentration of dry yeast S. cerevisiae (2-15 g, and fermentation time (72-168 hours. The results showed that at the flour substrate concentration of 250 g/L produced the maximum ethanol contents of 100.29 g/L and 95.11 g/L   for iles-iles and sorghum, respectively. Effect of β-amylase enzyme in the saccharification process showed that at concentration  of 3.2 ml/kg  the maximum reducing sugar content of 204.94 g/L and 193.15 g/L  for iles-iles and sorghum substrate, respectively were generated therefore it was corresponding to the maximum ethanol production. The concentration effect of dry yeast S. cerevisiae in the fermentation stage for the iles-iles and sorghum substrate revealed that the maximum ethanol obtained at 5 g yeast activated in 100 ml medium starter resulted the highest ethanol content 100.29 g/L 95.11 g/L for iles-iles and sorghum substrate, respectively. To determine the effect of fermentation time on ethanol yield from iles-iles and sorghum substrate, the fermentation process were performed at 3, 5, and 7 days. The maximum ethanol fermentation was obtained at 5 days fermentation. The ethanol yield is calculated by weight of ethanol is formed (g divided by the weight of flour (g. Based on the experiment results, conducted, generally the highest ethanol yield of iles-iles was higher than that of sorghum flour. The highest yield (g/g iles-iles and sorghum

Improved annotation through genome-scale metabolic modeling of Aspergillus oryzae

DEFF Research Database (Denmark)

Vongsangnak, Wanwipa; Olsen, Peter; Hansen, Kim

2008-01-01

Background: Since ancient times the filamentous fungus Aspergillus oryzae has been used in the fermentation industry for the production of fermented sauces and the production of industrial enzymes. Recently, the genome sequence of A. oryzae with 12,074 annotated genes was released but the number...... to a genome scale metabolic model of A. oryzae. Results: Our assembled EST sequences we identified 1,046 newly predicted genes in the A. oryzae genome. Furthermore, it was possible to assign putative protein functions to 398 of the newly predicted genes. Noteworthy, our annotation strategy resulted...... model was validated and shown to correctly describe the phenotypic behavior of A. oryzae grown on different carbon sources. Conclusion: A much enhanced annotation of the A. oryzae genome was performed and a genomescale metabolic model of A. oryzae was reconstructed. The model accurately predicted...

Performance of elite grain sorghum varieties in the West Nile Agro ...

African Journals Online (AJOL)

ACSS

Ouma, J.P. and Akuja, T.E. 2013. Agronomic and morphological performance of sorghum (Sorghum bicolor L.) for the dry highlands of. Kenya. www.m.elewa.org. Schatz, B.G., Schneiter, A.A. and Gardner,. J.E. 1987. Effect of plant density on grain sorghum production in North. Dakota. pp. 16-17. Snider, J.L., Randy, L.R. and ...

Fungal endophytes of sorghum in Burkina Faso

DEFF Research Database (Denmark)

Zida, E P; Thio, I G; Néya, B J

2014-01-01

A survey was conducted to assess the natural occurrence and distribution of fungal endophytes in sorghum in relation to plant performance in two distinct agro-ecological zones in Burkina Faso. Sorghum farm-saved seeds were sown in 48 farmers’ fields in Sahelian and North Sudanian zones to produce...... sorghum plants. In each field, leaf samples were collected from five well-developed (performing) and five less-developed (non-performing) plants at 3-5 leaf stage, while at plant maturity leaf, stem and root samples were collected from the same plants and fungal endophytes were isolated. A total of 39...... fungal species belonging to 25 genera were isolated. The most represented genera included Fusarium, Leptosphaeria, Curvularia, Nigrospora and Penicillium. The genera Fusarium and Penicillium occurred significantly higher in performing plants as compared to non-performing plants while the genera...

Experimental study on bread yeast cultured in sweet sorghum juice

International Nuclear Information System (INIS)

Wang Jufang; Dong Xicun; Li Wenjian; Xiao Guoqing; Ma Liang; Gao Feng

2008-01-01

As a substitute for food supplies, sweet sorghum juice with high grade has demonstrated out- standing advantage in fermentation. To obtain the optimized fermentation conditions, the growth, the bio- mass of bread yeast cultured in sweet sorghum juice and total residual sugar were investigated in the paper. The fermentation was performed and optimized in a 10-100 1 bio-reactor. The results show that the application of sweet sorghum juice in bread yeast production is very potential. (authors)

Sorghum stem yield and soluble carbohydrates under different ...

African Journals Online (AJOL)

STORAGESEVER

2008-11-19

Nov 19, 2008 ... The aim of this study was to select the most suitable cultivar for salty land in this geographical area. Two sweet sorghum cultivars (Keller and Sofra) and one grain sorghum cultivar (Kimia) were grown in greenhouse benches under four salinity levels of 2, 4, 8 and 12 dSm-1 to evaluate the effects of salinity.

Morphological characteristics of BRS 501 sweet sorghum under water stress

Directory of Open Access Journals (Sweden)

Luciano Rezende Moreira

2016-12-01

Full Text Available Sorghum [Sorghum bicolor (L. Moench] crop is distinguished from other crops for its tolerance to both water deficit and excess soil moisture, under very dry and/or very hot environmental situations in which the productivity of other cereals becomes uneconomical. This work was conducted to evaluate the effects of irrigation on root conformation at the initial development phase of sweet sorghum. So, BRS 501 cv. was subjected to four irrigation levels based on 80%, 60%, 40% and 20% of the field capacity (CC. The decreased availability of water in the soil negatively affected the majority of the characteristics under evaluation except for the relationship between the root system and the aerial part (SR/PA, average root diameter (DMR and specific root area (ARE. We concluded that the growth of sweet sorghum plants under evaluation is sensible to the decrease of water in the soil, as it is affected by low water availability. This methodology, common to other crops, can be used for saccharine sorghum in order to establish hydric availabilities in new experiments to discriminate the drought-tolerant cultivars.

Factors That Influence Technical Efficiency of Sorghum Production: A Case of Small Holder Sorghum Producers in Lower Eastern Kenya

Directory of Open Access Journals (Sweden)

Evaline Chepng’etich

2015-01-01

Full Text Available Majority of the rural households in Kenya depend on agriculture as a source of food and livelihood. Agricultural productivity has been declining due to many factors resulting in increased food insecurity in the country. Consequently, there is a renewed interest in promoting drought-tolerant crops such as sorghum which thrives in the arid and semiarid lands of the developing world. However, performance of sorghum production among the smallholder farmers has still remained low. This study was thus carried out to identify factors that influence technical efficiency of sorghum production among smallholder farmers in Machakos and Makindu districts of the lower eastern Kenya. Collected data on farm and farmer characteristics were analysed by use of descriptive statistics and Tobit model. Result highlights show that technical efficiency was influenced positively by formal education level of the household, experience in sorghum farming, membership in farmers associations, use of hired labour, production advice, and use of manure. Surprisingly household size, meant to enhance labour, had a negative influence. To increase technical efficiency, efforts should focus on improving information flows on agronomic practices. Farmers should also be encouraged to form and actively participate in various farmers associations, which enhance learning and pooling of labour resources, hence improving technical efficiency.

Energy sorghum--a genetic model for the design of C4 grass bioenergy crops.

Science.gov (United States)

Mullet, John; Morishige, Daryl; McCormick, Ryan; Truong, Sandra; Hilley, Josie; McKinley, Brian; Anderson, Robert; Olson, Sara N; Rooney, William

2014-07-01

Sorghum is emerging as an excellent genetic model for the design of C4 grass bioenergy crops. Annual energy Sorghum hybrids also serve as a source of biomass for bioenergy production. Elucidation of Sorghum's flowering time gene regulatory network, and identification of complementary alleles for photoperiod sensitivity, enabled large-scale generation of energy Sorghum hybrids for testing and commercial use. Energy Sorghum hybrids with long vegetative growth phases were found to accumulate more than twice as much biomass as grain Sorghum, owing to extended growing seasons, greater light interception, and higher radiation use efficiency. High biomass yield, efficient nitrogen recycling, and preferential accumulation of stem biomass with low nitrogen content contributed to energy Sorghum's elevated nitrogen use efficiency. Sorghum's integrated genetics-genomics-breeding platform, diverse germplasm, and the opportunity for annual testing of new genetic designs in controlled environments and in multiple field locations is aiding fundamental discovery, and accelerating the improvement of biomass yield and optimization of composition for biofuels production. Recent advances in wide hybridization between Sorghum and other C4 grasses could allow the deployment of improved genetic designs of annual energy Sorghums in the form of wide-hybrid perennial crops. The current trajectory of energy Sorghum genetic improvement indicates that it will be possible to sustainably produce biofuels from C4 grass bioenergy crops that are cost competitive with petroleum-based transportation fuels. © The Author 2014. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.

Sorghum - An alternative energy crop for marginal lands and reclamation sites

Science.gov (United States)

Lukas, Stefan; Theiß, Markus; Jäkel, Kerstin

2017-04-01

The production of biogas and the associated cultivation of energy crops are still of great importance. Considering increasing restrictions for the cultivation of standard biogas crop maize regarding an environmentally friendly production of biomass, a wider range of energy crops is needed. The cultivation of sorghum can contribute to this. As maize, sorghum is a C4-plant and offers a high biomass yield potential. Originated in the semi-arid tropics, sorghum is well adapted to warm and dry climate and particularly noted for its drought tolerance compared to maize. It also makes few demands on soil quality and shows a good capability of nutrient acquisition. Therefore, particularly on marginal areas and reclamation sites with low soil nutrient and water content sorghum can contribute to secure crop yield and income of farmers. The applied research project aims at and reflects on the establishment of sorghum as a profitable and ecological friendly cropping alternative to maize, especially in the face of probable climate change with increasing risks for agriculture. For this purpose, site differentiated growing and cultivar trials with a standardized planting design as well as several practical on-farm field experiments were conducted. The agronomical and economic results will lead to scientifically based procedures and standards for agricultural practice with respect to cultivation methods (drilling, pest-management, fertilization), cropping sequence and technique, cropping period or position in crop rotation. Even by now there is a promising feedback from the agricultural practice linked with an increasing demand for information. Moreover, the specific cropping area is increasing continuously. Therefore, the leading signs for the establishment of sorghum as profitable alternative to maize biogas production are positive. Sorghum cultures perform best as main crops in the warm D locations in the middle and East German dry areas. Here, the contribution margin

Management of rice seed during insurgency : a case study in Sierra Leone

NARCIS (Netherlands)

Mokuwa, G.A.

2015-01-01

Keywords: Technography, Oryza glaberrima, Oryza sativa, farmer hybrids, sub-optimal agriculture, farmer adaptive management, plant genetic resources, peace and extreme (wartime) conditions, local seed channels, selection for robustness, Sierra Leone, West Africa.

Antimicrobial evaluation of red, phytoalexin-rich sorghum food biocolorant

NARCIS (Netherlands)

Akogou, Folachodé U.G.; Besten, Den Heidy M.W.; Polycarpe Kayodé, A.P.; Fogliano, Vincenzo; Linnemann, Anita R.

2018-01-01

Sorghum (Sorghum bicolor) extract is traditionally used as red biocolorant in West Africa to colour foods, among which wagashi, a soft cheese. This biocolorant is a source of the phytoalexin apigeninidin and phenolic acids, and users claim that it has preservative effects next to its colouring

The Effect of Salicylic Acid and Gibberellin on Seed Reserve Utilization, Germination and Enzyme Activity of Sorghum (Sorghum bicolor L. Seeds Under Drought Stress

Directory of Open Access Journals (Sweden)

Roghayyeh Sheykhbaglou

2014-03-01

Full Text Available Seed priming methods have been used to increases germination characteristics under stress conditions. The study aimed was to determine the effect of salicylic acid and gibberellin on seed reserve utilization, germination and enzyme activity of sorghum (Sorghum bicolor L. seeds under drought stress. Factorial experiment was carried out in completely randomized design with three replications. The first factor was the seed treatments (unpriming, salicylic acid and gibberellin and the second factor was drought stress (0, -4, -8 and -12 bar. The results indicated that for these traits: germination percentage, germination index, weight of utilized (mobilized seed, seed reserve utilization efficiency, seedling dry weight and seed reserve depletion percentage was a significant treatment Ч drought interaction. Thus priming improved study traits in Sorghum (Sorghum bicolor L. seeds under drought stress. Also, priming improves enzyme activity as compared to the unprimed seeds.

Transcriptome Analysis of Salt Stress Responsiveness in the Seedlings of Dongxiang Wild Rice (Oryza rufipogon Griff.).

Science.gov (United States)

Zhou, Yi; Yang, Ping; Cui, Fenglei; Zhang, Fantao; Luo, Xiangdong; Xie, Jiankun

2016-01-01

Dongxiang wild rice (Oryza rufipogon Griff.) is the progenitor of cultivated rice (Oryza sativa L.), and is well known for its superior level of tolerance against cold, drought and diseases. To date, however, little is known about the salt-tolerant character of Dongxiang wild rice. To elucidate the molecular genetic mechanisms of salt-stress tolerance in Dongxiang wild rice, the Illumina HiSeq 2000 platform was used to analyze the transcriptome profiles of the leaves and roots at the seedling stage under salt stress compared with those under normal conditions. The analysis results for the sequencing data showed that 6,867 transcripts were differentially expressed in the leaves (2,216 up-regulated and 4,651 down-regulated) and 4,988 transcripts in the roots (3,105 up-regulated and 1,883 down-regulated). Among these differentially expressed genes, the detection of many transcription factor genes demonstrated that multiple regulatory pathways were involved in salt stress tolerance. In addition, the differentially expressed genes were compared with the previous RNA-Seq analysis of salt-stress responses in cultivated rice Nipponbare, indicating the possible specific molecular mechanisms of salt-stress responses for Dongxiang wild rice. A large number of the salt-inducible genes identified in this study were co-localized onto fine-mapped salt-tolerance-related quantitative trait loci, providing candidates for gene cloning and elucidation of molecular mechanisms responsible for salt-stress tolerance in rice.

Karakteristik Sensori dan Fisiko-Kimia Beras Analog Sorghum dengan Penambahan Rempah Campuran