Ma, Ni; Li, Zai-Yun; Cartagena, J A; Fukui, K
2006-10-01
New Brassica napus inbred lines with different petal colors and with canola quality and increased levels of oleic (approximately 70%, 10% higher than that of B. napus parent) and linoleic (28%) acids have been developed in the progenies of one B. napus cv. Oro x Orychophragmus violaceus F5 hybrid plant (2n = 31). Their genetic constituents were analyzed by using the methods of genomic in situ hybridization (GISH) and amplified fragments length polymorphism (AFLP). No intact chromosomes of O. violaceus origin were detected by GISH in their somatic cells of ovaries and root tips (2n = 38) and pollen mother cells (PMCs) with normal chromosome pairing (19 bivalents) and segregation (19:19), though signals of variable sizes and intensities were located mainly at terminal and centromeric parts of some mitotic chromosomes and meiotic bivalents at diakinesis or chromosomes in anaphase I groups and one large patch of chromatin was intensively labeled and separated spatially in some telophase I nuclei and metaphase II PMCs. AFLP analysis revealed that substantial genomic changes have occurred in these lines and O. violaceus-specific bands, deleted bands in 'Oro' and novel bands for two parents were detected. The possible mechanisms for these results were discussed.
Directory of Open Access Journals (Sweden)
Yi Yang
2017-09-01
Full Text Available Seeds per silique (SS, seed weight (SW, and silique length (SL are important determinant traits of seed yield potential in rapeseed (Brassica napus L., and are controlled by naturally occurring quantitative trait loci (QTLs. Mapping QTLs to narrow chromosomal regions provides an effective means of characterizing the genetic basis of these complex traits. Orychophragmus violaceus is a crucifer with long siliques, many SS, and heavy seeds. A novel B. napus introgression line with many SS was previously selected from multiple crosses (B. rapa ssp. chinesis × O. violaceus × B. napus. In present study, a doubled haploid (DH population with 167 lines was established from a cross between the introgression line and a line with far fewer SS, in order to detect QTLs for silique-related traits. By screening with a Brassica 60K single nucleotide polymorphism (SNP array, a high-density linkage map consisting of 1,153 bins and spanning a cumulative length of 2,209.1 cM was constructed, using 12,602 high-quality polymorphic SNPs in the DH population. The average recombination bin densities of the A and C subgenomes were 1.7 and 2.4 cM, respectively. 45 QTLs were identified for the three traits in all, which explained 4.0–34.4% of the total phenotypic variation; 20 of them were integrated into three unique QTLs by meta-analysis. These unique QTLs revealed a significant positive correlation between SS and SL and a significant negative correlation between SW and SS, and were mapped onto the linkage groups A05, C08, and C09. A trait-by-trait meta-analysis revealed eight, four, and seven consensus QTLs for SS, SW, and SL, respectively, and five major QTLs (cqSS.A09b, cqSS.C09, cqSW.A05, cqSW.C09, and cqSL.C09 were identified. Five, three, and four QTLs for SS, SW, and SL, respectively, might be novel QTLs because of the existence of alien genetic loci for these traits in the alien introgression. Thirty-eight candidate genes underlying nine QTLs for silique
Gautam, Mayank; Dang, Yanwei; Ge, Xianhong; Shao, Yujiao; Li, Zaiyun
2016-01-01
Allopolyploidization with the merger of the genomes from different species has been shown to be associated with genetic and epigenetic changes. But the maintenance of such alterations related to one parental species after the genome is extracted from the allopolyploid remains to be detected. In this study, the genome of Brassica napus L. (2n = 38, genomes AACC) was extracted from its intergeneric allohexaploid (2n = 62, genomes AACCOO) with another crucifer Orychophragmus violaceus (2n = 24, genome OO), by backcrossing and development of alien addition lines. B. napus-type plants identified in the self-pollinated progenies of nine monosomic additions were analyzed by the methods of amplified fragment length polymorphism, sequence-specific amplified polymorphism, and methylation-sensitive amplified polymorphism. They showed modifications to certain extents in genomic components (loss and gain of DNA segments and transposons, introgression of alien DNA segments) and DNA methylation, compared with B. napus donor. The significant differences in the changes between the B. napus types extracted from these additions likely resulted from the different effects of individual alien chromosomes. Particularly, the additions which harbored the O. violaceus chromosome carrying dominant rRNA genes over those of B. napus tended to result in the development of plants which showed fewer changes, suggesting a role of the expression levels of alien rRNA genes in genomic stability. These results provided new cues for the genetic alterations in one parental genome that are maintained even after the genome becomes independent.
Directory of Open Access Journals (Sweden)
Mayank eGautam
2016-04-01
Full Text Available ABSTRACT Allopolyploidization with the merger of the genomes from different species has been shown to be associated with genetic and epigenetic changes. But the maintenance of such alterations related to one parental species after the genome is extracted from the allopolyploid remains to be detected. In this study, the genome of Brassica napus L. (2n=38, genomes AACC was extracted from its intergeneric allohexaploid (2n=62, genomes AACCOO with another crucifer Orychophragmus violaceus (2n=24, genome OO, by backcrossing and development of alien addition lines. B. napus-type plants identified in the self-pollinated progenies of nine monosomic additions were analyzed by the methods of amplified fragment length polymorphism (AFLP, sequence-specific amplified polymorphism (SSAP, and methylation-sensitive amplified polymorphism (MSAP. They showed modifications to certain extents in genomic components (loss and gain of DNA segments and transposons, introgression of alien DNA segments and DNA methylation, compared with B. napus donor. The significant differences in the changes between the B. napus types extracted from these additions likely resulted from the different effects of individual alien chromosomes. Particularly, the additions which harbored the O. violaceus chromosome carrying dominant rRNA genes over those of B. napus tended to result in the development of plants which showed fewer changes, suggesting a role of the expression levels of alien rRNA genes in genomic stability. These results provided new cues for the genetic alterations in one parental genome that are maintained even after the genome becomes independent.
Molecular cloning and characterization of the plasma membrane ...
African Journals Online (AJOL)
User
2011-05-09
May 9, 2011 ... Southern blot analysis indicated that OvPIP gene was present in O. ... Key words: Orychophragmus violaceus, plasma membrane, tonoplast aquaporins .... fractionated by 0.8% agarose gel electrophoresis and transferred to.
(OvRCI) from Orychophragmus violaceus
African Journals Online (AJOL)
STORAGESEVER
1 дек 2009 ... ... to increase plant cells salt-tolerance under salt conditions by metabolic .... then synthesized into 1st strand cDNA using a Reverse-Trans- cription Kit ..... models, and the metabolic engineering of complex traits. In Genetic.
A plant defensin gene from Orychophragmus violaceus can improve ...
African Journals Online (AJOL)
PRECIOUS
2009-11-16
Nov 16, 2009 ... seedlings and plants from attacking of soil-bore patho- gens (Terras et al., ..... The boxes were covered with plastic film and then kept at. 20°C in dark. ... form four structure-stabilizing disulfide bridges as reported before which ...
A plant defensin gene from Orychophragmus violaceus can improve ...
African Journals Online (AJOL)
Quantitative RT-PCR showed that the expression of Ovd in the sense plant line was stronger than non-transformed plant and antisense plant. The lesion size on detached leaves of the transgenic plants and nontransformed control caused by Sclerotinia sclerotiorum mycelia was examined. Lesion size was reduced in sense ...
Directory of Open Access Journals (Sweden)
Huan Hu
2016-12-01
Full Text Available IntroductionIt is rather difficult to delimit recently diverged species and construct their interspecific relationships because of insufficient informative variations of sampled DNA fragments (Schluter, 2000; Arnold, 2006. The genome-scale sequence variations were found to increase the phylogenetic resolutions of both high- and low-taxonomic groups (e.g., Yoder et al., 2013; Lamichhaney et al., 2015. It is still expensive to collect nuclear genome variations between species for most none-model genera without the reference genome. However, chloroplast genomes (plastome are relatively easy to be assembled to examine interspecific relationships for phylogenetic analyses, especially in addressing unresolved relationship at low taxonomic levels (Wu et al., 2010; Nock et al., 2011; Yang et al., 2013; Huang et al., 2014; Carbonell-Caballero et al., 2015. Plastomes are haploid with maternal inheritance in most angiosperms (Corriveau and Coleman, 1988; Zhang and Liu, 2003; Hagemann, 2004 and are highly conservative in gene order and genome structure with rare recombinations (Jansen et al., 2007; Moore et al., 2010. In this study, we aimed to examine species delimitation and interspecific relationships in Orychophragmus through assembling chloroplast genomes of multiple individuals of tentatively delimited species (Hu et al., 2015a. Orychophragmus is a small genus in the mustard family (Brassicaceae, Cruciferae distributed in northern, central, and southeastern China (Zhou et al., 2001. Its plants have been widely cultivated as ornamentals, vegetables, or source of seed oil (Sun et al., 2011. Despite controversial species delimitations in the genus (Zhou et al., 1987; Tan et al., 1998; Wu and Zhao, 2003; Al-Shehbaz and Yang, 2000; Zhou et al., 2001; Sun et al., 2012, our recent study based on nuclear (nr ITS sequence variations suggested the recognition of seven species (Hu et al., 2015a. Orychophragmus is sister to Sinalliaria, which is a genus endemic
Directory of Open Access Journals (Sweden)
LUIZ R. ZAMITH
2013-06-01
Full Text Available Melocactus violaceus is an endangered species due to habitat destruction and the overcollection of this species for ornamental use. The aim of this study was to test the effect of different temperatures on the germination of M. violaceus. Three treatments were conducted: a constant temperature of 25ºC, a 20-35ºC alternating temperature, both inside germination chamber, and an alternating temperature under room temperature (mean temperature ranged from 25-37ºC. The final seed germination rates at the alternating temperature treatments were not significantly different (65% in the seed germinator and 62.5% at room condition. However, both treatments with alternating temperatures had significantly higher germination rates compared to the treatment kept at the constant temperature (8%. Our study showed that alternating temperatures between 20 and 37ºC provides satisfactory conditions to induce a high percentage of seed germination of M. violaceus, without the passage of seeds through the digestive tract of its natural disperser, the lizard Tropidurus torquatus. This condition contributes to efficiently producing seedlings that can be reintroduced into conservation areas or used as ornamentals that may help reduce the overcollection of the remaining native populations.
Zamith, Luiz R; Cruz, Denise D; Richers, Bárbara T T
2013-01-01
Melocactus violaceus is an endangered species due to habitat destruction and the overcollection of this species for ornamental use. The aim of this study was to test the effect of different temperatures on the germination of M. violaceus. Three treatments were conducted: a constant temperature of 25ºC, a 20-35ºC alternating temperature, both inside germination chamber, and an alternating temperature under room temperature (mean temperature ranged from 25-37ºC). The final seed germination rates at the alternating temperature treatments were not significantly different (65% in the seed germinator and 62.5% at room condition). However, both treatments with alternating temperatures had significantly higher germination rates compared to the treatment kept at the constant temperature (8%). Our study showed that alternating temperatures between 20 and 37ºC provides satisfactory conditions to induce a high percentage of seed germination of M. violaceus, without the passage of seeds through the digestive tract of its natural disperser, the lizard Tropidurus torquatus. This condition contributes to efficiently producing seedlings that can be reintroduced into conservation areas or used as ornamentals that may help reduce the overcollection of the remaining native populations.
Directory of Open Access Journals (Sweden)
Jinwei Zhou
2017-05-01
Full Text Available This study reported the efficacy of the metabolites of Plectosphaerella cucumerina, one phyllosphere fungus from Orychophragmus violaceus, against Pseudomonas aeruginosa quorum sensing (QS and QS-regulated biofilms. The minimum inhibitory concentration (MIC of the ethyl acetate (EtOAc extract from P. cucumerina against P. aeruginosa PAO1 was 1.25 mg mL−1. At sub-MIC concentrations, P. cucumerina extract (0.25–1 mg mL−1 not only inhibited biofilm formation but also disrupted preformed biofilms of P. aeruginosa PAO1 without affecting its growth. Fluorescence and scanning electron microscope (SEM showed architectural disruption of the biofilms when treated with P. cucumerina metabolites. Further investigation demonstrated that metabolites in P. cucumerina attenuated the QS-dependent virulence factors. LC-MS/MS spectra coupled with experimentally standard samples suggested that patulin and emodin might act as the principal components possessing anti-biofilm and antivirulence activities. This is the first report of (1 the isolation of P. cucumerina from the phyllosphere of O. violaceus and (2 anti-biofilm, antivirulence, and biofilm disruption activities of this fungus. Thus, this study provides fascinating new pathways for screening antipathogenic agents.
Directory of Open Access Journals (Sweden)
Andrea Matern
2011-05-01
Full Text Available Only very few cases have documented that an increase in connectivity after a period of fragmentation in ecological time has had an effect on the distribution, genetic structure and morphology of stenotopic species. In this study we present an example of clinal variability in a woodland ground beetle as a result of changes in the connectivity of a landscape during the last two centuries. The study area hosts both the nominate form C. violaceus s. str. and the subspecies C. v. purpurascens, which is ranked as a distinct species by some authors. We studied 12 Carabus violaceus populations from a 30 km transect of ancient and recent forests in north-western Germany. We analyzed three polymorphic enzyme loci, classified the elytron sculpture and measured the shape of the aedeagus tip of the specimens. C. violaceus showed secondary gradients both in allozyme markers and morphometric characters in our study area. A genetic differentiation of 16% between the populations is high but lies within the range of intraspecific variability in habitat specialists of the genus Carabus. Populations had no significant deficit of heterozygotes. We found many hybrid populations in terms of morphological properties. This study highlights the conservation value of ancient woodland and the consequences of landscape connectivity and defragmentation on the genetic setting of a ground beetle. Moreover, it shows that differences in the external shape of male genitalia do not prevent gene flow within the genus Carabus. Thus, the establishment of species status should not exclusively be based on this property.
Molecular cloning and characterization of the plasma membrane ...
African Journals Online (AJOL)
O. violaceus) was cloned. The full-length cDNA of O. violaceus gene (OvPIP) was 1314 bp and contained 1188 open reading frame encoding a protein of 395 amino acids. Homology analysis revealed that OvPIP strongly resembled other PIP ...
Origin of new Brassica types from a single intergeneric hybrid ...
Indian Academy of Sciences (India)
Origin of new Brassica types from a single intergeneric hybrid between B. rapa and Orychophragmus ... The morphological and genetic divergence of these novel types derived from a single hybrid is probably due ... Journal of Genetics | News.
ORF Alignment: NC_005125 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Gloeobacter violaceus PCC 7421] ... Length = 118 ... Query: 4 ... ILVIEDDALVRESVLEVLEAQGFRAIG...AQNGQVGLRLAEEHLPDLILCDILMPGLDGYAV 63 ... ILVIEDDALVRESVLEVLEAQGFRAIGAQNGQV...GLRLAEEHLPDLILCDILMPGLDGYAV Sbjct: 1 ... ILVIEDDALVRESVLEVLEAQGFRAIGAQNGQVGLRLAEEHLPDLILCDILMPGLDGYAV 60 ...
ORF Alignment: NC_005125 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Gloeobacter violaceus PCC 7421] ... Length = 128 ... Query: 161 VQYAWIFSYPGSETQVSELHLPIGRPVRMDMKSNDVI...HAFWVPEFRLKQDVIPGRTTQVS 220 ... VQYAWIFSYPGSETQVSELHLPIGRPVRMDMKSNDVI...HAFWVPEFRLKQDVIPGRTTQVS Sbjct: 9 ... VQYAWIFSYPGSETQVSELHLPIGRPVRMDMKSNDVIHAFWVPEFRLKQDVIPGRTTQVS 68 ...
ORF Alignment: NC_005125 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available dine ... kinase [Gloeobacter violaceus PCC 7421] ... Length = 70 ... Query: 286 MLGRLEGAFQTQRHFVNEVSHELRTPLTIIRGHLELIGDDPH...ERAETMHIVHDELGRMHR 345 ... MLGRLEGAFQTQRHFVNEVSHELRTPLTIIRGHLELIGDDPHE...RAETMHIVHDELGRMHR Sbjct: 1 ... MLGRLEGAFQTQRHFVNEVSHELRTPLTIIRGHLELIGDDPHERAETMHIVHDELGRMHR 60 ...
ORF Alignment: NC_005125 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... violaceus PCC 7421] ... Length = 132 ... Query: 1 ... MELIAVVAMDSRRLIGRGDGLPWHCPEDLSAFKALTWGQPLLMGRRTFESILAR...RGKPLP 60 ... MELIAVVAMDSRRLIGRGDGLPWHCPEDLSAFKALTWGQPLLMGRRTFESILAR...RGKPLP Sbjct: 1 ... MELIAVVAMDSRRLIGRGDGLPWHCPEDLSAFKALTWGQPLLMGRRTFESILARRGKPLP 60 ... Query: 121 GLHTGDVFLPDL 132 ... GLHTGDVFLPDL Sbjct: 121 GLHTGDVFLPDL 132
Directory of Open Access Journals (Sweden)
Carlos Eduardo de Alvarenga Júlio
2002-12-01
Full Text Available The genus Cyclopeplus Thomson, 1860 is revised. New synonyms proposed: C. violaceus Lane, 1957 = C. peruvianas Tippmann, 1939 and C. germaini Gounelle, 1906 = C. lacordairei Thomson, 1868. The five species of Cyclopeplus are keyed, redescribed and illustrated.
Molecular cloning and characterization of a new peroxidase gene ...
African Journals Online (AJOL)
length cDNA of O.violaceus peroxidase gene (OvRCI, GenBank. Acc. No. AY428037) was 1220 bp and contained an 1128 bp open reading frame encoding a protein of 375 amino acids. Homology analysis and molecular modeling revealed that ...
The response of Cyperus papyrus (L.) and Miscanthidium violaceum ...
African Journals Online (AJOL)
Interrelationships between nutrient concentrations and aerial biomass, root numbers, length and rhizomes size in Cyperus papyrus (L.) (papyrus) and Miscanthidium violaceum (K. Schum.) Robyns (synonymous to Miscanthus violaceus (K. Schum) Pilg.) were established in five different wetlands around the northern shores ...
DEFF Research Database (Denmark)
Muadsub, Sawitree; Sutcharit, Chirasak; Pimvichai, Piyatida
2012-01-01
(type species of Sterropristes) and S.metallicus (Verhoeff, 1937) from Penang Hill, Penang, Malaysia (type species of Malaccolabis) are redescribed based on their type material, together with newly collected topotypes of S. metallicus. Sterropristes violaceus Muadsub and Panha n. sp., found under leaves...
Apparent nutrient digestibility and performance of Heterobranchus ...
African Journals Online (AJOL)
Apparent digestibility coefficients (ADCs) of nutrients is a useful tool for fish diet formulation, which gives the right estimation of growth, thereby reducing waste products. The ADCs of crude protein, energy and dry matter of processed earthworm, Libyodrilus violaceus meal by Heterobranchus longifilis fingerlings ...
Dicty_cDB: Contig-U05966-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available PCC 73102, c... 56 1e-11 AF079138_3( AF079138 |pid:none) Streptomyces venezuelae methymycin... 55 2e-11 AF15...) Gloeobacter violaceus PCC 7421 ... 65 2e-11 AF015823_1( AF015823 |pid:none) Streptomyces venezuelae venA g
Is Monoglucosyldiacylglycerol a Precursor to Monogalactosyldiacylglycerol in All Cyanobacteria?
Sato, Naoki
2015-10-01
Monogalactosyldiacylglycerol (MGDG) is ubiquitous in the photosynthetic membranes of cyanobacteria and chloroplasts. It is synthesized by galactosylation of diacylglycerol (DAG) in the chloroplasts, whereas it is produced by epimerization of monoglucosyldiacylglycerol (GlcDG) in at least several cyanobacteria that have been analyzed such as Synechocystis sp. PCC 6803. A previous study, however, showed that the mgdE gene encoding the epimerase is absent in some cyanobacteria such as Gloeobacter violaceus, Thermosynechococcus elongatus and Acaryochloris marina. In addition, the N-terminal 'fatty acid hydroxylase' domain is lacking in the MgdE protein of Prochlorococcus marinus. These problems may cast doubt upon the general (or exclusive) role of MgdE in the epimerization of GlcDG to MGDG in cyanobacteria. In addition, GlcDG is usually present at a very low level, and the structural determination of endogenous GlcDG has not been accomplished with cyanobacterial samples. In this study, I determined the structure of GlcDG from Anabaena variabilis by (1)H- and (13)C-nuclear magnetic resonance (NMR) spectroscopy. I then showed that G. violaceus, T. elongatus, A. marina and P. marinus contain GlcDG. In all cases, GlcDG consisted of fewer unsaturated molecular species than MGDG, providing further evidence that GlcDG is a precursor to MGDG. The conversion of GlcDG to MGDG was also demonstrated by radiolabeling and chase experiments in G. violaceus and P. marinus. These results demonstrate that all the analyzed cyanobacteria contain GlcDG, which is converted to MGDG, and suggest that an alternative epimerase is required for MGDG synthesis in these cyanobacteria. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
The Primitive Thylakoid-Less Cyanobacterium Gloeobacter Is a Common Rock-Dwelling Organism.
Directory of Open Access Journals (Sweden)
Jan Mareš
Full Text Available Cyanobacteria are an ancient group of photosynthetic prokaryotes, which are significant in biogeochemical cycles. The most primitive among living cyanobacteria, Gloeobacter violaceus, shows a unique ancestral cell organization with a complete absence of inner membranes (thylakoids and an uncommon structure of the photosynthetic apparatus. Numerous phylogenetic papers proved its basal position among all of the organisms and organelles capable of plant-like photosynthesis (i.e., cyanobacteria, chloroplasts of algae and plants. Hence, G. violaceus has become one of the key species in evolutionary study of photosynthetic life. It also numbers among the most widely used organisms in experimental photosynthesis research. Except for a few related culture isolates, there has been little data on the actual biology of Gloeobacter, being relegated to an "evolutionary curiosity" with an enigmatic identity. Here we show that members of the genus Gloeobacter probably are common rock-dwelling cyanobacteria. On the basis of morphological, ultrastructural, pigment, and phylogenetic comparisons of available Gloeobacter strains, as well as on the basis of three new independent isolates and historical type specimen, we have produced strong evidence as to the close relationship of Gloeobacter to a long known rock-dwelling cyanobacterial morphospecies Aphanothece caldariorum. Our results bring new clues to solving the 40 year old puzzle of the true biological identity of Gloeobacter violaceus, a model organism with a high value in several biological disciplines. A probable broader distribution of Gloeobacter in common wet-rock habitats worldwide is suggested by our data, and its ecological meaning is discussed taking into consideration the background of cyanobacterial evolution. We provide observations of previously unknown genetic variability and phenotypic plasticity, which we expect to be utilized by experimental and evolutionary researchers worldwide.
Keller, Irene; Largiadèr, Carlo R
2003-02-22
Although habitat fragmentation is suspected to jeopardize the long-term survival of many species, few data are available on its impact on the genetic variability of invertebrates. We assess the genetic population structure of the flightless ground beetle Carabus violaceus L., 1758 in a Swiss forest, which is divided into several fragments by a highway and two main roads. Eight samples were collected from different forest fragments and analysed at six microsatellite loci. The largest genetic differentiation was observed between samples separated by roads and in particular by the highway. The number of roads between sites explained 44% of the variance in pairwise F(ST) estimates, whereas the age of the road and the geographical distance between locations were not significant factors. Furthermore, a comparison of allelic richness showed that the genetic variability in a small forest fragment isolated by the highway was significantly lower than in the rest of the study area. These findings strongly support the hypothesis that large roads are absolute barriers to gene flow in C. violaceus, which may lead to a loss of genetic variability in fragmented populations.
Heupel, Kristina
2010-01-01
In this study, side-effects of various pesticides on collembolan species covering different life forms (Isotoma anglicana, Lepidocyrtus violaceus, Folsomia fimetaria, Heteromurus nitidus and Onychiurus armatus) were examined in laboratory and field experiments. The principal aim of the study was to develop choice experiments with Collembola for the quantitative assessment of avoidance behaviour. Avoidance can potentially lead to population declines due to inhibited immigration or escape from ...
Directory of Open Access Journals (Sweden)
Jimmy H W Saw
Full Text Available The ancestor of Gloeobacter violaceus PCC 7421(T is believed to have diverged from that of all known cyanobacteria before the evolution of thylakoid membranes and plant plastids. The long and largely independent evolutionary history of G. violaceus presents an organism retaining ancestral features of early oxygenic photoautotrophs, and in whom cyanobacteria evolution can be investigated. No other Gloeobacter species has been described since the genus was established in 1974 (Rippka et al., Arch Microbiol 100:435. Gloeobacter affiliated ribosomal gene sequences have been reported in environmental DNA libraries, but only the type strain's genome has been sequenced. However, we report here the cultivation of a new Gloeobacter species, G. kilaueensis JS1(T, from an epilithic biofilm in a lava cave in Kīlauea Caldera, Hawai'i. The strain's genome was sequenced from an enriched culture resembling a low-complexity metagenomic sample, using 9 kb paired-end 454 pyrosequences and 400 bp paired-end Illumina reads. The JS1(T and G. violaceus PCC 7421(T genomes have little gene synteny despite sharing 2842 orthologous genes; comparing the genomes shows they do not belong to the same species. Our results support establishing a new species to accommodate JS1(T, for which we propose the name Gloeobacter kilaueensis sp. nov. Strain JS1(T has been deposited in the American Type Culture Collection (BAA-2537, the Scottish Marine Institute's Culture Collection of Algae and Protozoa (CCAP 1431/1, and the Belgian Coordinated Collections of Microorganisms (ULC0316. The G. kilaueensis holotype has been deposited in the Algal Collection of the US National Herbarium (US# 217948. The JS1(T genome sequence has been deposited in GenBank under accession number CP003587. The G+C content of the genome is 60.54 mol%. The complete genome sequence of G. kilaueensis JS1(T may further understanding of cyanobacteria evolution, and the shift from anoxygenic to oxygenic photosynthesis.
Oxygen Concentration Inside a Functioning Photosynthetic Cell
Kihara, Shigeharu; Hartzler, Daniel A.; Savikhin, Sergei
2014-01-01
The excess oxygen concentration in the photosynthetic membranes of functioning oxygenic photosynthetic cells was estimated using classical diffusion theory combined with experimental data on oxygen production rates of cyanobacterial cells. The excess oxygen concentration within the plesiomorphic cyanobacterium Gloeobactor violaceus is only 0.025 μM, or four orders of magnitude lower than the oxygen concentration in air-saturated water. Such a low concentration suggests that the first oxygenic...
Types of cross-cultural studies in cross-cultural psychology
van de Vijver, F.J.R.; Lonner, W.J.; Dinnel, D.L.; Hayes, S.A.; Sattler, D.N.
2003-01-01
From a methodological perspective cross-cultural studies in psychology differ in three dimensions. First, cross-cultural psychological studies can be exploratory or test specific hypotheses. Second, some cross-cultural studies compare countries or ethnic groups while other cross-cultural studies
Border Crossing/Entry Data - Boarder Crossing
Department of Transportation — Border Crossing/Entry Data provides summary statistics for incoming crossings at the U.S.-Canadian and the U.S.-Mexican border at the port level. Data are available...
CrossWork: Software-assisted identification of cross-linked peptides
DEFF Research Database (Denmark)
Rasmussen, Morten; Refsgaard, Jan; Peng, Li
2011-01-01
Work searches batches of tandem mass-spectrometric data, and identifies cross-linked and non-cross-linked peptides using a standard PC. We tested CrossWork by searching mass-spectrometric datasets of cross-linked complement factor C3 against small (1 protein) and large (1000 proteins) search spaces, and show...
International Nuclear Information System (INIS)
Velazquez Miranda, S.; Munoz Carmona, D. M.; Ortyiz Seidel, M.; Gomez-Millan Barrachina, J.; Delgado Gil, M. M.; Ortega Rodriguez, M. J.; Dominguez Rodriguez, M.; Marquez Garcia Salazar, M.; Bayo Lozano, E.
2011-01-01
Classic Kaposi sarcoma presents as asymptomatic red-violaceus plaques, usually on the legs below the knees, ankles and soles preferentially. When the disease is spread on the skin preferential treatment is radiation therapy at low doses. Homogeneous irradiation of the various lesions could be very complex due to the irregular geometry of the feet, interdigital lesions on different planes. To overcome this problem, and in the case of disseminated disease and low doses, we propose the technique of dipping the tip in Cuba expanded polystyrene filled with saline with a methacrylate plate 2 cm in depth and irradiation with parallel opposed fields.
ISOLATION AND PURIFICATION OF STREPTOMYCES SPP. PRODUCING VANCOMYCIN
International Nuclear Information System (INIS)
EL-KABBANY, H.M.I.
2008-01-01
Soil samples obtained from different governments in Egypt were analyzed to determine the presence of types of antibiotic producing actinomycetes using starch-nitrite agar, starch-casein nitrate agar and Czapek's Dox agar as culture media. Different Streptomyces spp. were isolated. The Streptomyces (S.) isolates encountered were S. violochromogens, S. violaceus-nigar and S. orientalis and known as standard Vancomycin producers. The optimum conditions of S. orientalis; incubation period, initial pH and incubation temperature, were determined. In addition, physical properties; appearance, melting point, solubility, mass spectrophotometer of ultra violet (UV) and the effect of gamma rays, were also determined
Energy Technology Data Exchange (ETDEWEB)
Velazquez Miranda, S.; Munoz Carmona, D. M.; Ortyiz Seidel, M.; Gomez-Millan Barrachina, J.; Delgado Gil, M. M.; Ortega Rodriguez, M. J.; Dominguez Rodriguez, M.; Marquez Garcia Salazar, M.; Bayo Lozano, E.
2011-07-01
Classic Kaposi sarcoma presents as asymptomatic red-violaceus plaques, usually on the legs below the knees, ankles and soles preferentially. When the disease is spread on the skin preferential treatment is radiation therapy at low doses. Homogeneous irradiation of the various lesions could be very complex due to the irregular geometry of the feet, interdigital lesions on different planes. To overcome this problem, and in the case of disseminated disease and low doses, we propose the technique of dipping the tip in Cuba expanded polystyrene filled with saline with a methacrylate plate 2 cm in depth and irradiation with parallel opposed fields.
A subspecies of region crossing change, region freeze crossing change
Inoue, Ayumu; Shimizu, Ryo
2016-01-01
We introduce a local move on a link diagram named a region freeze crossing change which is close to a region crossing change, but not the same. We study similarity and difference between region crossing change and region freeze crossing change.
CrossFlow: Cross-Organizational Workflow Management in Dynamic Virtual Enterprises
Grefen, P.W.P.J.; Aberer, Karl; Hoffner, Yigal; Ludwig, Heiko
In this report, we present the approach to cross-organizational workflow management of the CrossFlow project. CrossFlow is a European research project aiming at the support of cross-organizational workflows in dynamic virtual enterprises. The cooperation in these virtual enterprises is based on
CrossFlow : cross-organizational workflow management in dynamic virtual enterprises
Grefen, P.W.P.J.; Aberer, K.; Hoffner, Y.
2000-01-01
This paper gives a detailed overview of the approach to cross-organizational workflow management developed in the CrossFlow project. CrossFlow is a European research project aiming at the support of cross-organizational workflows in dynamic virtual enterprises. The cooperation in these virtual
Siers, Shane R.; Reed, Robert N.; Savidge, Julie A.
2016-01-01
Roads are significant barriers to landscape-scale movements of individuals or populations of many wildlife taxa. The decision by an animal near a road to either cross or not cross may be influenced by characteristics of the road, environmental conditions, traits of the individual animal, and other aspects of the context within which the decision is made. We considered such factors in a mixed-effects logistic regression model describing the nightly road crossing probabilities of invasive nocturnal Brown Treesnakes (Boiga irregularis) through short-term radiotracking of 691 snakes within close proximity to 50 road segments across the island of Guam. All measures of road magnitude (traffic volume, gap width, surface type, etc.) were significantly negatively correlated with crossing probabilities. Snake body size was the only intrinsic factor associated with crossing rates, with larger snakes crossing roads more frequently. Humidity was the only environmental variable affecting crossing rate. The distance of the snake from the road at the start of nightly movement trials was the most significant predictor of crossings. The presence of snake traps with live mouse lures during a portion of the trials indicated that localized prey cues reduced the probability of a snake crossing the road away from the traps, suggesting that a snake's decision to cross roads is influenced by local foraging opportunities. Per capita road crossing rates of Brown Treesnakes were very low, and comparisons to historical records suggest that crossing rates have declined in the 60+ yr since introduction to Guam. We report a simplified model that will allow managers to predict road crossing rates based on snake, road, and contextual characteristics. Road crossing simulations based on actual snake size distributions demonstrate that populations with size distributions skewed toward larger snakes will result in a higher number of road crossings. Our method of modeling per capita road crossing
Directory of Open Access Journals (Sweden)
Stephen D. Gaimari
2017-10-01
Full Text Available The family Celyphidae (Diptera, Lauxanioidea is verified as part of the New World fauna, with a second specimen discovered of a species described from French Guiana in 1844 by P.J.M. Macquart. As this species possesses characteristics that clearly suggest a separate lineage from the Old World celyphids, a new genus is proposed, Atopocelyphus gen. n., with the type species, Celyphus ruficollis Macquart, in the new combination Atopocelyphus ruficollis (Macquart, comb. n. A key to world genera of Celyphidae is presented, along with discussion of generic concepts. Chamaecelyphus Frey is synonymized under Spaniocelyphus Hendel, syn. n., resulting in the following 10 new combinations: Spaniocelyphus africanus (Walker, comb. n.; S. dichrous (Bezzi, comb. n.; S. gutta (Speiser, comb. n.; S. halticinus (Frey, comb. n.; S. kalongensis (Vanschuytbroek, comb. n.; S. ruwenzoriensis (Vanschuytbroek, comb. n.; S. straeleni (Vanschuytbroek, comb. n.; S. upembaensis (Vanschuytbroek, comb. n.; S. violaceus (Vanschuytbroek, comb. n.; S. vrydaghi (Vanschuytbroek, comb. n. The subgenera of Celyphus Dalman are elevated to genus rank, as Paracelyphus Bigot, stat. rev., and Hemiglobus Frey, stat. rev., resulting in the following 17 new and revised combinations: Hemiglobus cheni (Shi, comb. n.; H. eos (Frey, comb. n.; H. lacunosus Frey, comb. rev.; H. pellucidus Frey, comb. rev.; H. planitarsalis (Shi, comb. n.; H. porosus (Tenorio, comb. n.; H. pulchmaculatus (Liu & Yang, comb. n.; H. quadrimaculatus (Tenorio, comb. n.; H. resplendens Frey, comb. rev.; H. rugosus (Tenorio, comb. n.; H. testaceus (Malloch, comb. n.; H. trichoporis (Shi, comb. n.; H. unicolor Frey, comb. rev.; H. violaceus Chen, comb. rev.; Paracelyphus hyacinthus Bigot, comb. rev.; P. medogis (Shi, comb. n.; P. vittalis (Shi, comb. n.
Light-induced cross-linking and post-cross-linking modification of polyglycidol.
Marquardt, F; Bruns, M; Keul, H; Yagci, Y; Möller, M
2018-02-08
The photoinduced radical generation process has received renewed interest due to its economic and ecological appeal. Herein the light-induced cross-linking of functional polyglycidol and its post-cross-linking modification are presented. Linear polyglycidol was first functionalized with a tertiary amine in a two-step reaction. Dimethylaminopropyl functional polyglycidol was cross-linked in a UV-light mediated reaction with camphorquinone as a type II photoinitiator. The cross-linked polyglycidol was further functionalized by quaternization with various organoiodine compounds. Aqueous dispersions of the cross-linked polymers were investigated by means of DLS and zeta potential measurements. Polymer films were evaluated by DSC and XPS.
Multifractal Cross Wavelet Analysis
Jiang, Zhi-Qiang; Gao, Xing-Lu; Zhou, Wei-Xing; Stanley, H. Eugene
Complex systems are composed of mutually interacting components and the output values of these components usually exhibit long-range cross-correlations. Using wavelet analysis, we propose a method of characterizing the joint multifractal nature of these long-range cross correlations, a method we call multifractal cross wavelet analysis (MFXWT). We assess the performance of the MFXWT method by performing extensive numerical experiments on the dual binomial measures with multifractal cross correlations and the bivariate fractional Brownian motions (bFBMs) with monofractal cross correlations. For binomial multifractal measures, we find the empirical joint multifractality of MFXWT to be in approximate agreement with the theoretical formula. For bFBMs, MFXWT may provide spurious multifractality because of the wide spanning range of the multifractal spectrum. We also apply the MFXWT method to stock market indices, and in pairs of index returns and volatilities we find an intriguing joint multifractal behavior. The tests on surrogate series also reveal that the cross correlation behavior, particularly the cross correlation with zero lag, is the main origin of cross multifractality.
Nufer, Gerd; Kelm, Daniel
2011-01-01
Erfolgreiches Cross Selling Management bietet die Möglichkeit, die Profitabilität von Neu- oder Bestandskunden zu steigern und kann zur Verbesserung der Kundenzufriedenheit, Kundenbindung und Verlängerung des Kundenlebenszyklus beitragen. Um erfolgreiches Cross Selling Management zu betreiben, sind ein systematisches Vorgehen und die Bereitstellung von Unternehmensressourcen notwendig. Umfangreiche vorbereitende Maßnahmen stellen sicher, dass Cross Selling nicht dem Zufall überlassen wird. De...
Cross-border versus cross-sector interconnectivity in renewable energy systems
DEFF Research Database (Denmark)
Thellufsen, Jakob Zinck; Lund, Henrik
2017-01-01
. The results show that while both measures increase the system utilisation of renewable energy and the system efficiency, the cross-sector interconnection gives the best system performance. To analyse the possible interaction between cross-sector and cross-border interconnectivity, two main aspects have......In the transition to renewable energy systems, fluctuating renewable energy, such as wind and solar power, plays a large and important role. This creates a challenge in terms of meeting demands, as the energy production fluctuates based on weather patterns. To utilise high amounts of fluctuating...... renewable energy, the energy system has to be more flexible in terms of decoupling demand and production. This paper investigates two potential ways to increase flexibility. The first is the interconnection between energy systems, for instance between two countries, labelled as cross-border interconnection...
German cross-cultural psychology
Trommsdorff, Gisela
1986-01-01
The present study deals with German-language cross-cultural research in different fields of psychology which attempts to achieve one Or more goals of cross-cultural psychology. First, methodological problems are discussed, followed by a selective presentation of cross-cultural research in personality, clinical, ethological, developmental, and social psychology. The theoretical and methodological advancement of these studies is investigated with respect to four approaches - universals in cross...
Cross-border versus cross-sector interconnectivity in renewable energy systems
DEFF Research Database (Denmark)
Thellufsen, Jakob Zinck; Lund, Henrik
2017-01-01
renewable energy, the energy system has to be more flexible in terms of decoupling demand and production. This paper investigates two potential ways to increase flexibility. The first is the interconnection between energy systems, for instance between two countries, labelled as cross-border interconnection...... systems that represent Northern and Southern Europe. Both systems go through three developmental steps that increase the cross-sector interconnectivity. At each developmental step an increasing level of transmission capacities is examined to identify the benefits of cross-border interconnectivity...
Cross-border versus cross-sector interconnectivity in renewable energy systems
International Nuclear Information System (INIS)
Thellufsen, Jakob Zinck; Lund, Henrik
2017-01-01
In the transition to renewable energy systems, fluctuating renewable energy, such as wind and solar power, plays a large and important role. This creates a challenge in terms of meeting demands, as the energy production fluctuates based on weather patterns. To utilise high amounts of fluctuating renewable energy, the energy system has to be more flexible in terms of decoupling demand and production. This paper investigates two potential ways to increase flexibility. The first is the interconnection between energy systems, for instance between two countries, labelled as cross-border interconnection, and the second is cross-sector interconnection, i.e., the integration between different parts of an energy system, for instance heat and electricity. This paper seeks to compare the types of interconnectivity and discuss to which extent they are mutually beneficial. To do this, the study investigates two energy systems that represent Northern and Southern Europe. Both systems go through three developmental steps that increase the cross-sector interconnectivity. At each developmental step an increasing level of transmission capacities is examined to identify the benefits of cross-border interconnectivity. The results show that while both measures increase the system utilisation of renewable energy and the system efficiency, the cross-sector interconnection gives the best system performance. To analyse the possible interaction between cross-sector and cross-border interconnectivity, two main aspects have to be clarified. The first part defines the approach and the second is the construction of the two archetypes. - Highlights: • A method to investigate system integration and system interconnection is suggested. • The implementation is investigated across a Northern and Southern energy system. • The study identifies benefits of system integration and system interconnection. • The performance of the energy system benefits most from system integration.
Border Crossing/Entry Data - Border Crossing/Entry Data Time Series tool
Department of Transportation — The dataset is known as “Border Crossing/Entry Data.” The Bureau of Transportation Statistics (BTS) Border Crossing/Entry Data provides summary statistics to the...
Crans, Alissa S.; Wagemann, Friedrich
2014-01-01
We generalize the notion of a crossed module of groups to that of a crossed module of racks. We investigate the relation to categorified racks, namely strict 2-racks, and trunk-like objects in the category of racks, generalizing the relation between crossed modules of groups and strict 2-groups. Then we explore topological applications. We show that by applying the rack-space functor, a crossed module of racks gives rise to a covering. Our main result shows how the fundamental racks associate...
Cross of Lorraine and Cross of Caravaca: new IUD's with low expulsion rates.
Coutinho, E M; Mascarenhas, M J
1985-01-01
The Cross of Caravaca and Cross of Lorraine IUDs with double horizontal bar design were developed in an attempt to reduce expulsion and removal rates for pain and bleeding encountered with other IUDs. The devices were manufactured in radio-opaque plastic bearing copper wire or sleeves on the top arm. The Cross of Lorraine has the upper arm shorter than the lower arm whereas in the Cross of Caravaca the shorter is the lower arm. 748 women had insertion of the Cross of Caravaca and 412 had insertion of the Cross of Lorraine. For the Cross of Caravaca 486 women completed 1 year of use, 392 completed 2 years and 310 completed 3 years. For the Cross of Lorraine, 268 women completed the 1st year, 205 the 2nd, and 150 women completed 3 years of use. The combined number of observed months of use for the 2 devices at the end of 3 years was 24,963. Accidental pregnancy rates at the end of 3 years were 1.13% for Caravaca and 3.48% for Lorraine. Expulsion rates at the end of 3 years were nil for the Cross of Lorraine and 1.16% for the Cross of Caravaca. Pain and bleeding were the most common causes of termination for medical reasons, bleeding accounting for termination in 1.66% of Lorraine users at the end of 3 years of use and 2.75% of Caravaca users. Pain accounted for termination in 3.14% of Caravaca users and 2.02% of Lorraine users. Incidence of infection was 0.42% and nil for Caravaca and Lorraine users respectively. Total discontinuation rates at the end of 3 years were 25.39% for Caravaca and 16.67% for Lorraine.
CROPPER: a metagene creator resource for cross-platform and cross-species compendium studies.
Paananen, Jussi; Storvik, Markus; Wong, Garry
2006-09-22
Current genomic research methods provide researchers with enormous amounts of data. Combining data from different high-throughput research technologies commonly available in biological databases can lead to novel findings and increase research efficiency. However, combining data from different heterogeneous sources is often a very arduous task. These sources can be different microarray technology platforms, genomic databases, or experiments performed on various species. Our aim was to develop a software program that could facilitate the combining of data from heterogeneous sources, and thus allow researchers to perform genomic cross-platform/cross-species studies and to use existing experimental data for compendium studies. We have developed a web-based software resource, called CROPPER that uses the latest genomic information concerning different data identifiers and orthologous genes from the Ensembl database. CROPPER can be used to combine genomic data from different heterogeneous sources, allowing researchers to perform cross-platform/cross-species compendium studies without the need for complex computational tools or the requirement of setting up one's own in-house database. We also present an example of a simple cross-platform/cross-species compendium study based on publicly available Parkinson's disease data derived from different sources. CROPPER is a user-friendly and freely available web-based software resource that can be successfully used for cross-species/cross-platform compendium studies.
Balachandran, Uthamalingam; Poeppel, Roger B.; Kleefisch, Mark S.; Kobylinski, Thaddeus P.; Udovich, Carl A.
1994-01-01
This invention discloses cross-flow electrochemical reactor cells containing oxygen permeable materials which have both electron conductivity and oxygen ion conductivity, cross-flow reactors, and electrochemical processes using cross-flow reactor cells having oxygen permeable monolithic cores to control and facilitate transport of oxygen from an oxygen-containing gas stream to oxidation reactions of organic compounds in another gas stream. These cross-flow electrochemical reactors comprise a hollow ceramic blade positioned across a gas stream flow or a stack of crossed hollow ceramic blades containing a channel or channels for flow of gas streams. Each channel has at least one channel wall disposed between a channel and a portion of an outer surface of the ceramic blade, or a common wall with adjacent blades in a stack comprising a gas-impervious mixed metal oxide material of a perovskite structure having electron conductivity and oxygen ion conductivity. The invention includes reactors comprising first and second zones seprated by gas-impervious mixed metal oxide material material having electron conductivity and oxygen ion conductivity. Prefered gas-impervious materials comprise at least one mixed metal oxide having a perovskite structure or perovskite-like structure. The invention includes, also, oxidation processes controlled by using these electrochemical reactors, and these reactions do not require an external source of electrical potential or any external electric circuit for oxidation to proceed.
Directory of Open Access Journals (Sweden)
Maria Cristina ENACHE
2017-04-01
Full Text Available Cross-platform - a concept becoming increasingly used in recent years especially in the development of mobile apps, but this consistently over time and in the development of conventional desktop applications. The notion of cross-platform software (multi-platform or platform-independent refers to a software application that can run on more than one operating system or computing architecture. Thus, a cross-platform application can operate independent of software or hardware platform on which it is execute. As a generic definition presents a wide range of meanings for purposes of this paper we individualize this definition as follows: we will reduce the horizon of meaning and we use functionally following definition: a cross-platform application is a software application that can run on more than one operating system (desktop or mobile identical or in a similar way.
International Nuclear Information System (INIS)
Carlson, A.D.
1984-01-01
The accuracy of neutron cross-section measurement is limited by the uncertainty in the standard cross-section and the errors associated with using it. Any improvement in the standard immediately improves all cross-section measurements which have been made relative to that standard. Light element, capture and fission standards are discussed. (U.K.)
Pullback and pushout crossed polymodules
Indian Academy of Sciences (India)
Crossed module; polygroup; crossed polymodule; action; pullback; pushout; fundamental relation. Mathematics Subject Classification. 13D99, 20N20, 18D35. 1. Introduction. Crossed module was defined by Whitehad in [21] and many have worked on this sub- ject. There are many examples of crossed module such as ...
Cross sections for atmospheric corrections
International Nuclear Information System (INIS)
Meyer, J.P.; Casse, M.; Westergaard, N.
1975-01-01
A set of cross sections for spallation of relativistic nuclei is proposed based on (i) the best available proton cross sections, (ii) an extrapolation to heavier nuclei of the dependence on the number of nucleons lost of the 'target factor' observed for C 12 and O 16 by Lindstrom et al. (1975), in analogy with Rudstam's formalism, and (iii) on a normalization of all cross sections to the total cross sections for production of fragments with Asub(f) >= 6. The obtained cross sections for peripheral interactions are not inconsistent with simple geometrical considerations. (orig.) [de
Directory of Open Access Journals (Sweden)
Suzić Nenad
2014-01-01
Full Text Available The paper displays the application of the Cross-Impact method in pedagogy, namely a methodological approach which crosses variables in a novel, but statistically justified manner. The method is an innovation in pedagogy as well as in research methodology of social and psychological phenomena. Specifically, events and processes are crossed, that is, experts' predictions of about future interaction of events and processes. Therefore, this methodology is futuristic; it concerns predicting future, which is of key importance for pedagogic objectives. The paper presents two instances of the cross-impact approach: the longer, displayed in fourteen steps, and the shorter, in four steps. They are both accompanied with mathematic and statistical formulae allowing for quantification, that is, a numerical expression of the probability of a certain event happening in the future. The advantage of this approach is that it facilitates planning in education which so far has been solely based on lay estimates and assumptions.
Generalized Cross-Gramian for Linear Systems
DEFF Research Database (Denmark)
Shaker, Hamid Reza
2012-01-01
The cross-gramian is a well-known matrix with embedded controllability and observability information. The cross-gramian is related to the Hankel operator and the Hankel singular values of a linear square system and it has several interesting properties. These properties make the cross...... square symmetric systems, the ordinary cross-gramian does not exist. To cope with this problem, a new generalized cross-gramian is introduced in this paper. In contrast to the ordinary cross-gramian, the generalized cross-gramian can be easily obtained for general linear systems and therefore can be used...
Cross-cultural organizational behavior.
Gelfand, Michele J; Erez, Miriam; Aycan, Zeynep
2007-01-01
This article reviews research on cross-cultural organizational behavior (OB). After a brief review of the history of cross-cultural OB, we review research on work motivation, or the factors that energize, direct, and sustain effort across cultures. We next consider the relationship between the individual and the organization, and review research on culture and organizational commitment, psychological contracts, justice, citizenship behavior, and person-environment fit. Thereafter, we consider how individuals manage their interdependence in organizations, and review research on culture and negotiation and disputing, teams, and leadership, followed by research on managing across borders and expatriation. The review shows that developmentally, cross-cultural research in OB is coming of age. Yet we also highlight critical challenges for future research, including moving beyond values to explain cultural differences, attending to levels of analysis issues, incorporating social and organizational context factors into cross-cultural research, taking indigenous perspectives seriously, and moving beyond intracultural comparisons to understand the dynamics of cross-cultural interfaces.
Directory of Open Access Journals (Sweden)
Marta Szabo White
2010-12-01
Full Text Available Commensurate with the concept of Academic Globalization, coupled with the foray of Globalization, this paper underscores the cross-cultural, cross-disciplinary and cross-epistemological transformation from the first-generation Cultureactive to the second-generation InterCultural Edge [ICE]. The former is embedded in the experiential works of cross-cultural consultant. Richard Lewis and the latter is grounded in established theoretical frameworks. Both serve to underscore the impact of the Globalization Phenomenon, as manifested in and enabled by the acceleration of academic and practitioner cross-cultural activities. The contribution of this paper is the celebration of the longawaited arrival of ICE [InterCultural Edge]. While previous research streams have underscored global similarities and differences among cultures, a previous paper [19] established that cross-professional rather than cross-cultural differences are more paramount. Employing Cultureactive and the LMR framework, it was noted that business versus non-business predisposition had a more direct impact on one's individual cultural profile than did nationality. Regardless of culture, persons involved in business are characterized primarily by linear-active modes of communication, and persons involved in non-business activities typically employ more multiactive/hybrid and less linear modes of communication. The pivotal question is this: Now that we have a new and improved tool, are we in a better position to assess and predict leadership, negotiating styles, individual behaviors, etc., which are central to academic globalization and preparing global business leaders?
Cross-cultural nursing research.
Suhonen, Riitta; Saarikoski, Mikko; Leino-Kilpi, Helena
2009-04-01
International cross-cultural comparative nursing research is considered important for the advancement of nursing knowledge offering a global perspective for nursing. Although this is recognised in policy statements and quality standards, international comparative studies are rare in database citations. To highlight the need for cross-cultural comparative research in nursing and to share some of the insights gained after conducting three international/cross-cultural comparative studies. These are: an examination of patients' autonomy, privacy and informed consent in nursing interventions BIOMED 1998-2001, the ICProject International Patient Study 2002-2006 and the Ethical Codes in Nursing (ECN) project 2003-2005. There are three critical issues raised here for discussion from the international cross-cultural studies. These are: the planning and formulating of an international study, the conduct of cross-cultural research including the implementation of rigorous data collection and analysis and the reporting and implementing the results. International and cross-cultural nursing research is powerful tool for the improvement of clinical nursing practise, education and management and advancement of knowledge. Such studies should be carried out in order to improve European evidence based health care development in which the patients' perspective plays an important part in the evaluation and benchmarking of services.
Boenkost, Wolfram; Schmidt, Wolfgang M.
2004-01-01
Cross currency swaps are powerful instruments to transfer assets or liabilities from one currency into another. The market charges for this a liquidity premium, the cross currency basis spread, which should be taken into account by the valuation methodology. We describe and compare two valuation methods for cross currency swaps which are based upon using two different discounting curves. The first method is very popular in practice but inconsistent with single currency swap valuation methods....
Language and Cross-Culture Understanding—Through Cross-Culture Study of the Word'Dragon'
Institute of Scientific and Technical Information of China (English)
周玲
2016-01-01
This essay contributes to the analysis of the significance of cross-culture understanding in connection with language. It is important and necessary to promote cross-cultural understanding in order to communicate with people from various cultural backgrounds with the development of globalization. This essay also gives the example of the word'dragon'to illustrate that the cross-culture understanding of language will make us communicate with each other more effectively.
Flow velocity measurement by using zero-crossing polarity cross correlation method
International Nuclear Information System (INIS)
Xu Chengji; Lu Jinming; Xia Hong
1993-01-01
Using the designed correlation metering system and a high accurate hot-wire anemometer as a calibration device, the experimental study of correlation method in a tunnel was carried out. The velocity measurement of gas flow by using zero-crossing polarity cross correlation method was realized and the experimental results has been analysed
Zhang, Yaqing; Zhang, Xiangmei; Xu, Ling; Wei, Shicheng; Zhai, Maolin
2015-01-01
Ionizing radiation effectively cross-links collagen into network with enhanced anti-degradability and biocompatibility, while radiation-cross-linked collagen scaffold lacks flexibility, satisfactory surface appearance, and performs poor in cell penetration and ingrowth. To make the radiation-cross-linked collagen scaffold to serve as an ideal artificial dermis, dextran was incorporated into collagen. Scaffolds with the collagen/dextran (Col/Dex) ratios of 10/0, 7/3, and 5/5 were fabricated via (60)Co γ-irradiation cross-linking, followed by lyophilization. The morphology, microstructure, physicochemical, and biological properties were investigated. Compared with pure collagen, scaffolds with dextran demonstrated more porous appearance, enhanced hydrophilicity while the cross-linking density was lower with the consequence of larger pore size, higher water uptake, as well as reduced stiffness. Accelerated degradation was observed when dextran was incorporated in both the in vitro and in vivo assays, which led to earlier integration with cell and host tissue. The effect of dextran on degradation was ascribed to the decreased cross-linking density, looser microstructure, more porous and hydrophilic surface. Considering the better appearance, softness, moderate degradation rate due to controllable cross-linking degree and good biocompatibility as well, radiation-cross-linked collagen/dextran scaffolds are expected to serve as promising artificial dermal substitutes.
Department of Transportation — The Bureau of Transportation Statistics (BTS) Border Crossing/Entry Data provides summary statistics for inbound crossings at the U.S.-Canadian and the U.S.-Mexican...
Department of Transportation — The dataset is known as “Border Crossing/Entry Data.” The Bureau of Transportation Statistics (BTS) Border Crossing/Entry Data provides summary statistics to the...
Cross-National Yardstick Comparisons
DEFF Research Database (Denmark)
Møller Hansen, Kasper; Leth Olsen, Asmus; Bech, Mickael
2015-01-01
performance comparisons—even when accounting for classic national sociotropic and egotropic items. Specifically, voters respond strongly to how the prospective wealth of Denmark evolves relative to the neighboring Sweden. Interestingly, voters are more negative in their response to cross-national losses......Comparing performance between countries is both a theoretically and intuitively useful yardstick for voters. Cross-national comparisons provide voters with heuristics that are less cognitively demanding, less ambiguous, and less uncertain than solely national, absolute performance measurements. We...... test this proposition using a unique, choice experiment embedded in the 2011 Danish National Election Study. This design allows to contrast cross-national comparisons with more traditional national sociotropic and egotropic concerns. The findings suggest that voters are strongly influenced by cross-national...
Multitrajectory eikonal cross sections
International Nuclear Information System (INIS)
Turner, R.E.
1983-01-01
With the use of reference and distorted transition operators, a time-correlation-function representation of the inelastic differential cross section has recently been used to obtain distorted eikonal cross sections. These cross sections involve straight-line and reference classical translational trajectories that are unaffected by any internal-state changes which have occurred during the collision. This distorted eikonal theory is now extended to include effects of internal-state changes on the translational motion. In particular, a different classical trajectory is associated with each pair of internal states. Expressions for these inelastic cross sections are obtained in terms of time-ordered cosine and sine memory functions using the Zwanzig-Feshbach projection-operator method. Explicit formulas are obtained in the time-disordered perturbation approximation
Minnesota Department of Natural Resources — FEMA Cross Sections are required for any Digital Flood Insurance Rate Map database where cross sections are shown on the Flood Insurance Rate Map (FIRM). Normally...
International Nuclear Information System (INIS)
Lee, Y.T.
1976-01-01
Research activities with crossed molecular beams at Lawrence Berkeley Laboratory during 1976 are described. Topics covered include: scattering of Ar*, Kr*, with Xe; metastable rare gas interactions, He* + H 2 ; an atomic and molecular halogen beam source; a crossed molecular beam study of the Cl + Br 2 → BrCl + Br reaction; O( 3 P) reaction dynamics, development of the high pressure plasma beam source; energy randomization in the Cl + C 2 H 3 Br → Br + C 2 H 3 Cl reaction; high resolution photoionization studies of NO and ICl; photoionization of (H 2 O)/sub n/ and (NH 3 ) 2 ; photoionization mass spectroscopy of NH 3 + and O 3 + ; photo fragmentation of bromine; and construction of chemiluminescence-laser fluorescence crossed molecular beam machine
Comparison of integral cross section values of several cross section libraries in the SAND-II format
International Nuclear Information System (INIS)
Zijp, W.L.; Nolthenius, H.J.
1976-09-01
A comparison of some integral cross-section values for several cross-section libraries in the SAND-II format is presented. The integral cross-section values are calculated with the aid of the spectrum functions for a Watt fission spectrum, a 1/E spectrum and a Maxwellian spectrum. The libraries which are considered here are CCC-112B, ENDF/B-IV, DETAN74, LAPENAS and CESNEF. These 5 cross-section libraries used have all the SAND-II format. Discrepancies between cross-sections in the different libraries are indicated but not discussed
Cross-tools and cross-media effects
Voorveld, H.
2013-01-01
Effects of persuasive messages depend on the content of the message itself and on the media or tools that deliver the persuasive messages. Nowadays almost all campaigns make use of multiple media or multiple promotional tools. Therefore, it is important to study so-called cross-media (or
Cross-linking of polymeric materials
International Nuclear Information System (INIS)
Bloom, L.I.; Du Plessis, T.A.; Meij, G.O.
1991-01-01
The invention provides a method of producing a cured polymeric artifact from a polymeric thermoplastic starting material, the material of the artifact having reduced thermoplasticity relative to the starting material and exhibiting an enhanced degree of cross-linking relative to the starting material. The method includes subjecting a polymeric thermoplastic starting material, which is capable of being cross-linked by irradiation, to sufficient irradiation partially to cross-linked the starting material to produce a thermoplastic partially cross-linked intermediate material. The thermoplasticity of the intermediate material is then reduced by heating it to raise its melting point. The invention also provides a method of making a partially cross-linked feedstocks and a master batch for use in making such artifacts
Relativistic photon-Maxwellian electron cross sections
International Nuclear Information System (INIS)
Wienke, B.R.; Lathrop, B.L.; Devaney, J.J.
1986-01-01
Temperature corrected cross sections, complementing the Klein-Nishina set, are developed for astrophysical, plasma, and transport applications. The set is obtained from a nonlinear least squares fit to the exact photon-Maxwellian electron cross sections, using the static formula as the asymptotic basis. Two parameters are sufficient (two decimal places) to fit the exact cross sections over a range of 0-100 keV in electron temperature, and 0-1 MeV in incident photon energy. The fit is made to the total cross sections, yet the parameters predict both total and differential scattering cross sections well. Corresponding differential energy cross sections are less accurate. An extended fit to (just) the total cross sections, over the temperature and energy range 0-5 MeV, is also described. (author)
50 CFR 228.18 - Cross-examination.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Cross-examination. 228.18 Section 228.18...-examination. (a) The presiding officer may: (1) Require the cross-examiner to outline the intended scope of the cross-examination; (2) Prohibit parties from cross-examining witnesses unless the presiding...
Over-expression, purification and characterization of an Asc-1 homologue from Gloeobacter violaceus
DEFF Research Database (Denmark)
Wang, Xiaole; Hald, Helle; Ernst, Heidi Asschenfeldt
2010-01-01
The human alanine-serine-cysteine transporter 1 (Asc-1) belongs to the slc7a family of solute carrier transporters. Asc-1 mediates the uptake of D-serine in an exchanger-type fashion, coupling the process to the release of alanine and cysteine. Among the bacterial Asc-1 homologues, one transporter...... of auto-induction was crucial for obtaining high yields and purity of the transporter. The transporter was purified with yields in the range of 0.2-0.4 mg per L culture and eluted in a single peak from a size-exclusion column. The circular dichroism spectrum revealed a folded and apparently all...
International Nuclear Information System (INIS)
Wang Jing; Gao Jinfeng; Ma Xikui
2007-01-01
This Letter presents a novel cross active backstepping design method for synchronization control of cross-strict feedback hyperchaotic system, in which the ordinary backstepping design is unavailable. The proposed control method, combining backstepping design and active control approach, extends the application of backstepping technique in chaos control. Based on this method, different combinations of controllers can be designed to meet the needs of different applications. The proposed method is applied to achieve chaos synchronization of two identical cross-strict feedback hyperchaotic systems. Also it is used to implement synchronization between cross-strict feedback hyperchaotic system and Roessler hyperchaotic system. Numerical examples illustrate the validity of the control method
Intracellular events regulating cross-presentation
Directory of Open Access Journals (Sweden)
Peter eCresswell
2012-06-01
Full Text Available Cross-presentation plays a fundamental role in the induction of CD8-T cell immunity. However, although more than three decades have passed since its discovery, surprisingly little is known about the exact mechanisms involved. Here we give an overview of the components involved at different stages of this process. First, antigens must be internalized into the cross-presenting cell. The involvement of different receptors, method of antigen uptake, and nature of the antigen can influence intracellular trafficking and access to the cross-presentation pathway. Once antigens access the endocytic system, different requirements for endosomal/phagosomal processing arise, such as proteolysis and reduction of disulfide bonds. The majority of cross-presented peptides are generated by proteasomal degradation. Therefore, antigens must cross a membrane barrier in a manner analogous to the fate of misfolded proteins in the endoplasmic reticulum (ER that are retrotranslocated into the cytosol for degradation. Indeed, some components of the ER-associated degradation (ERAD machinery have been implicated in cross-presentation. Further complicating the matter, endosomal and phagosomal compartments have been suggested as alternative sites to the ER for loading of peptides on MHC class I molecules. Finally, the antigen presenting cells involved, particularly dendritic cell subsets and their state of maturation, influence the efficiency of cross-presentation.
Internet and Cross Media Productions
DEFF Research Database (Denmark)
Petersen, Anja Bechmann
2006-01-01
, the Internet continues to play a minor role when compared to older media. The content of the cross media concepts and organizations' history are crucial elements in deciding the priority and use of platforms. Methodologically, the article approaches cross media and the roles of the Internet on a micro......Convergence is one of the hot topics in Internet studies. Recently, however, media organizations have turned their focus to cross media communication. Media organizations are interested in optimizing communication across platforms such as TV, radio, websites, mobile telephones and newspapers....... The aim of this article is to examine the roles of the Internet when emphasis is put on cross media rather than convergence. This article proposes not one unidirectional convergent tendency but manifold roles of the Internet in cross media communication. Inside the media organizations, however...
Knaapi, Matti
2014-01-01
CrossFit on laji, joka pyrkii edistämään terveyttä ja kuntoa. CrossFit saleja löytyy mailmalta yli 10 000 kappaletta. CrossFit -harjoittelussa pyritään parantamaan ihmisen kuntoa mahdollisimman laajalla skaalalla kehittämällä mm. voimaa, kestävyyttä, tarkkuutta, tasapainoa ja eri aineenvaihduntareittejä samanaikaisesti. Terveyden ja kunnon kehittämiseen kuuluu kuntoilun lisäksi myös muita osa-alueita. Ruokavalio ja kehonhuolto ovat tärkeitä osa-alueita hyvän kunnon saavuttamiseksi. Ruokav...
Antigen Cross-Presentation of Immune Complexes
Platzer, Barbara; Stout, Madeleine; Fiebiger, Edda
2014-01-01
The ability of dendritic cells (DCs) to cross-present tumor antigens has long been a focus of interest to physicians, as well as basic scientists, that aim to establish efficient cell-based cancer immune therapy. A prerequisite for exploiting this pathway for therapeutic purposes is a better understanding of the mechanisms that underlie the induction of tumor-specific cytotoxic T-lymphocyte (CTL) responses when initiated by DCs via cross-presentation. The ability of humans DC to perform cross-presentation is of utmost interest, as this cell type is a main target for cell-based immunotherapy in humans. The outcome of a cross-presentation event is guided by the nature of the antigen, the form of antigen uptake, and the subpopulation of DCs that performs presentation. Generally, CD8α+ DCs are considered to be the most potent cross-presenting DCs. This paradigm, however, only applies to soluble antigens. During adaptive immune responses, immune complexes form when antibodies interact with their specific epitopes on soluble antigens. Immunoglobulin G (IgG) immune complexes target Fc-gamma receptors on DCs to shuttle exogenous antigens efficiently into the cross-presentation pathway. This receptor-mediated cross-presentation pathway is a well-described route for the induction of strong CD8+ T cell responses. IgG-mediated cross-presentation is intriguing because it permits the CD8− DCs, which are commonly considered to be weak cross-presenters, to efficiently cross-present. Engaging multiple DC subtypes for cross-presentation might be a superior strategy to boost CTL responses in vivo. We here summarize our current understanding of how DCs use IgG-complexed antigens for the efficient induction of CTL responses. Because of its importance for human cell therapy, we also review the recent advances in the characterization of cross-presentation properties of human DC subsets. PMID:24744762
A new species of Microphallus (Trematoda: Microphallidae from Venezuela
Directory of Open Access Journals (Sweden)
M.T Díaz
2004-06-01
Full Text Available During 1997-1999, a total of 94 crabs, Uca rapax were collected from La Sabana, La Ceiba and El Paujil, Sucre State, Venezuela. Of these 36 were infected with metacercariae. Two parasites were located in the abdominal muscles and one under the tissue of carapace and gonad. These metacercariae grew to adults in the following genera: Levinseniella, Microphallus and Maritrema, in the period of 2-5 days after feeding experimentally to the rat Rattus norvegicus, mice Mus musculus and duck Cairinia moschata. Specimens of the genus Microphallus were described herein as a new species M. sabanensis. The life cycle of M. sabanensis sp.nov. were studied experimentally using rat, mice and duck. All developmental stages and the adult are described. In addition, M. sabanensis was collected from wild birds Anas discors, Pluvialis squatarola, Butorides striatus, Egretta caerulea and Nycticorax violaceus from the same localitiesDurante 1997-1999, se recolectaron en La Sabana, La Ceiba y El Paujil del Distrito Cajigal, Estado Sucre, Venezuela, un total de 94 cangrejos Uca rapax, 36 de ellos estaban parasitados con tres especies de metacercarias de digéneos. Dos de ellos localizados en la musculatura del abdomen y una en el tejido que recubre internamente el caparazón y las gónadas. Estas metacercarias fueron dadas como alimento a ratones Mus musculus, ratas Rattus norvegicus, y patos Cairina moschata y tres genéros de microfálidos, Levinseniella, Microphallus y Maritrema fueron recuperados del intestino delgado de estos animales después de 2-5 días de la infección. Especimenes del genero Microphallus de este estudio se describen como Microphallus sabanensis sp.n. Se estudió experimentalmente los aspectos de ciclo vida de la especie, utilizando ratas, ratones y patos. Se describen todas las estapas larvales y los adultos. Además, M. sabanensis se encuentra naturalmente en las aves: Anas discors, Pluvialis squatarola, Butorides striatus, Egretta caerulea
Papež, Jan
2008-01-01
This thesis describes the criss-cross method, which solves the tasks of linear programming and does not need primar or dual feasibility of the basis. At first, the single-phase simplex method, that needs primal feasibility, gets described. After that, we describe the dual simplex method, which needs dual feasibility. The criss-cross method combines both of these methods. All of mentioned methods are explained and demonstrated in several examples.
Seeds of Cross-Media Production
DEFF Research Database (Denmark)
Bødker, Susanne; Petersen, Anja Bechmann
2007-01-01
separately and of cross-media production. Since cross-media production is in the making, we study the instruments currently used for planning and coordination, and analyze them as seeds that will eventually make cross-media production happen. Time and timing are important in news production in general......We present an empirical study of an organization that has recently moved from traditional newspaper production towards cross-media production involving the integrated digital production of newspaper, television, radio and web-news. The paper focuses on the daily production rhythms of the media...... with planning and coordination. We demonstrate how the production rhythms of the individual media collide with that of cross-media, and how product lifecycle rhythms add to the list of causes of problems that may jeopardize crossmedia production. We propose to strengthen planning and overview support elements...
CrossFit athletes exhibit high symmetry of fundamental movement patterns. A cross-sectional study.
Tafuri, Silvio; Notarnicola, Angela; Monno, Antonello; Ferretti, Francesco; Moretti, Biagio
2016-01-01
even if CrossFit training programs accounted actually more than 7500 gyms affiliated in the USA and more than 2000 in Europe and involved today more than 1 million of people, actually there were not several studies about the effect of the CrossFit on the health and sport performance. The aim of these research was to evaluate the performance in 7 fundamental movement patterns using a standardized methods, the Functional Movement Screen (FMS). we enrolled three groups of athletes (age 17-40 years; >6 months of training programs): CrossFitters, body builders and professional weightlifters. FMS test was performed to all people enrolled. Scores of FMS test was examined comparing three groups. no differences in the three groups were showed in the mean score values of each test and in total score, except for shoulder mobility test (higher among CrossFitters) and trunk stability push-up test (higher among weightlifter). Agreement between the test performed on the two sides was higher in CrossFit groups for hurdle step (93.2%), in line lung (86%), rotary stability test (95.3%) and shoulder mobility (90.7%; pCrossFit seems to produce marked symmetry in some fundamental movements compared to weightlifting and bodybuilding.
Academic Globalization: Universality of Cross-Cultural And Cross-Disciplinary LMR Perspectives
Directory of Open Access Journals (Sweden)
Marta Szabo White
2010-10-01
Full Text Available The contribution of this paper suggests that previous research underscoring cross-cultural differences may be misleading, when in fact it is cross-professional rather than cross-cultural differences that should be emphasized. Employing the LMR framework, this paper concludes that business or non-business predisposition has a more direct impact on one's individual cultural profile than does nationality. Regardless of culture, persons involved in business are characterized primarily by linear-active modes of communication, and persons not involved in business typically employ less linear and more multi-active/hybrid modes of communication. The linkages among individual characteristics, communication styles, work behaviors, and the extent to which the LMR constructs can facilitate and predict leadership, negotiating styles, individual behaviors, etc. are central to academic globalization and preparing global business leaders.
Integral nucleus-nucleus cross sections
International Nuclear Information System (INIS)
Barashenkov, V.S.; Kumawat, H.
2003-01-01
Expressions approximating the experimental integral cross sections for elastic and inelastic interactions of light and heavy nuclei at the energies up to several GeV/nucleon are presented. The calculated cross sections are inside the corridor of experimental errors or very close to it. Described in detail FORTRAN code and a numerical example of the cross section approximation are also presented
Comparison of integral cross section values of several cross section libraries in the SAND-II format
International Nuclear Information System (INIS)
Zijp, W.L.; Nolthenius, H.J.
1978-01-01
A comparison of some integral cross section values for several cross section libraries in the SAND-II format is presented. The integral cross section values are calculated with aid of the spectrum functions for a Watt fission spectrum, a 1/E spectrum and a Maxwellian spectrum. The libraries which are considered here are CCC-112B, ENDF/B-IV, DETAN74, LAPENAS and CESNEF. These 5 cross section libraries used have all the SAND-II format. (author)
Border Crossings, US-Mexico Border, 2010, NAVTEQ
U.S. Environmental Protection Agency — NAVTEQ Border Crossings for Region 9. The Border Crossing layer contains all international border crossings for all motorway crossings, as well as other important...
Various aspects of cross-cultural communication
Tsibulya, N.
2014-01-01
The author considers the main cultural dimensions and tendencies in cross-cultural communication studies from the 1950s till the present day. Using one’s own experience in carrying out research of non-verbal and prosodic aspects of cross-cultural interaction, the author suggests a system of exercises useful in teaching and learning cross-cultural communication and aimed at formation and developing cross-cultural competence.
Electron collision cross sections of mercury
International Nuclear Information System (INIS)
Suzuki, Susumu; Kuzuma, Kiyotaka; Itoh, Haruo
2006-01-01
In this paper, we propose a new collision cross section set for mercury which revises the original set summarized by Hayashi in 1989. Hanne reported three excitation collision cross sections (6 3 P 0 , 6 3 P 1 , 6 3 P 2 ) determined from an electron beam experiment in 1988. As a matter for regret, no attentive consideration was given to combining these three excitation cross sections with the cross section set of Hayashi. Therefore we propose a new set where these three excitation cross sections are included. In this study, other two excitation cross sections (6 1 P 1 , 6 3 D 3 ) except for the three excitation collision cross sections (6 3 P 0 , 6 3 P 1 , 6 3 P 2 ) are taken from the original set of Hayashi. The momentum transfer cross section and the ionization collision cross section are also taken from Hayashi. A Monte Carlo Simulation (MCS) technique is applied for evaluating our new cross section set. The present results of the electron drift velocity and the ionization coefficient are compared to experimental values. Agreement is secured in relation to the electron drift velocity for 1.5 Td 2 ) is the reduced electric field, E (V/cm) is the electric field, N (1/cm 3 ) is the number density of mercury atoms at 0degC, 1 Torr, E/N is also equal to 2.828 x 10 -17 E/p 0 from the relation of the ideal gas equation, p 0 (Torr) is gas pressure at 0degC, 1 Torr=1.33322 x 10 -2 N/cm -2 and 10 -17 V/cm 2 is called 1 Td. Thus it is ensured that our new cross section set is reasonable enough to be used up to 100 eV when considering with the electron drift velocity and the ionization coefficient. (author)
Cross-relaxation solid state lasers
International Nuclear Information System (INIS)
Antipenko, B.M.
1989-01-01
Cross-relaxation functional diagrams provide a high quantum efficiency for pumping bands of solid state laser media and a low waste heat. A large number of the cross-relaxation mechanisms for decay rare earth excited states in crystals have been investigated. These investigations have been a starting-point for development of the cross-relaxation solid state lasers. For example, the cross-relaxation interactions, have been used for the laser action development of LiYF 4 :Gd-Tb. These interactions are important elements of the functional diagrams of the 2 μm Ho-doped media sensitized with Er and Tm and the 3 μm Er-doped media. Recently, new efficient 2 μm laser media with cross-relaxation pumping diagrams have been developed. Physical aspects of these media are the subject of this paper. A new concept of the Er-doped medium, sensitized with Yb, is illustrated
Background-cross-section-dependent subgroup parameters
International Nuclear Information System (INIS)
Yamamoto, Toshihisa
2003-01-01
A new set of subgroup parameters was derived that can reproduce the self-shielded cross section against a wide range of background cross sections. The subgroup parameters are expressed with a rational equation which numerator and denominator are expressed as the expansion series of background cross section, so that the background cross section dependence is exactly taken into account in the parameters. The advantage of the new subgroup parameters is that they can reproduce the self-shielded effect not only by group basis but also by subgroup basis. Then an adaptive method is also proposed which uses fitting procedure to evaluate the background-cross-section-dependence of the parameters. One of the simple fitting formula was able to reproduce the self-shielded subgroup cross section by less than 1% error from the precise evaluation. (author)
Photon-splitting cross sections
International Nuclear Information System (INIS)
Johannessen, A.M.; Mork, K.J.; Overbo, I.
1980-01-01
The differential cross section for photon splitting (scattering of one photon into two photons) in a Coulomb field, obtained earlier by Shima, has been integrated numerically to yield various differential cross sections. Energy spectra differential with respect to the energy of one of the outgoing photons are presented for several values of the primary photon energy. Selected examples of recoil momentum distributions and some interesting doubly or multiply differential cross sections are also given. Values for the total cross section are obtained essentially for all energies. The screening effect caused by atomic electrons is also taken into account, and is found to be important for high energies, as in e + e - pair production. Comparisons with various approximate results obtained by previous authors mostly show fair agreement. We also discuss the possibilities for experimental detection and find the most promising candidate to be a measurement of both photons, and their energies, at a moderately high energy
Electron-impact cross sections of Ne
International Nuclear Information System (INIS)
Tsurubuchi, S.; Arakawa, K.; Kinokuni, S.; Motohashi, K.
2000-01-01
Electron-impact absolute emission cross sections were measured for the 3p→3s transitions of Ne. Excitation functions of the 3s→2p first resonance lines were measured in the energy range from the threshold to 1000 eV by a polarization-free optical method and relative cross sections were normalized to the absolute values, (41.0±5.4)x10 -19 cm 2 for the 73.6 nm line and (7.1±1.0)x10 -19 cm 2 for the 74.4 nm line, which were determined at 500 eV. The integrated level-excitation cross sections of Suzuki et al for the 1s 2 and 1s 4 levels were combined with the corresponding 3p→3s cascade cross sections obtained in this paper to give absolute emission cross sections for the resonance lines. The level-excitation cross sections of the 1s 2 and 1s 4 states in Paschen notation were determined from the threshold to 1000 eV by subtracting 3p→3s cascade cross sections from the corresponding 3s→2p emission cross sections of the resonance lines. A large cascade contribution is found in the emission cross section of the resonance lines. It is 28.5% for the 73.6 nm line and 49.6% for the 74.4 nm line at 40 eV, and 17.0 and 61.8%, respectively, at 300 eV. (author)
Cross-section methodology in SIMMER
International Nuclear Information System (INIS)
Soran, P.D.
1975-11-01
The cross-section methodology incorporated in the SIMMER code is described. Data base for all cross sections is the ENDF/B system with various progressing computer codes to group collapse and modify the group constants which are used in SIMMER. Either infinitely dilute cross sections or the Bondarenko formalism can be used in SIMMER. Presently only a microscopic treatment is considered, but preliminary macroscopic algorithms have been investigated
Cross-section methodology in SIMMER
International Nuclear Information System (INIS)
Soran, P.D.
1976-05-01
The cross-section methodology incorporated in the SIMMER code is described. Data base for all cross sections is the ENDF/B system with various progressing computer codes to group collapse and modify the group constants which are used in SIMMER. Either infinitely dilute cross sections or the Bondarenko formalism can be used in SIMMER. Presently only a microscopic treatment is considered, but preliminary macroscopic algorithms have been investigated
Women Mentoring in the Academe: A Faculty Cross-Racial and Cross-Cultural Experience
Guramatunhu-Mudiwa, Precious; Angel, Roma B.
2017-01-01
Two women faculty members, one White from the southeastern United States and one Black African from Zimbabwe, purposefully explored their informal mentoring relationship with the goal of illuminating the complexities associated with their cross-racial, cross-cultural experience. Concentrating on their four-year mentor-mentee academic relationship…
Boundary Crossing in R&D Projects in Schools: Learning through Cross-Professional Collaboration
Schenke, Wouter; van Driel, Jan; Geijsel, Femke P.; Volman, Monique L. L.
2017-01-01
Background/Context: School leaders, teachers, and researchers are increasingly involved in collaborative research and development (R&D) projects in schools, which encourage crossing boundaries between the fields of school and research. It is not clear, however, what and how professionals in these projects learn through cross-professional…
Neutron cross sections: Book of curves
International Nuclear Information System (INIS)
McLane, V.; Dunford, C.L.; Rose, P.F.
1988-01-01
Neuton Cross Sections: Book of Curves represents the fourth edition of what was previously known as BNL-325, Neutron Cross Sections, Volume 2, CURVES. Data is presented only for (i.e., intergrated) reaction cross sections (and related fission parameters) as a function of incident-neutron energy for the energy range 0.01 eV to 200 MeV. For the first time, isometric state production cross sections have been included. 11 refs., 4 figs
International Nuclear Information System (INIS)
Del Duca, V.
1992-11-01
Minijet production in jet inclusive cross sections at hadron colliders, with large rapidity intervals between the tagged jets, is evaluated by using the BFKL pomeron. We describe the jet inclusive cross section for an arbitrary number of tagged jets, and show that it behaves like a system of coupled pomerons
International Nuclear Information System (INIS)
Posselt, K.; Haedrich, W.
1986-01-01
In practice the cross-linking of irradiated polyethylene is mostly characterized by solubility and thermomechanical data. The irradiation of samples of a LDPE and a HDPE yields very different gel-dose curves. But for a quantitative comparison the complicated connection between the gel values and the corresponding densities of cross-links, especially the dependence on the initial molecular size distribution, has to take into consideration. The analysis of the solubility data according to the statistical theory of cross-linking developed by Inokuti and Saito shows that at equal doses in both investigated PE types in spite of the different gel values nearly the same densities of cross-links are present. That result is confirmed by the densities of cross-links determined from stress-strain measurements at 423 K. (author)
Experimental study of crossing angle collision
International Nuclear Information System (INIS)
Chen, T.; Rice, D.; Rubin, D.; Sagan, D.; Tigner, M.
1993-01-01
The non-linear coupling due to the beam-beam interaction with crossing angle has been studied. The major effect of a small (∼12mrad) crossing angle is to excite 5Q x ±Q s =integer coupling resonance family on large amplitude particles, which results in bad lifetime. On the CESR, a small crossing angle (∼2.4mr) was created at the IP and a reasonable beam-beam tune-shift was achieved. The decay rate of the beam is measured as a function of horizontal tune with and without crossing angle. The theoretical analysis, simulation and experimental measurements have a good agreement. The resonance strength as a function of crossing angle is also measured
Vermont Center for Geographic Information — Physical measurements and attributes of stream crossing structures and adjacent stream reaches which are used to provide a relative rating of aquatic organism...
CrossLink: a novel method for cross-condition classification of cancer subtypes.
Ma, Chifeng; Sastry, Konduru S; Flore, Mario; Gehani, Salah; Al-Bozom, Issam; Feng, Yusheng; Serpedin, Erchin; Chouchane, Lotfi; Chen, Yidong; Huang, Yufei
2016-08-22
We considered the prediction of cancer classes (e.g. subtypes) using patient gene expression profiles that contain both systematic and condition-specific biases when compared with the training reference dataset. The conventional normalization-based approaches cannot guarantee that the gene signatures in the reference and prediction datasets always have the same distribution for all different conditions as the class-specific gene signatures change with the condition. Therefore, the trained classifier would work well under one condition but not under another. To address the problem of current normalization approaches, we propose a novel algorithm called CrossLink (CL). CL recognizes that there is no universal, condition-independent normalization mapping of signatures. In contrast, it exploits the fact that the signature is unique to its associated class under any condition and thus employs an unsupervised clustering algorithm to discover this unique signature. We assessed the performance of CL for cross-condition predictions of PAM50 subtypes of breast cancer by using a simulated dataset modeled after TCGA BRCA tumor samples with a cross-validation scheme, and datasets with known and unknown PAM50 classification. CL achieved prediction accuracy >73 %, highest among other methods we evaluated. We also applied the algorithm to a set of breast cancer tumors derived from Arabic population to assign a PAM50 classification to each tumor based on their gene expression profiles. A novel algorithm CrossLink for cross-condition prediction of cancer classes was proposed. In all test datasets, CL showed robust and consistent improvement in prediction performance over other state-of-the-art normalization and classification algorithms.
49 CFR 236.384 - Cross protection.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Cross protection. 236.384 Section 236.384 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... and Tests § 236.384 Cross protection. Cross protection shall be tested at least once every six months...
Cross-Border Exposures and Financial Contagion
Degryse, H.A.; Elahi, M.A.; Penas, M.F.
2009-01-01
Integrated financial markets provide opportunities for expansion and improved risk sharing, but also pose threats of contagion risk through cross-border exposures. This paper examines cross-border contagion risk over the period 1999-2006. To that purpose we use aggregate cross-border exposures of
Highway-Rail Crossings Inventory Data
Department of Transportation — The entire National Highway-Rail Crossing Inventory is available in three separate downloadble files. There is a file of all current Public-at-Grade crossings. There...
Nuclear Forensics and Radiochemistry: Cross Sections
Energy Technology Data Exchange (ETDEWEB)
Rundberg, Robert S. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2017-11-08
The neutron activation of components in a nuclear device can provide useful signatures of weapon design or sophistication. This lecture will cover some of the basics of neutron reaction cross sections. Nuclear reactor cross sections will also be presented to illustrate the complexity of convolving neutron energy spectra with nuclear excitation functions to calculate useful effective reactor cross sections. Deficiencies in the nuclear database will be discussed along with tools available at Los Alamos to provide new neutron cross section data.
Recent trends in cross-border banking
De Haas, Ralph; van Horen, Neeltje; Beck, Thorsten; Casu, Barbara
2017-01-01
This chapter identifies a number of recent trends in European cross-border banking. The authors first distinguish between two main modes of international banking: cross-border versus multinational banking. Cross-border banking occurs when a bank in country A lends directly to a borrower in country
CHALLENGES IN CROSS CULTURAL ADVERTISING
Directory of Open Access Journals (Sweden)
Yuni Retnowati
2016-04-01
Full Text Available At first, marketing practitioners and academics consider standardized approaches to marketing and advertising strategies in globalization, and then some studies proved that the standardization of advertising across culture is not valid. Therefore, cross cultural advertising takes local culture into account when conveying messages in advertisements. Cross cultural understanding is very important in order to produce successful localized advertising that would reflect the cultural values and norms of intended audience. Challenge in cross cultural advertising is the problem of communicating to people of diverse cultural background. Cross cultural solutions are applied in areas such as language, communication style, images and cultural values. Cross cultural advertising is simply about using common sense and analyzing how the different elements of an advertising campaign are impacted by culture and modifying them to best speak to the target audience. Other challenges are determining between standardization and adaptation of cultural values content of advertising when facing different people from diverse cultures. In academic side, the challenge is preparing students to design advertisements that communicate effectively to diverse cultures.
Evaluated cross section libraries
International Nuclear Information System (INIS)
Maqurno, B.A.
1976-01-01
The dosimetry tape (ENDF/B-IV tape 412) was issued in a general CSEWG distribution, August 1974. The pointwise cross section data file was tested with specified reference spectra. A group averaged cross section data file (620 groups based on tape 412) was tested with the above spectra and the results are presented in this report
Cross-Cultural Interpretations of Curricular Contextual Crossings
Schlein, Candace; Garii, Barbara
2011-01-01
Teachers--who are generally representatives of the cultural mainstream--are expected to use global experiences to become culturally enhanced and to bring these enhancements back to their classrooms. In this article, the authors discuss a cross-cultural exploration of investigations into the experiences of Canadian and U.S. educators with…
30 CFR 57.9104 - Railroad crossings.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Railroad crossings. 57.9104 Section 57.9104... SAFETY AND HEALTH SAFETY AND HEALTH STANDARDS-UNDERGROUND METAL AND NONMETAL MINES Loading, Hauling, and Dumping Traffic Safety § 57.9104 Railroad crossings. Designated railroad crossings shall be posted with...
50 CFR 18.88 - Cross-examination.
2010-10-01
... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Cross-examination. 18.88 Section 18.88... PLANTS (CONTINUED) MARINE MAMMALS Notice and Hearing on Section 103 Regulations § 18.88 Cross-examination... examination; and (2) Exclude cross-examination questions that are immaterial, irrelevant or unduly repetitious...
Activation cross section data file, (1)
International Nuclear Information System (INIS)
Yamamuro, Nobuhiro; Iijima, Shungo.
1989-09-01
To evaluate the radioisotope productions due to the neutron irradiation in fission of fusion reactors, the data for the activation cross sections ought to be provided. It is planning to file more than 2000 activation cross sections at final. In the current year, the neutron cross sections for 14 elements from Ni to W have been calculated and evaluated in the energy range 10 -5 to 20 MeV. The calculations with a simplified-input nuclear cross section calculation system SINCROS were described, and another method of evaluation which is consistent with the JENDL-3 were also mentioned. The results of cross section calculation are in good agreement with experimental data and they were stored in the file 8, 9 and 10 of ENDF/B format. (author)
Differential Top Cross-section Measurements
Fenton, Michael James; The ATLAS collaboration
2017-01-01
The top quark is the heaviest known fundamental particle. The measurement of the differential top-quark pair production cross-section provides a stringent test of advanced perturbative QCD calculations. The ATLAS collaboration has performed detailed measurements of those differential cross sections at a centre-of-mass energy of 13 TeV. This talk focuses on differential cross-section measurements in the lepton+jets final state, including using boosted top quarks to probe our understanding of top quark production in the TeV regime.
Cross-link guided molecular modeling with ROSETTA.
Directory of Open Access Journals (Sweden)
Abdullah Kahraman
Full Text Available Chemical cross-links identified by mass spectrometry generate distance restraints that reveal low-resolution structural information on proteins and protein complexes. The technology to reliably generate such data has become mature and robust enough to shift the focus to the question of how these distance restraints can be best integrated into molecular modeling calculations. Here, we introduce three workflows for incorporating distance restraints generated by chemical cross-linking and mass spectrometry into ROSETTA protocols for comparative and de novo modeling and protein-protein docking. We demonstrate that the cross-link validation and visualization software Xwalk facilitates successful cross-link data integration. Besides the protocols we introduce XLdb, a database of chemical cross-links from 14 different publications with 506 intra-protein and 62 inter-protein cross-links, where each cross-link can be mapped on an experimental structure from the Protein Data Bank. Finally, we demonstrate on a protein-protein docking reference data set the impact of virtual cross-links on protein docking calculations and show that an inter-protein cross-link can reduce on average the RMSD of a docking prediction by 5.0 Å. The methods and results presented here provide guidelines for the effective integration of chemical cross-link data in molecular modeling calculations and should advance the structural analysis of particularly large and transient protein complexes via hybrid structural biology methods.
Crossing borders via mental bridges
DEFF Research Database (Denmark)
Keil, Dirk
The project studies cross-border regional integration in Europe drawing on the example of the emerging Danish-German Femern Belt Region. It focuses on cross-border networking within public administration as part of regional integra- tion. My central question is how national-cultural differences...... influence coopera- tion, coordination and collaboration in administrative cross-border networks. In this connection the project asks after the perception of regional integration seen from the different national backgrounds. The research concentrates on the group of decision makers within the field of public...... administration, and in specific on the attempt to initiate and promote cross-border regional integration via the building of mental bridges between Danish and German parts of the Femern Belt Region. Here one of the first projects aiming primarily at building mental bridges in the Femern Belt Region...
A new methodology of spatial cross-correlation analysis.
Chen, Yanguang
2015-01-01
Spatial correlation modeling comprises both spatial autocorrelation and spatial cross-correlation processes. The spatial autocorrelation theory has been well-developed. It is necessary to advance the method of spatial cross-correlation analysis to supplement the autocorrelation analysis. This paper presents a set of models and analytical procedures for spatial cross-correlation analysis. By analogy with Moran's index newly expressed in a spatial quadratic form, a theoretical framework is derived for geographical cross-correlation modeling. First, two sets of spatial cross-correlation coefficients are defined, including a global spatial cross-correlation coefficient and local spatial cross-correlation coefficients. Second, a pair of scatterplots of spatial cross-correlation is proposed, and the plots can be used to visually reveal the causality behind spatial systems. Based on the global cross-correlation coefficient, Pearson's correlation coefficient can be decomposed into two parts: direct correlation (partial correlation) and indirect correlation (spatial cross-correlation). As an example, the methodology is applied to the relationships between China's urbanization and economic development to illustrate how to model spatial cross-correlation phenomena. This study is an introduction to developing the theory of spatial cross-correlation, and future geographical spatial analysis might benefit from these models and indexes.
Desmosine-Inspired Cross-Linkers for Hyaluronan Hydrogels
Hagel, Valentin; Mateescu, Markus; Southan, Alexander; Wegner, Seraphine V.; Nuss, Isabell; Haraszti, Tamás; Kleinhans, Claudia; Schuh, Christian; Spatz, Joachim P.; Kluger, Petra J.; Bach, Monika; Tussetschläger, Stefan; Tovar, Günter E. M.; Laschat, Sabine; Boehm, Heike
2013-06-01
We designed bioinspired cross-linkers based on desmosine, the cross-linker in natural elastin, to prepare hydrogels with thiolated hyaluronic acid. These short, rigid cross-linkers are based on pyridinium salts (as in desmosine) and can connect two polymer backbones. Generally, the obtained semi-synthetic hydrogels are form-stable, can withstand repeated stress, have a large linear-elastic range, and show strain stiffening behavior typical for biopolymer networks. In addition, it is possible to introduce a positive charge to the core of the cross-linker without affecting the gelation efficiency, or consequently the network connectivity. However, the mechanical properties strongly depend on the charge of the cross-linker. The properties of the presented hydrogels can thus be tuned in a range important for engineering of soft tissues by controlling the cross-linking density and the charge of the cross-linker.
Cohen-Kettenis, Peggy T; Wallien, Madeleine; Johnson, Laurel L; Owen-Anderson, Allison F H; Bradley, Susan J; Zucker, Kenneth J
2006-07-01
A one-factor, 14-item parent-report Gender Identity Questionnaire for Children (GIQC) was developed in a sample of 325 clinic-referred children with gender identity problems and 504 controls from Toronto, Canada (Johnson et al., 2004). In this study, we report a cross-national, cross-clinic comparative analysis of the GIQC on gender-referred children (N = 338) from Toronto and gender-referred children (N = 175) from Utrecht, The Netherlands. Across clinics, the results showed both similarities and differences. Gender-referred boys from Utrecht had a significantly higher total score (indicating more cross-gender behavior) than did gender-referred boys from Toronto, but there was no significant difference for girls. In the Toronto sample, the gender-referred girls had a significantly higher total score than the gender-referred boys, but there was no significant sex difference in the Utrecht sample. Across both clinics, gender-referred children who met the complete DSM criteria for gender identity disorder (GID) had a significantly higher cross-gender score than the gender-referred children who were subthreshold for GID (Cohen's d = 1.11). The results of this study provide the first empirical evidence of relative similarity in cross-gender behavior in a sample of gender-referred children from western Europe when compared to North American children. The results also provide some support for cross-clinic consistency in clinician-based diagnosis of GID.
The Crossing Speed of Elderly Pedestrians
Directory of Open Access Journals (Sweden)
Ana Trpković
2017-04-01
Full Text Available The population of elderly people is rapidly growing and in terms of safety, senior pedestrians represent one of the most vulnerable group. The pedestrian crossing speed is a significant input parameter in traffic engineering, which can have effect on pedestrians’ safety, especially of older population. The objective of this study was to determine the value of the crossing speed of elderly pedestrians (65+ for different types of urban crossings. The research was conducted at ten intersections in the city of Belgrade, Serbia, using the method of direct observation and a questionnaire for collecting data. The data were analysed in the statistical software package IBM SPSS Statistics. The results showed that elderly pedestrians walk slower and the crossing type significantly influenced the speed of older population. The order of crossing types in relation to the measured speed is ranked as follows, from the lowest to the highest speed value: unsignalized, signalized, signalized with pedestrian countdown display, signalized with pedestrian island and pedestrian countdown display and finally signalized crossing with pedestrian island. According to the questionnaire results, the elderly recognize the importance of implementing pedestrian counters. This indicates the necessity to provide safe street crossing for the elderly using the corresponding engineering measures.
40 CFR 750.40 - Cross-examination.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Cross-examination. 750.40 Section 750... Processing and Distribution in Commerce Exemptions § 750.40 Cross-examination. (a) After the close of the... cross-examination. The request must be received by EPA within one week after a full transcript of the...
Adverse selection without single crossing
DEFF Research Database (Denmark)
Schottmüller, Christoph
2015-01-01
The single-crossing assumption simplifies the analysis of screening models as local incentive compatibility becomes sufficient for global incentive compatibility. If single crossing is violated, global incentive compatibility constraints have to be taken into account. This paper studies monotone...... solutions in a screening model that allows a one-time violation of single crossing. The results show that local and non-local incentive constraints distort the solution in opposite directions. Therefore, the optimal decision might involve distortions above as well as below the first-best decision...
Bianisotropic metamaterials based on twisted asymmetric crosses
International Nuclear Information System (INIS)
Reyes-Avendaño, J A; Sampedro, M P; Juárez-Ruiz, E; Pérez-Rodríguez, F
2014-01-01
The effective bianisotropic response of 3D periodic metal-dielectric structures, composed of crosses with asymmetrically-cut wires, is investigated within a general homogenization theory using the Fourier formalism and the form-factor division approach. It is found that the frequency dependence of the effective permittivity for a system of periodically-repeated layers of metal crosses exhibits two strong resonances, whose separation is due to the cross asymmetry. Besides, bianisotropic metamaterials, having a base of four twisted asymmetric crosses, are proposed. The designed metamaterials possess negative refractive index at frequencies determined by the cross asymmetry, the gap between the arms of adjacent crosses lying on the same plane, and the type of Bravais lattice. (papers)
Regulation of Cross-holdings between European Companies
DEFF Research Database (Denmark)
Sørensen, Karsten Engsig
2003-01-01
Cross-holdings can be a barrier to takeovers, and they may have other disadvantages. This article analyses how cross-holdings may be regulated to avoid these negative effects.......Cross-holdings can be a barrier to takeovers, and they may have other disadvantages. This article analyses how cross-holdings may be regulated to avoid these negative effects....
45 CFR 81.79 - Cross-examination.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Cross-examination. 81.79 Section 81.79 Public... UNDER PART 80 OF THIS TITLE Hearing Procedures § 81.79 Cross-examination. A witness may be cross-examined on any matter material to the proceeding without regard to the scope of his direct examination. ...
Utilization of cross-section covariance data in FBR core nuclear design and cross-section adjustment
International Nuclear Information System (INIS)
Ishikawa, Makoto
1994-01-01
In the core design of large fast breeder reactors (FBRs), it is essentially important to improve the prediction accuracy of nuclear characteristics from the viewpoint of both reducing cost and insuring reliability of the plant. The cross-section errors, that is, covariance data are one of the most dominant sources for the prediction uncertainty of the core parameters, therefore, quantitative evaluation of covariance data is indispensable for FBR core design. The first objective of the present paper is to introduce how the cross-section covariance data are utilized in the FBR core nuclear design works. The second is to delineate the cross-section adjustment study and its application to an FBR design, because this improved design method markedly enhances the needs and importance of the cross-section covariance data. (author)
[Factors associated with cross-nursing].
von Seehausen, Mariana Pujól; Oliveira, Maria Inês Couto de; Boccolini, Cristiano Siqueira
2017-05-01
This article aims to estimate the prevalence and analyze the factors associated with cross-nursing. A cross-sectional study was conducted in 2013 with interviews with a representative sample of mothers of infants less than one-year-old (n' = 695) attended in nine primary health units in Rio de Janeiro, Brazil. Sociodemographic characteristics were studied; pregnancy, childbirth and primary care assistance; maternal habits and baby features. Adjusted prevalence ratios (PR) were obtained by Poisson Regression, retaining variables associated with the outcome in the final model (p ≤ 0.05). Cross-nursing was practiced by 29.4% of the mothers. Most practitioner mothers were relatives or friends. The following variables were directly associated with cross-nursing: being an adolescent mother (PR' = 1.595), smoking (PR' = 1.396), alcohol consumption (PR' = 1.613), inappropriate baby feeding habits (PR' = 1.371) and infant's age in months (PR' = 1.066). Maternal formal employment was inversely associated with the practice (PR' = 0.579). Cross-nursing has a relevant prevalence among mothers assisted by primary health care units in Rio de Janeiro City. This issue should be addressed, especially among the most vulnerable groups, due to the association with adolescence and with unhealthy habits.
A New Methodology of Spatial Cross-Correlation Analysis
Chen, Yanguang
2015-01-01
Spatial correlation modeling comprises both spatial autocorrelation and spatial cross-correlation processes. The spatial autocorrelation theory has been well-developed. It is necessary to advance the method of spatial cross-correlation analysis to supplement the autocorrelation analysis. This paper presents a set of models and analytical procedures for spatial cross-correlation analysis. By analogy with Moran’s index newly expressed in a spatial quadratic form, a theoretical framework is derived for geographical cross-correlation modeling. First, two sets of spatial cross-correlation coefficients are defined, including a global spatial cross-correlation coefficient and local spatial cross-correlation coefficients. Second, a pair of scatterplots of spatial cross-correlation is proposed, and the plots can be used to visually reveal the causality behind spatial systems. Based on the global cross-correlation coefficient, Pearson’s correlation coefficient can be decomposed into two parts: direct correlation (partial correlation) and indirect correlation (spatial cross-correlation). As an example, the methodology is applied to the relationships between China’s urbanization and economic development to illustrate how to model spatial cross-correlation phenomena. This study is an introduction to developing the theory of spatial cross-correlation, and future geographical spatial analysis might benefit from these models and indexes. PMID:25993120
Seeds of Cross-Media Production
DEFF Research Database (Denmark)
Bødker, Susanne; Petersen, Anja Bechmann
2007-01-01
We present an empirical study of an organization that has recently moved from traditional newspaper production towards cross-media production involving the integrated digital production of newspaper, television, radio and web-news. The paper focuses on the daily production rhythms of the media...... separately and of cross-media production. Since cross-media production is in the making, we study the instruments currently used for planning and coordination, and analyze them as seeds that will eventually make cross-media production happen. Time and timing are important in news production in general......, and our analyses focus on the rhythm of the daily planning, coordination and production processes. Specifically, we analyze the temporal coordination of the activities in and around the Superdesk – the current center of coordination of the news organization, and of the persons who work specifically...
Wei, Yun-Lan; Yu, Zu-Guo; Zou, Hai-Long; Anh, Vo
2017-06-01
A new method—multifractal temporally weighted detrended cross-correlation analysis (MF-TWXDFA)—is proposed to investigate multifractal cross-correlations in this paper. This new method is based on multifractal temporally weighted detrended fluctuation analysis and multifractal cross-correlation analysis (MFCCA). An innovation of the method is applying geographically weighted regression to estimate local trends in the nonstationary time series. We also take into consideration the sign of the fluctuations in computing the corresponding detrended cross-covariance function. To test the performance of the MF-TWXDFA algorithm, we apply it and the MFCCA method on simulated and actual series. Numerical tests on artificially simulated series demonstrate that our method can accurately detect long-range cross-correlations for two simultaneously recorded series. To further show the utility of MF-TWXDFA, we apply it on time series from stock markets and find that power-law cross-correlation between stock returns is significantly multifractal. A new coefficient, MF-TWXDFA cross-correlation coefficient, is also defined to quantify the levels of cross-correlation between two time series.
JENDL gas-production cross section file
International Nuclear Information System (INIS)
Nakagawa, Tsuneo; Narita, Tsutomu
1992-05-01
The JENDL gas-production cross section file was compiled by taking cross-section data from JENDL-3 and by using the ENDF-5 format. The data were given to 23 nuclei or elements in light nuclei and structural materials. Graphs of the cross sections and brief description on their evaluation methods are given in this report. (author)
40 CFR 750.8 - Cross-examination.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Cross-examination. 750.8 Section 750.8... Section 6 of the Toxic Substances Control Act § 750.8 Cross-examination. (a) After the close of the... cross-examination. The request shall be received by EPA within one week after a full transcript of the...
Toy models of crossed Andreev reflection
International Nuclear Information System (INIS)
Melin, R; Jirari, H; Peysson, S
2003-01-01
We propose toy models of crossed Andreev reflection in multiterminal hybrid structures containing out-of-equilibrium conductors. We apply the description to two possible experiments: (i) to a device containing a large quantum dot inserted in a crossed Andreev reflection circuit, and (ii) to a device containing an Aharonov-Bohm loop inserted in a crossed Andreev reflection circuit
Is the quasielastic pion cross section really bigger than the pion-nucleus reaction cross section
International Nuclear Information System (INIS)
Silbar, R.R.
1979-01-01
It is shown that soft pion charge exchanges may increase the inclusive (π + ,π 0 ') cross section, relative to the total quasielastic (π + ,π + ') cross section, by as much as a factor of two. 4 references
Directory of Open Access Journals (Sweden)
Inga Minelgaite Snaebjornsson
2015-05-01
Full Text Available Ongoing low participation of women in global leadership calls for more research in this field. In this article, we set out to include gendered expectations toward leader behavior as part of cross-cultural leadership theory. Building on an existing body of research, we focus on propositions about the effects of gendered expectations on the leader, from the followers’ standpoint. The consideration of gendered effects from the follower standpoint is an under-researched area in leadership literature, and it is even more rarely to be found in empirical data. In every culture, there are certain expectations toward leaders of the two genders that influence their behavior. In this article, we will attempt to answer the following question: How does perceived leader behavior and gendered behavior relate to national culture and actual leader behavior? We present a conceptual model that seeks to incorporate gendered expectations into cross-cultural leadership as an answer. Moreover, we provide a conceptual guideline toward operationalization of the model. The model includes the potential of dissonance between male expectations as a dominating leadership role and female leadership. This might serve as an explanation as to why in some cases women are not seen as successful as men when they adopt a masculine leadership style. The article seeks to advance cross-cultural leadership theory by focusing on expected gendered leadership behavior. Our ideas and model could eventually contribute to the advancement of leadership theory, as well as contributing to gender studies, cross-cultural leadership, and business communication.
Border Crossing Points, US-Mexico Border, 2015, NAVTEQ
U.S. Environmental Protection Agency — NAVTEQ Border Crossings for the United States. The Border Crossing layer contains all international border crossings for all motorway crossings, as well as other...
Density-dependent expressions for photoionization cross-sections
International Nuclear Information System (INIS)
Sun Weiguo; Ma Xiaoguang; Cheng Yansong
2004-01-01
Alternative expressions for photoionization cross-sections and dielectric influence functions are suggested to study the photoionization cross-sections of atoms in solid system. The basic picture is that the photoionization cross-section of atoms in a real system can be described as the coupling between quantum quantity (QQ) and classical quantity (CQ) parts. The QQ part represents the photoionization cross-sections of an isolated particle, while the CQ part may represent most of the important influence of the macroscopic effects (e.g., the interactions of all surrounding polarized particles, and the dielectric property, etc.) on the photoionization cross-sections. The applications to the barium system show that the number-density-dependent new photoionization formula not only obtains the same cross-sections as those from the first order approximation for ideal gas, but also can generate the cross-sections for solid barium by transforming those of ideal gas of the same species using the dielectric influence function
Density-dependent expressions for photoionization cross-sections
Energy Technology Data Exchange (ETDEWEB)
Sun Weiguo; Ma Xiaoguang; Cheng Yansong
2004-06-07
Alternative expressions for photoionization cross-sections and dielectric influence functions are suggested to study the photoionization cross-sections of atoms in solid system. The basic picture is that the photoionization cross-section of atoms in a real system can be described as the coupling between quantum quantity (QQ) and classical quantity (CQ) parts. The QQ part represents the photoionization cross-sections of an isolated particle, while the CQ part may represent most of the important influence of the macroscopic effects (e.g., the interactions of all surrounding polarized particles, and the dielectric property, etc.) on the photoionization cross-sections. The applications to the barium system show that the number-density-dependent new photoionization formula not only obtains the same cross-sections as those from the first order approximation for ideal gas, but also can generate the cross-sections for solid barium by transforming those of ideal gas of the same species using the dielectric influence function.
Cross-border innovation cooperation
DEFF Research Database (Denmark)
Hjaltadóttir, Rannveig Edda; Makkonen, Teemu; Sørensen, Nils Karl
2017-01-01
Finding a suitable partner is paramount for the success of innovation cooperation. Thus, this paper sets out to analyse the determinants of cross-border innovation cooperation in Denmark by focusing on partner selection. The aim of the article is to investigate determinants of partner selection...... by taking the location of the partners into account. In particular, the discussion is tied to the notion of varying knowledge bases firms utilize in their innovation creation processes. Firm level data from the 2010 Community Innovation Survey in Denmark was utilized to analyse cross-border innovation...... of innovativeness increase the likelihood of cross-border innovation cooperation. Accordingly, geographical proximity to international borders is found to have a significant, positive effect on selecting partners within the European Union. The multivariate probit model shows that the decision of choosing a domestic...
The safety of pedestrian crossing
Goede, M. de; Groenewoud, C.; Horst, A.R.A. van der
2010-01-01
More than half of all severe traffic accidents in which pedestrians or cyclists are involved, occur during road crossing. In this chapter insights, based on previous studies and literature, concerning requirements for safe and comfortable crossing facilities are discussed. In order to develop
Doppler broadening of cross sections
International Nuclear Information System (INIS)
Buckler, P.A.C.; Pull, I.C.
1962-12-01
Expressions for temperature dependent cross-sections in terms of resonance parameters are obtained, involving generalisations of the conventional Doppler functions, ψ and φ. Descriptions of Fortran sub-routines, which calculate broadened cross-sections in accordance with the derived formulae, are included. (author)
Boge, A; Gerstmeier, R; Einspanier, R
1994-11-01
Differentiation between Carabus species (ground beetle) and subspecies is difficult, although there have been extensive studies. To address this problem we have applied PCR in combination with SSCP analysis focussing on the evolutionally conservative ubiquitin gene to elaborate a new approach to molecular differentiation between species. We report that Carabidae possess an ubiquitin gene and that its gene has a multimeric structure. Differential SSCP analysis was performed with the monomeric form of the gene to generate a clear SSCP pattern. Such PCR/SSCP resulted in reproducible patterns throughout our experiments. Comparing different Carabus species (Carabus granulatus, C. irregularis, C. violaceus and C. auronitens) we could observe clear interspecies differences but no differences between genders. Some species showed some remarkable differences between the individuals. We suggest that the ubiquitin PCR-SSCP technique might be an additional tool for the differentiation of ground beetles.
DEFF Research Database (Denmark)
Sørensen, Paul Haase; Nørgård, Peter Magnus; Hansen, Lars Kai
1996-01-01
The leave-one-out cross-validation scheme for generalization assessment of neural network models is computationally expensive due to replicated training sessions. Linear unlearning of examples has recently been suggested as an approach to approximative cross-validation. Here we briefly review...... the linear unlearning scheme, dubbed LULOO, and we illustrate it on a systemidentification example. Further, we address the possibility of extracting confidence information (error bars) from the LULOO ensemble....
Total neutron cross section of lead
International Nuclear Information System (INIS)
Kanda, K.; Aizawa, O.
1976-01-01
The total thermal-neutron cross section of natural lead under various physical conditions was measured by the transmission method. It became clear that the total cross section at room temperature previously reported is lower than the present data. The total cross section at 400, 500, and 600 0 C, above the melting point of lead, 327 0 C, was also measured, and the changes in the cross section as a function of temperature were examined, especially near and below the melting point. The data obtained for the randomly oriented polycrystalline state at room temperature were in reasonable agreement with the theoretical values calculated by the THRUSH and UNCLE-TOM codes
Differences between LASL- and ANL-processed cross sections
International Nuclear Information System (INIS)
Kidman, R.B.; MacFarlane, R.E.; Becker, M.
1978-03-01
As part of the Los Alamos Scientific Laboratory (LASL) cross-section processing development, LASL cross sections and results from MINX/1DX system are compared to the Argonne National Laboratory cross sections and results from the ETOE-2/MC 2 -2 system for a simple reactor problem. Exact perturbation theory is used to establish the eigenvalue effect of every isotope group cross-section difference. Cross sections, cross-section differences, and their eigenvalue effects are clearly and conveniently displayed and compared on a group-by-group basis
CrossFit® instructor demographics and practice trends
Gregory R. Waryasz; Vladimir Suric; Alan H. Daniels; Joseph A. Gil; Craig P. Eberson
2016-01-01
CrossFit® is an increasingly popular exercise modality that uses high intensity power training. The literature to date regarding CrossFit® has focused on its benefits to VO2 Max, body composition and the motivational variables of participants of CrossFit®. A computerized survey was distributed to CrossFit® instructors using Survey Monkey® (Palo Alto, CA, USA). One hundred and ninety-three CrossFit® instructors responded to the survey. Of these 86.6% (155/179) reported being a certified CrossF...
Creating Cross-disciplinary Courses.
Reynolds, Elaine R
2012-01-01
Because of its focus on the biological underpinnings of action and behavior, neuroscience intersects with many fields of human endeavor. Some of these cross-disciplinary intersections have been long standing, while others, such as neurotheology or neuroeconomics, are more recently formed fields. Many undergraduate institutions have sought to include cross-disciplinary courses in their curriculum because this style of pedagogy is often seen as applicable to real world problems. However, it can be difficult for faculty with specialized training within their discipline to expand beyond their own fields to offer cross-disciplinary courses. I have been creating a series of multi- or cross-disciplinary courses and have found some strategies that have helped me successfully teach these classes. I will discuss general strategies and tools in developing these types of courses including: 1) creating mixed experience classrooms of students and contributing faculty 2) finding the right tools that will allow you to teach to a mixed population without prerequisites 3) examining the topic using multiple disciplinary perspectives 4) feeding off student experience and interest 5) assessing the impact of these courses on student outcomes and your neuroscience program. This last tool in particular is important in establishing the validity of this type of teaching for neuroscience students and the general student population.
Winkel, Brian
2012-01-01
We give an example of cross coursing in which a subject or approach in one course in undergraduate mathematics is used in a completely different course. This situation crosses falling body modelling in an upper level differential equations course into a modest discrete dynamical systems unit of a first-year mathematics course. (Contains 1 figure.)
The cross linking of EPDM and NBR rubber
Directory of Open Access Journals (Sweden)
Samardžija-Jovanović Suzana
2005-01-01
Full Text Available In the process of macromolecule cross linking, the choice of type and quantity of the components and the experimental conditions are important to obtain the new cross linked materials with better mechanical and chemical characteristics. The cross linking method depends on the rubber type and structure. Intermolecular cross linking results in the formation elastomer network. The basis of the cross linking process, between ethylene propylene diene rubber (EPDM and acrylonitrile butadiene rubber (NBR, is a chemical reaction. Fillers and other additives are present in different mass ratios in the material. The exploitation properties of the cross linked materials depend on the quantity of additive in the cross linked systems.
Piano Crossing – Walking on a Keyboard
Directory of Open Access Journals (Sweden)
Bojan Kverh
2010-11-01
Full Text Available Piano Crossing is an interactive art installation which turns a pedestrian crossing marked with white stripes into a piano keyboard so that pedestrians can generate music by walking over it. Matching tones are created when a pedestrian steps on a particular stripe or key. A digital camera is directed at the crossing from above. A special computer vision application was developed, which maps the stripes of the pedestrian crossing to piano keys and detects by means of an image over which key the center of gravity of each pedestrian is placed at any given moment. Black stripes represent the black piano keys. The application consists of two parts: (1 initialization, where the model of the abstract piano keyboard is mapped to the image of the pedestrian crossing, and (2 the detection of pedestrians at the crossing, so that musical tones can be generated according to their locations. The art installation Piano crossing was presented to the public for the first time during the 51st Jazz Festival in Ljubljana in July 2010.
Piano Crossing – Walking on a Keyboard
Directory of Open Access Journals (Sweden)
Franc Solina
2010-04-01
Full Text Available Piano Crossing is an interactive art installation which turns a pedestrian crossing marked with white stripes into a piano keyboard so that pedestrians can generate music by walking over it. Matching tones are created when a pedestrian steps on a particular stripe or key. A digital camera is directed at the crossing from above. A special computer vision application was developed, which maps the stripes of the pedestrian crossing to piano keys and detects by means of an image over which key the center of gravity of each pedestrian is placed at any given moment. Black stripes represent the black piano keys. The application consists of two parts: (1 initialization, where the model of the abstract piano keyboard is mapped to the image of the pedestrian crossing, and (2 the detection of pedestrians at the crossing, so that musical tones can be generated according to their locations. The art installation Piano crossing was presented to the public for the first time during the 51st Jazz Festival in Ljubljana in July 2010.
Cross-cultural difference in OSH
Starren, A.; Drupsteen, L.
2014-01-01
In this article we describe cross-cultural aspects in the context of safety management. When working abroad, cross-cultural differences ask for other competencies to enhance safe behaviour than at home due to cultural and language differences. In this wiki some guidance is given on aspects of
Cross-cultural Lifelong Learning
2010-01-01
Globalisation, internationalisation, multiculturalism, immigration, and growing number of cross-cultural encounters are colorising the everyday life both in Western and Eastern parts of the world. However, in most cases, lifelong learning is normally studied in and around a certain condensed culture or from the dominant Western perspective. Thus it is important to ask how we should rebuild our conceptions of 'culture' or 'learning' in the context of these global cross-cultural trends, or how ...
Cross-Disciplinary Collaboration and Learning
Directory of Open Access Journals (Sweden)
Deana D. Pennington
2008-12-01
Full Text Available Complex environmental problem solving depends on cross-disciplinary collaboration among scientists. Collaborative research must be preceded by an exploratory phase of collective thinking that creates shared conceptual frameworks. Collective thinking, in a cross-disciplinary setting, depends on the facility with which collaborators are able to learn and understand each others' perspectives. This paper applies three perspectives on learning to the problem of enabling cross-disciplinary collaboration: Maslow's hierarchy of needs, constructivism, and organizational learning. Application of learning frameworks to collaboration provides insights regarding receptive environments for collaboration, and processes that facilitate cross-disciplinary interactions. These environments and interactions need time to develop and require a long phase of idea generation preceding any focused research effort. The findings highlight that collaboration is itself a complex system of people, scientific theory, and tools that must be intentionally managed. Effective management of the system requires leaders who are facilitators and are capable of orchestrating effective environments and interactions.
Top quark production cross-section measurements
Chen, Ye; The ATLAS collaboration
2017-01-01
Measurements of the inclusive and differential cross-sections for top-quark pair and single top production cross sections in proton-proton collisions with the ATLAS detector at the Large Hadron Collider are presented at center-of-mass energies of 8 TeV and 13 TeV. The inclusive measurements reach high precision and are compared to the best available theoretical calculations. These measurements, including results using boosted tops, probe our understanding of top-pair production in the TeV regime. The results are compared to Monte Carlo generators implementing LO and NLO matrix elements matched with parton showers and NLO QCD calculations. For the t-channel single top measurement, the single top-quark and anti-top-quark total production cross-sections, their ratio, as well as differential cross sections are also presented. A measurement of the production cross-section of a single top quark in association with a W boson, the second largest single-top production mode, is also presented. Finally, measurements of ...
Career development in cross-cultural environment
Balčiūnaitienė, Asta; Barvydienė, Violeta; Petkevičiūtė, Nijolė
2013-01-01
The aim of this paper is to discuss the peculiarities of career development and cultural competence in crosscultural environment. The idea of career development in a cross-cultural environment is usually linked to personal, communication skills, social and cultural issues. Understanding of the concept of peculiarities of career development and cross-cultural communication competence is of crucial significance in a multicultural environment. The main factors of career development in cross-cult...
Cross-correlations and influence in world gold markets
Lin, Min; Wang, Gang-Jin; Xie, Chi; Stanley, H. Eugene
2018-01-01
Using the detrended cross-correlation analysis (DCCA) coefficient and the detrended partial cross-correlation analysis (DPCCA) coefficient, we investigate cross-correlations and net cross-correlations among five major world gold markets (London, New York, Shanghai, Tokyo, and Mumbai) at different time scales. We propose multiscale influence measures for examining the influence of individual markets on other markets and on the entire system. We find (i) that the cross-correlations, net cross-correlations, and net influences among the five gold markets vary across time scales, (ii) that the cross-market correlation between London and New York at each time scale is intense and inherent, meaning that the influence of other gold markets on the London-New York market is negligible, (iii) that the remaining cross-market correlations (i.e., those other than London-New York) are greatly affected by other gold markets, and (iv) that the London gold market significantly affects the other four gold markets and dominates the world-wide gold market. Our multiscale findings give market participants and market regulators new information on cross-market linkages in the world-wide gold market.
Collective states and crossing symmetry
International Nuclear Information System (INIS)
Heiss, W.D.
1977-01-01
Collective states are usually described in simple terms but with the use of effective interactions which are supposed to contain more or less complicated contributions. The significance of crossing symmetry is discussed in this connection. Formal problems encountered in the attempts to implement crossing symmetry are pointed out
Interaction in Balanced Cross Nested Designs
Ramos, Paulo; Mexia, João T.; Carvalho, Francisco; Covas, Ricardo
2011-09-01
Commutative Jordan Algebras, CJA, are used in the study of mixed models obtained, through crossing and nesting, from simpler ones. In the study of cross nested models the interaction between nested factors have been systematically discarded. However this can constitutes an artificial simplification of the models. We point out that, when two crossed factors interact, such interaction is symmetric, both factors playing in it equivalent roles, while when two nested factors interact, the interaction is determined by the nesting factor. These interactions will be called interactions with nesting. In this work we present a coherent formulation of the algebraic structure of models enabling the choice of families of interactions between cross and nested factors using binary operations on CJA.
Photoionization cross section of atomic and molecular oxygen
International Nuclear Information System (INIS)
Pareek, P.N.
1983-01-01
Photoionization cross sections of atomic oxygen and dissociative photoionization cross sections of molecular oxygen were measured from their respective thresholds to 120 angstrom by use of a photoionization mass spectrometer in conjunction with a spark light source. The photoionization cross sections O 2 + parent ion and O + fragment ion from neutral O 2 were obtained by a technique that eliminated the serious problem of identifying the true abundances of O + ions. These ions are generally formed with considerable kinetic energy and, because most mass spectrometers discriminate against energetic ions, true O + abundances are difficult to obtain. In the present work the relative cross sections for producing O + ions are obtained and normalized against the total cross sections in a spectral region where dissociative ionization is not possible. The fragmentation cross sections for O + were then obtained by subtraction of O 2 + cross sections from the known total photoionization cross sections. The results are compared with the previously published measurements. The absolute photoionization cross section of atomic oxygen sigma 8 /sub +/ was measured at 304 A. The actual number density of oxygen atoms within the ionization region was obtained by measuring the fraction of 0 2 molecules dissociated. This sigma/sub +/ at 304 angstrom was used to convert the relative photoinization cross sections, measured as a function of wavelength using a calibrated photodiode, to absolute cross sections. The results are compared with previous measurements and calculated cross sections. angstrom Rydberg series converging to the OII 4 P state was observed
Children's cross-ethnic friendships: Antecedents and consequences
Jugert, P.; Feddes, A.R.; Rutland, A.; Nesdale, D.; Brown, C.S.
2017-01-01
This chapter reviews recent research on the antecedents of cross-ethnic friendships, on friendship stability and quality, as well as on their consequences. It discusses structural, intergroup, and family factors and its relationship to cross-ethnic friendships. Research shows that cross-ethnic
CrossRef text and data mining services
Directory of Open Access Journals (Sweden)
Rachael Lammey
2015-02-01
Full Text Available CrossRef is an association of scholarly publishers that develops shared infrastructure to support more effective scholarly communications. It is a registration agency for the digital object identifier (DOI, and has built additional services for CrossRef members around the DOI and the bibliographic metadata that publishers deposit in order to register DOIs for their publications. Among these services are CrossCheck, powered by iThenticate, which helps publishers screen for plagiarism in submitted manuscripts and FundRef, which gives publishers standard way to report funding sources for published scholarly research. To add to these services, Cross-Ref launched CrossRef text and data mining services in May 2014. This article will explain the thinking behind CrossRef launching this new service, what it offers to publishers and researchers alike, how publishers can participate in it, and the uptake of the service so far.
The SWAT approach for pipeline watercourse crossings
Energy Technology Data Exchange (ETDEWEB)
Jasper, Steve [WorleyParsons Calgary, Pipeline Systems Business Unit, Calgary, AB (Canada)], email: steve.jasper@worleyparsons.com; Harris, Jason D. [Triton Environmental Consultants Ltd., Terrace, British Columbia (Canada)], email: jharris@triton-env.com; Doering, Raymond [Enbridge Northern Gateway Pipelines, Calgary, AB (Canada)], email: raymond.doering@enbridge.com
2010-07-01
In a pipeline project, watercourse crossings are an important environmental and technical challenge. In identifying the best crossing location and method, many factors must be taken into account such as fish habitat, access, geotechnical and hydrological issues. The aim of this paper is to present a program used in a major pipeline project to assess crossings of sensitive watercourses. This program was implemented in the Enbridge Northern Gateway project which extends from Bruderheim, Alberta, to Kitimat, British Columbia, crossing over 750 watercourses. A sensitive watercourse assessment (SWAT) team composed of a fisheries biologist, a pipeline watercourse construction specialist and other personnel carried out assessments on the 200 sensitive watercourses identified. This program led to recommendations to shift the crossing location at 40% of the sensitive sites. This project showed that setting up a SWAT team be helpful in choosing the best location, method and construction timing for a crossing.
Cross-site scripting attacks procedure and Prevention Strategies
Directory of Open Access Journals (Sweden)
Wang Xijun
2016-01-01
Full Text Available Cross-site scripting attacks and defense has been the site of attack and defense is an important issue, this paper, the definition of cross-site scripting attacks, according to the current understanding of the chaos on the cross-site scripting, analyzes the causes and harm cross-site scripting attacks formation of attacks XXS complete process XSS attacks made a comprehensive analysis, and then for the web program includes Mobility there are cross-site scripting filter laxity given from ordinary users browse the web and web application developers two the defense cross-site scripting attacks effective strategy.
Dyslexia from a Cross-Linguistic and Cross-Cultural Perspective: The Case of Russian and Russia
Kornev, Aleksandr N.; Rakhlin, Natalia; Grigorenko, Elena L.
2010-01-01
An important goal of research on specific learning disorders (such as dyslexia, or specific reading disability, or dysgraphia, or specific writing disorder) is to elucidate the universal characteristics and cross-linguistic and cross-cultural differences of literacy acquisition and disability. However, despite the acknowledged necessity of…
Multiscale Detrended Cross-Correlation Analysis of STOCK Markets
Yin, Yi; Shang, Pengjian
2014-06-01
In this paper, we employ the detrended cross-correlation analysis (DCCA) to investigate the cross-correlations between different stock markets. We report the results of cross-correlated behaviors in US, Chinese and European stock markets in period 1997-2012 by using DCCA method. The DCCA shows the cross-correlated behaviors of intra-regional and inter-regional stock markets in the short and long term which display the similarities and differences of cross-correlated behaviors simply and roughly and the persistence of cross-correlated behaviors of fluctuations. Then, because of the limitation and inapplicability of DCCA method, we propose multiscale detrended cross-correlation analysis (MSDCCA) method to avoid "a priori" selecting the ranges of scales over which two coefficients of the classical DCCA method are identified, and employ MSDCCA to reanalyze these cross-correlations to exhibit some important details such as the existence and position of minimum, maximum and bimodal distribution which are lost if the scale structure is described by two coefficients only and essential differences and similarities in the scale structures of cross-correlation of intra-regional and inter-regional markets. More statistical characteristics of cross-correlation obtained by MSDCCA method help us to understand how two different stock markets influence each other and to analyze the influence from thus two inter-regional markets on the cross-correlation in detail, thus we get a richer and more detailed knowledge of the complex evolutions of dynamics of the cross-correlations between stock markets. The application of MSDCCA is important to promote our understanding of the internal mechanisms and structures of financial markets and helps to forecast the stock indices based on our current results demonstrated the cross-correlations between stock indices. We also discuss the MSDCCA methods of secant rolling window with different sizes and, lastly, provide some relevant implications and
Vehicle routing with cross-docking
DEFF Research Database (Denmark)
Wen, Min; Larsen, Jesper; Clausen, Jens
2009-01-01
a set of homogeneous vehicles are used to transport orders from the suppliers to the corresponding customers via a cross-dock. The orders can be consolidated at the cross-dock but cannot be stored for very long because the cross-dock does not have long-term inventory-holding capabilities. The objective...... of the VRPCD is to minimize the total travel time while respecting time window constraints at the nodes and a time horizon for the whole transportation operation. In this paper, a mixed integer programming formulation for the VRPCD is proposed. A tabu search heuristic is embedded within an adaptive memory...... values) within very short computational time....
Investigation Of Cross-Flow Model Water Turbine
International Nuclear Information System (INIS)
Obretenov, V.S.
1998-01-01
The research is made with the basic objective of constructing effective stream section of cross-flow turbine. In the research project are presented the results from experimental testing of the cross-flow turbine with various runner. nozzles and draft tubes. The rotational and universal characteristics of the turbine are presented. The experimental results have been analyzed.The results from the research give the possibility to make clear some important aspects of the working process with the cross-flow turbines. The characteristics derived from these tests prove that the stream section of the tested cross-flow turbine can be used as a model in the construction of cross-flow turbines for power electric stations with small capacity
Cross-Cultural Research and Qualitative Inquiry
Liamputtong, Pranee
2010-01-01
Cross-cultural research has become important in this postmodern world where many people have been made, and are still, marginalised and vulnerable by others in more powerful positions like colonial researchers. In this paper, I contend that qualitative research is particularly appropriate for cross-cultural research because it allows us to find answers which are more relevant to the research participants. Cross-cultural qualitative research must be situated within some theoretical frameworks....
Competitive implications of cross-border banking
Claessens, Stijn
2006-01-01
This paper reviews the recent literature on cross-border banking, with a focus on policy implications. Cross-border banking has increased sharply in recent decades, particularly in the form of entry, and has affected the development of financial systems, access to financial services, and stability. Reviewing the empirical literature, the author finds much, although not uniform, evidence that cross-border banking supports the development of an efficient and stable financial system that offers ...
Cross-Sectional Analysis of Longitudinal Mediation Processes.
O'Laughlin, Kristine D; Martin, Monica J; Ferrer, Emilio
2018-01-01
Statistical mediation analysis can help to identify and explain the mechanisms behind psychological processes. Examining a set of variables for mediation effects is a ubiquitous process in the social sciences literature; however, despite evidence suggesting that cross-sectional data can misrepresent the mediation of longitudinal processes, cross-sectional analyses continue to be used in this manner. Alternative longitudinal mediation models, including those rooted in a structural equation modeling framework (cross-lagged panel, latent growth curve, and latent difference score models) are currently available and may provide a better representation of mediation processes for longitudinal data. The purpose of this paper is twofold: first, we provide a comparison of cross-sectional and longitudinal mediation models; second, we advocate using models to evaluate mediation effects that capture the temporal sequence of the process under study. Two separate empirical examples are presented to illustrate differences in the conclusions drawn from cross-sectional and longitudinal mediation analyses. Findings from these examples yielded substantial differences in interpretations between the cross-sectional and longitudinal mediation models considered here. Based on these observations, researchers should use caution when attempting to use cross-sectional data in place of longitudinal data for mediation analyses.
Luethge, Denise J.; Raska, David; Greer, Bertie M.; O'Connor, Christina
2016-01-01
Today's business school academics are tasked with pedagogy that offers students an understanding of the globalization of markets and the cross-cultural communication skills needed in today's business environment. The authors describe how a virtual cross-cultural experience was integrated into an undergraduate business course and used as an…
International Nuclear Information System (INIS)
Soran, P.D.; Seamon, R.E.
1980-05-01
Graphs of all neutron cross sections and photon production cross sections on the Recommended Monte Carlo Cross Section (RMCCS) library have been plotted along with local neutron heating numbers. Values for anti ν, the average number of neutrons per fission, are also given
Atlas of photoneutron cross sections obtained with monoenergetic photons
International Nuclear Information System (INIS)
Dietrich, S.S.; Berman, B.L.
1988-01-01
Photoneutron cross-section and integrated cross-section data obtained with monoenergetic photons are presented in a uniform format. All of the measured partial photoneutron cross sections, the total photoneutron cross section, and the photoneutron yield cross section are plotted as functions of the incident photon energy, as are the integrated photoneutron cross sections and their first and second moments. The values of the integrated cross sections and the moments of the integrated total cross section up to the highest photon energy for which they were measured are tabulated, as are the parameters of Lorentz curves fitted to the total photoneutron cross-section data for medium and heavy nuclei (A>50). This compilation is current as of June 1987. copyright 1988 Academic Press, Inc
ON DEPARTURES FROM INDEPENDENCE IN CROSS-CLASSIFICATIONS.
CASE, C. MARSTON
THIS NOTE IS CONCERNED WITH IDEAS AND PROBLEMS INVOLVED IN CROSS-CLASSIFICATION OF OBSERVATIONS ON A GIVEN POPULATION, ESPECIALLY TWO-DIMENSIONAL CROSS-CLASSIFICATIONS. MAIN OBJECTIVES OF THE NOTE INCLUDE--(1) ESTABLISHMENT OF A CONCEPTUAL FRAMEWORK FOR CHARACTERIZATION AND COMPARISON OF CROSS-CLASSIFICATIONS, (2) DISCUSSION OF EXISTING METHODS…
Teacher self-efficacy in cross-cultural perspective
Vieluf, S.; Kuenther, M.; van de Vijver, F.J.R.
2013-01-01
In the present study, teacher self-efficacy was examined in a cross-national setting. The cross-national generalizability of the scale and the meaning of cross-national variation in mean scores were investigated. Using data from TALIS involving 73,100 teachers in 23 countries, teacher self-efficacy
Oczeretko, Edward; Swiatecka, Jolanta; Kitlas, Agnieszka; Laudanski, Tadeusz; Pierzynski, Piotr
2006-01-01
In physiological research, we often study multivariate data sets, containing two or more simultaneously recorded time series. The aim of this paper is to present the cross-correlation and the wavelet cross-correlation methods to assess synchronization between contractions in different topographic regions of the uterus. From a medical point of view, it is important to identify time delays between contractions, which may be of potential diagnostic significance in various pathologies. The cross-correlation was computed in a moving window with a width corresponding to approximately two or three contractions. As a result, the running cross-correlation function was obtained. The propagation% parameter assessed from this function allows quantitative description of synchronization in bivariate time series. In general, the uterine contraction signals are very complicated. Wavelet transforms provide insight into the structure of the time series at various frequencies (scales). To show the changes of the propagation% parameter along scales, a wavelet running cross-correlation was used. At first, the continuous wavelet transforms as the uterine contraction signals were received and afterwards, a running cross-correlation analysis was conducted for each pair of transformed time series. The findings show that running functions are very useful in the analysis of uterine contractions.
Linear Unlearning for Cross-Validation
DEFF Research Database (Denmark)
Hansen, Lars Kai; Larsen, Jan
1996-01-01
The leave-one-out cross-validation scheme for generalization assessment of neural network models is computationally expensive due to replicated training sessions. In this paper we suggest linear unlearning of examples as an approach to approximative cross-validation. Further, we discuss...... time series prediction benchmark demonstrate the potential of the linear unlearning technique...
Scattering cross section for various potential systems
Directory of Open Access Journals (Sweden)
Myagmarjav Odsuren
2017-08-01
Full Text Available We discuss the problems of scattering in this framework, and show that the applied method is very useful in the investigation of the effect of the resonance in the observed scattering cross sections. In this study, not only the scattering cross sections but also the decomposition of the scattering cross sections was computed for the α–α system. To obtain the decomposition of scattering cross sections into resonance and residual continuum terms, the complex scaled orthogonality condition model and the extended completeness relation are used. Applying the present method to the α–α and α–n systems, we obtained good reproduction of the observed phase shifts and cross sections. The decomposition into resonance and continuum terms makes clear that resonance contributions are dominant but continuum terms and their interference are not negligible. To understand the behavior of observed phase shifts and the shape of the cross sections, both resonance and continuum terms are calculated.
Scattering cross section for various potential systems
Energy Technology Data Exchange (ETDEWEB)
Odsuren, Myagmarjav; Khuukhenkhuu, Gonchigdorj; Davaa, Suren [Nuclear Research Center, School of Engineering and Applied Sciences, National University of Mongolia, Ulaanbaatar (Mongolia); Kato, Kiyoshi [Nuclear Reaction Data Centre, Faculty of Science, Hokkaido University, Sapporo (Japan)
2017-08-15
We discuss the problems of scattering in this framework, and show that the applied method is very useful in the investigation of the effect of the resonance in the observed scattering cross sections. In this study, not only the scattering cross sections but also the decomposition of the scattering cross sections was computed for the α–α system. To obtain the decomposition of scattering cross sections into resonance and residual continuum terms, the complex scaled orthogonality condition model and the extended completeness relation are used. Applying the present method to the α–α and α–n systems, we obtained good reproduction of the observed phase shifts and cross sections. The decomposition into resonance and continuum terms makes clear that resonance contributions are dominant but continuum terms and their interference are not negligible. To understand the behavior of observed phase shifts and the shape of the cross sections, both resonance and continuum terms are calculated.
International Nuclear Information System (INIS)
Khakoo, M. A.; Wrkich, J.; Larsen, M.; Kleiban, G.; Kanik, I.; Trajmar, S.; Brunger, M.J.; Teubner, P.J.O.; Crowe, A.; Fontes, C.J.; Clark, R.E.H.; Zeman, V.; Bartschat, K.; Madison, D.H.; Srivastava, R.; Stauffer, A.D.
2002-01-01
Electron-impact differential cross-section measurements for the excitation of the 2p 5 3s configuration of Ne are reported. The Ne cross sections are obtained using experimental differential cross sections for the electron-impact excitation of the n=2 levels of atomic hydrogen [Khakoo et al., Phys. Rev. A 61, 012701-1 (1999)], and existing experimental helium differential cross-section measurements, as calibration standards. These calibration measurements were made using the method of gas mixtures (Ne and H followed by Ne and He), in which the gas beam profiles of the mixed gases are found to be the same within our experimental errors. We also present results from calculations of these differential cross sections using the R-matrix and unitarized first-order many-body theory, the distorted-wave Born approximation, and relativistic distorted-wave methods. Comparison with available experimental differential cross sections and differential cross-section ratios is also presented
Energy Technology Data Exchange (ETDEWEB)
Sanami, Toshiya; Baba, Mamoru; Saito, Keiichiro; Ibara, Yasutaka; Hirakawa, Naohiro [Tohoku Univ., Sendai (Japan). Faculty of Engineering
1997-03-01
We are developing a method of (n,{alpha}) cross section measurement using gaseous samples in a gridded ionization chamber (GIC). This method enables cross section measurements in large solid angle without the distortion by the energy loss in a sample, but requires a method to estimate the detection efficiency. We solve this problem by using GIC signals and a tight neutron collimation. The validity of this method was confirmed through the {sup 12}C(n,{alpha}{sub 0}){sup 9}Be measurement. We applied this method to the {sup 16}O(n,{alpha}){sup 13}C cross section around 14.1 MeV. (author)
Cross-sectional anatomy for computed tomography
International Nuclear Information System (INIS)
Farkas, M.L.
1988-01-01
This self-study guide recognizes that evaluation and interpretation of CT-images demands a firm understanding of both cross-sectional anatomy and the principles of computed tomography. The objectives of this book are: to discuss the basic principles of CT, to stress the importance of cross-sectional anatomy to CT through study of selected cardinal transverse sections of head, neck, and trunk, to explain orientation and interpretation of CT-images with the aid of corresponding cross-sectional preparations
Measurements of neutron capture cross sections
International Nuclear Information System (INIS)
Nakajima, Yutaka
1984-01-01
A review of measurement techniques for the neutron capture cross sections is presented. Sell transmission method, activation method, and prompt gamma-ray detection method are described using examples of capture cross section measurements. The capture cross section of 238 U measured by three different prompt gamma-ray detection methods (large liquid scintillator, Moxon-Rae detector, and pulse height weighting method) are compared and their discrepancies are resolved. A method how to derive the covariance is described. (author)
International Nuclear Information System (INIS)
Choi, Ji-Ae; Kang, Yongku; Kim, Dong-Won
2013-01-01
Highlights: ► Ionic liquid-based cross-linked gel polymer electrolytes were synthesized and their electrochemical properties were investigated. ► Lithium polymer cells with in situ cross-linked gel polymer electrolytes exhibited reversible cycling behavior with good capacity retention. ► The use of ionic liquid-based cross-linked gel polymer electrolytes significantly improved the thermal stability of the cells. -- Abstract: Ionic liquid-based cross-linked gel polymer electrolytes were prepared with a phosphazene-based cross-linking agent, and their electrochemical properties were investigated. Lithium polymer cells composed of lithium anode and LiCoO 2 cathode were assembled with ionic liquid-based cross-linked gel polymer electrolyte and their cycling performance was evaluated. The interfacial adhesion between the electrodes and the electrolyte by in situ chemical cross-linking resulted in stable capacity retention of the cell. A reduction in the ionic mobility in both the electrolyte and the electrode adversely affected discharge capacity and high rate performance of the cell. DSC studies demonstrated that the use of ionic liquid-based cross-linked gel polymer electrolytes provided a significant improvement in the thermal stability of the cell
38 CFR 18b.58 - Cross-examination.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Cross-examination. 18b.58... Procedures § 18b.58 Cross-examination. A witness may be cross-examined on any matter material to the proceeding without regard to the scope of his direct examination. ...
Discourse Issues in Cross-Cultural Pragmatics.
Boxer, Diana
2002-01-01
Focuses on recent research in cross-cultural pragmatics as distinct from interlanguage pragmatics. The essential difference between the two lies in the perspective from which each views cross-cultural communication. (Author/VWL)
International Nuclear Information System (INIS)
Seamon, R.E.; Soran, P.D.
1980-06-01
Graphs of all neutron cross sections and photon production cross sections on the Alternate Monte Carlo Cross Section (AMCCS) library have been plotted along with local neutron heating numbers. The values of ν-bar, the average number of neutrons per fission, are also plotted for appropriate isotopes
[Ella-cross, a Scanian amulet].
Björnberg, Alf; Tegner, Eva
2006-01-01
An Ella-cross is an amulet of a special type dated back to the period of the late 1700s to the early 1800s, stemming from the Scania region in Sweden, the southernmost part of the country. It has not before been studied systematically. The investigation reported here concerned 125 crosses of this type, most of them from various institutions in Scania. The amulets are for the most part quite similar in appearance, consisting of a thin round silver plate 2 - 4 centimeters in diameter on which a cross with four arms of equal length, usually of the anchor type, is engraved, together with a Jesus monogram (IHS and I.N.R.I.) and a plea for "help", lettered in the spelling of the time. An Ella-cross was worn under one's clothing in direct contact with the skin throughout one's life, following its wearer into the grave. It was to protect one from Ellen's diseases (caused by the Neck, an evil water spirit) and also from misfortune and evil.
Two-dimensional multifractal cross-correlation analysis
International Nuclear Information System (INIS)
Xi, Caiping; Zhang, Shuning; Xiong, Gang; Zhao, Huichang; Yang, Yonghong
2017-01-01
Highlights: • We study the mathematical models of 2D-MFXPF, 2D-MFXDFA and 2D-MFXDMA. • Present the definition of the two-dimensional N 2 -partitioned multiplicative cascading process. • Do the comparative analysis of 2D-MC by 2D-MFXPF, 2D-MFXDFA and 2D-MFXDMA. • Provide a reference on the choice and parameter settings of these methods in practice. - Abstract: There are a number of situations in which several signals are simultaneously recorded in complex systems, which exhibit long-term power-law cross-correlations. This paper presents two-dimensional multifractal cross-correlation analysis based on the partition function (2D-MFXPF), two-dimensional multifractal cross-correlation analysis based on the detrended fluctuation analysis (2D-MFXDFA) and two-dimensional multifractal cross-correlation analysis based on the detrended moving average analysis (2D-MFXDMA). We apply these methods to pairs of two-dimensional multiplicative cascades (2D-MC) to do a comparative study. Then, we apply the two-dimensional multifractal cross-correlation analysis based on the detrended fluctuation analysis (2D-MFXDFA) to real images and unveil intriguing multifractality in the cross correlations of the material structures. At last, we give the main conclusions and provide a valuable reference on how to choose the multifractal algorithms in the potential applications in the field of SAR image classification and detection.
Transvestism: a survey of 1032 cross-dressers.
Docter, R F; Prince, V
1997-12-01
One thousand and thirty-two male periodic cross-dressers (transvestites) responded to an anonymous survey patterned after Prince and Bentler's (1972) report. With few exceptions, the findings are closely related to the 1972 survey results. Eighty-seven percent described themselves as heterosexual. All except 17% had married and 60% were married at the time of this survey. Topics surveyed included demographic, childhood, and family variables, sexual orientation and sexual behavior, cross-gender identity, cross-gender role behavior, future plans to live entirely as a woman, and utilization of counseling or mental health services. Of the present sample, 45% reported seeking counseling compared to 24% of the 1972 survey, and those reporting strong transsexual inclinations were up by 5%. Today's transvestites strongly prefer both their masculine and feminine selves equally. A second research objective was to identify variables discriminating between so-called Nuclear (stable, periodic cross-dressers) and Marginal transvestites (more transgendered or transsexually inclined); 10 strongly discriminating parameters were found. The most important are (i) cross-gender identity, (ii) commitment to live entirely as a woman, (iii) taking steps toward body feminization, (iv) low sexual arousal to cross-dressing. Neither age nor experience as a cross-dresser were found to be correlates of cross-gender identity. Although the present generation of transvestites describe themselves much as did similar subjects 20 years ago, the percentage migrating toward full-time living as a woman is greater.
Parametric equations for calculation of macroscopic cross sections
International Nuclear Information System (INIS)
Botelho, Mario Hugo; Carvalho, Fernando
2015-01-01
Neutronic calculations of the core of a nuclear reactor is one thing necessary and important for the design and management of a nuclear reactor in order to prevent accidents and control the reactor efficiently as possible. To perform these calculations a library of nuclear data, including cross sections is required. Currently, to obtain a cross section computer codes are used, which require a large amount of processing time and computer memory. This paper proposes the calculation of macroscopic cross section through the development of parametric equations. The paper illustrates the proposal for the case of macroscopic cross sections of absorption (Σa), which was chosen due to its greater complexity among other cross sections. Parametric equations created enable, quick and dynamic way, the determination of absorption cross sections, enabling the use of them in calculations of reactors. The results show efficient when compared with the absorption cross sections obtained by the ALPHA 8.8.1 code. The differences between the cross sections are less than 2% for group 2 and less than 0.60% for group 1. (author)
Neutron-capture Cross Sections from Indirect Measurements
Energy Technology Data Exchange (ETDEWEB)
Escher, J E; Burke, J T; Dietrich, F S; Ressler, J J; Scielzo, N D; Thompson, I J
2011-10-18
Cross sections for compound-nuclear reactions play an important role in models of astrophysical environments and simulations of the nuclear fuel cycle. Providing reliable cross section data remains a formidable task, and direct measurements have to be complemented by theoretical predictions and indirect methods. The surrogate nuclear reactions method provides an indirect approach for determining cross sections for reactions on unstable isotopes, which are difficult or impossible to measure otherwise. Current implementations of the method provide useful cross sections for (n,f) reactions, but need to be improved upon for applications to capture reactions.
NNLO jet cross sections by subtraction
International Nuclear Information System (INIS)
Somogyi, G.; Bolzoni, P.; Trocsanyi, Z.
2010-06-01
We report on the computation of a class of integrals that appear when integrating the so-called iterated singly-unresolved approximate cross section of an earlier NNLO subtraction scheme over the factorised phase space of unresolved partons. The integrated approximate cross section itself can be written as the product of an insertion operator (in colour space) times the Born cross section. We give selected results for the insertion operator for processes with two and three hard partons in the final state. (orig.)
NNLO jet cross sections by subtraction
Energy Technology Data Exchange (ETDEWEB)
Somogyi, G.; Bolzoni, P. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany); Trocsanyi, Z. [CERN, Geneva (Switzerland)
2010-06-15
We report on the computation of a class of integrals that appear when integrating the so-called iterated singly-unresolved approximate cross section of an earlier NNLO subtraction scheme over the factorised phase space of unresolved partons. The integrated approximate cross section itself can be written as the product of an insertion operator (in colour space) times the Born cross section. We give selected results for the insertion operator for processes with two and three hard partons in the final state. (orig.)
NNLO jet cross sections by subtraction
Somogyi, Gabor; Trocsanyi, Zoltan
2010-01-01
We report on the computation of a class of integrals that appear when integrating the so-called iterated singly-unresolved approximate cross section of the NNLO subtraction scheme of [1-4], over the factorised phase space of unresolved partons. The integrated approximate cross section itself can be written as the product of an insertion operator (in colour space) times the Born cross section. We give selected results for the insertion operator for processes with two and three hard partons in the final state.
XCOM: Photon Cross Sections Database
SRD 8 XCOM: Photon Cross Sections Database (Web, free access) A web database is provided which can be used to calculate photon cross sections for scattering, photoelectric absorption and pair production, as well as total attenuation coefficients, for any element, compound or mixture (Z <= 100) at energies from 1 keV to 100 GeV.
Capture cross sections on unstable nuclei
Tonchev, A. P.; Escher, J. E.; Scielzo, N.; Bedrossian, P.; Ilieva, R. S.; Humby, P.; Cooper, N.; Goddard, P. M.; Werner, V.; Tornow, W.; Rusev, G.; Kelley, J. H.; Pietralla, N.; Scheck, M.; Savran, D.; Löher, B.; Yates, S. W.; Crider, B. P.; Peters, E. E.; Tsoneva, N.; Goriely, S.
2017-09-01
Accurate neutron-capture cross sections on unstable nuclei near the line of beta stability are crucial for understanding the s-process nucleosynthesis. However, neutron-capture cross sections for short-lived radionuclides are difficult to measure due to the fact that the measurements require both highly radioactive samples and intense neutron sources. Essential ingredients for describing the γ decays following neutron capture are the γ-ray strength function and level densities. We will compare different indirect approaches for obtaining the most relevant observables that can constrain Hauser-Feshbach statistical-model calculations of capture cross sections. Specifically, we will consider photon scattering using monoenergetic and 100% linearly polarized photon beams. Challenges that exist on the path to obtaining neutron-capture cross sections for reactions on isotopes near and far from stability will be discussed.
Measuring cross-border regional STI integration
Energy Technology Data Exchange (ETDEWEB)
Makkonen, T
2016-07-01
Earlier quantitative studies on cross-border regional integration processes have commonly neglected science, technology and innovation (STI) indicators: even the most notable example of a composite indicator approach to measuring cross-border regional integration, i.e. the Oresund index, lacks a sub-category for STI. Consequently, by ignoring cross-border innovation and knowledge flows, the Oresund integration index fails to take into account one of the most important drivers of economic growth in cross-border regions. Therefore, a new composite STI indicator (sub-category) was introduced to strengthen the Oresund integration index. This was compiled from patent, publication and collaborative R&D project data. The findings show that this index performs reasonably well in depicting STI integration, while at the same time remaining simple and straightforward enough to be adopted in other crossborder regions. (Author)
Status of neutron dosimetry cross sections
International Nuclear Information System (INIS)
Griffin, P.J.; Kelly, J.G.
1992-01-01
Several new cross section libraries, such as ENDF/B-VI(release 2), IRDF-90,JEF-2.2, and JENDL-3 Dosimetry, have recently been made available to the dosimetry community. the Sandia National Laboratories (SNL) Radiation Metrology Laboratory (RML) has worked with these libraries since pre-release versions were available. this paper summarizes the results of the intercomparison and testing of dosimetry cross sections. As a result of this analysis, a compendium of the best dosimetry cross sections was assembled from the available libraries for use within the SNL RML. this library, referred to as the SNLRML Library, contains 66 general dosimetry sensors and 3 special dosimeters unique to the RML sensor inventory. The SNLRML cross sections have been put into a format compatible with commonly used spectrum determination codes
Capture cross sections on unstable nuclei
Directory of Open Access Journals (Sweden)
Tonchev A.P.
2017-01-01
Full Text Available Accurate neutron-capture cross sections on unstable nuclei near the line of beta stability are crucial for understanding the s-process nucleosynthesis. However, neutron-capture cross sections for short-lived radionuclides are difficult to measure due to the fact that the measurements require both highly radioactive samples and intense neutron sources. Essential ingredients for describing the γ decays following neutron capture are the γ-ray strength function and level densities. We will compare different indirect approaches for obtaining the most relevant observables that can constrain Hauser-Feshbach statistical-model calculations of capture cross sections. Specifically, we will consider photon scattering using monoenergetic and 100% linearly polarized photon beams. Challenges that exist on the path to obtaining neutron-capture cross sections for reactions on isotopes near and far from stability will be discussed.
Navigation in Cross-cultural business relationships
DEFF Research Database (Denmark)
Andersen, Poul Houman
2001-01-01
Cross-cultural business navigation concerns the process of handling the complexity of several interacting cultural spheres of influence......Cross-cultural business navigation concerns the process of handling the complexity of several interacting cultural spheres of influence...
Detrended cross-correlation analysis of electroencephalogram
International Nuclear Information System (INIS)
Wang Jun; Zhao Da-Qing
2012-01-01
In the paper we use detrended cross-correlation analysis (DCCA) to study the electroencephalograms of healthy young subjects and healthy old subjects. It is found that the cross-correlation between different leads of a healthy young subject is larger than that of a healthy old subject. It was shown that the cross-correlation relationship decreases with the aging process and the phenomenon can help to diagnose whether the subject's brain function is healthy or not. (interdisciplinary physics and related areas of science and technology)
Study of Drivers’ Behaviour at a Passive Railway Crossing
Directory of Open Access Journals (Sweden)
Sandra Kasalica
2012-05-01
Full Text Available Problem: The number of killed and injured persons in incidents at railway level crossings is generally increasing on the Serbian Railways, particularly at passive crossings. In this paper we researched the direct behaviour of road traffic participants at a conventional railway passive crossing. Method: Direct observational study of drivers’ behaviour at a level crossing. Results: Sixty-one road vehicle drivers were observed in the moments of train approach. The probability of crossing varies depending on the train distance and the time the driver has to cross the crossing. The drivers who have limited visibility cannot estimate the speed of the approaching train well and make more risky decisions. Conclusion: This study shows that the number of “risky crossings” is worrying as the result of such crossings is a large number of accidents with fatal consequences at the passive crossings in Serbia.
The basics of CrossRef extensible markup language
Directory of Open Access Journals (Sweden)
Rachael Lammey
2014-08-01
Full Text Available CrossRef is an association of scholarly publishers that develops shared infrastructure to support more effective scholarly communications. Launched in 2000, CrossRef’s citation-linking network today covers over 68 million journal articles and other content items (books chapters, data, theses, and technical reports from thousands of scholarly and professional publishers around the globe. CrossRef has over 4,000 member publishers who join as members in order to avail of a number of CrossRef services, reference linking via the Digital Object Identifier (DOI being the core service. To deposit CrossRef DOIs, publishers and editors need to become familiar with the basics of extensible markup language (XML. This article will give an introduction to CrossRef XML and what publishers need to do in order to start to deposit DOIs with CrossRef and thus ensure their publications are discoverable and can be linked to consistently in an online environment.
International Nuclear Information System (INIS)
Hasegawa, Akira
1991-01-01
A common group cross-section library has been developed in JAERI. This system is called 'JSSTDL-295n-104γ (neutron:295 gamma:104) group constants library system', which is composed of a common 295n-104γ group cross-section library based on JENDL-3 nuclear data file and its utility codes. This system is applicable to fast and fusion reactors. In this paper, firstly outline of group cross-section processing adopted in Prof. GROUCH-G/B system is described in detail which is a common step for all group cross-section library generation. Next available group cross-section libraries developed in Japan based on JENDL-3 are briefly reviewed. Lastly newly developed JSSTDL library system is presented with some special attention to the JENDL-3 data. (author)
International Nuclear Information System (INIS)
Simard, T.
1999-01-01
Energy risk management is the principal topic of this paper. Four major subjects are examined: cross-commodity trading objectives (reduce the risk of an underlying exposure in another commodity); portfolio risk reduction (an Alberta power distributor exposed to high pool prices could protect against high pool prices through a fixed price purchase of Alberta natural gas); tailoring pricing to customer needs (sell power to the gas producer indexed to the price of gas); and (4) reducing insurance costs (rather than purchasing downside protection (puts) individually against oil and gas prices, a producer could purchase a basket option). Since the key issue in cross-commodity transactions is the estimation of correlation, it is important to be prepared to alter correlation assumptions. 1 tab., 2 figs
Neutron-capture cross sections from indirect measurements
Directory of Open Access Journals (Sweden)
Scielzo N.D.
2012-02-01
Full Text Available Cross sections for compound-nuclear reactions reactions play an important role in models of astrophysical environments and simulations of the nuclear fuel cycle. Providing reliable cross section data remains a formidable task, and direct measurements have to be complemented by theoretical predictions and indirect methods. The surrogate nuclear reactions method provides an indirect approach for determining cross sections for reactions on unstable isotopes, which are difficult or impossible to measure otherwise. Current implementations of the method provide useful cross sections for (n,f reactions, but need to be improved upon for applications to capture reactions.
Curves and tables of neutron cross sections
International Nuclear Information System (INIS)
Nakagawa, Tsuneo; Asami, Tetsuo; Yoshida, Tadashi
1990-07-01
Neutron cross-section curves from the Japanese Evaluated Nuclear Data Library version 3, JENDL-3, are presented in both graphical and tabular form for users in a wide range of application areas in the nuclear energy field. The contents cover cross sections for all the main reactions induced by neutrons with an energy below 20 MeV including; total, elastic scattering, capture, and fission, (n,n'), (n,2n), (n,3n), (n,α), (n,p) reactions. The 2200 m/s cross-section values, resonance integrals, and Maxwellian- and fission-spectrum averaged cross sections are also tabulated. (author)
Chemical cross-linking of Chlamydia trachomatis
DEFF Research Database (Denmark)
Birkelund, Svend; Lundemose, AG; Christiansen, Gunna
1988-01-01
Purified elementary bodies (EBs) of Chlamydia trachomatis serovar L2 were analyzed by chemical cross-linking with disuccinimidyl selenodipropionate. The effect of the cross-linking was analyzed by immunoblotting sodium dodecyl sulfate-polyacrylamide gel electrophoresis-separated components which...
CrossFit® instructor demographics and practice trends
Directory of Open Access Journals (Sweden)
Gregory R. Waryasz
2016-11-01
Full Text Available CrossFit® is an increasingly popular exercise modality that uses high intensity power training. The literature to date regarding CrossFit® has focused on its benefits to VO2 Max, body composition and the motivational variables of participants of CrossFit®. A computerized survey was distributed to CrossFit® instructors using Survey Monkey® (Palo Alto, CA, USA. One hundred and ninety-three CrossFit® instructors responded to the survey. Of these 86.6% (155/179 reported being a certified CrossFit® instructor with 26.7% (48/180 having a bachelor’s degree in an exercise-related field. Instructors with a CrossFit® certification have less bachelor’s (P=0.04 or master’s (P=0.0001 degrees compared to those without a CrossFit® certification, more utilization of Olympic weightlifting (P=0.03, one-on-one teaching (P=0.0001, 1-RM max on snatch (P=0.004, 1- RM on clean and jerk or hang clean (P=0.0003, kettlebell use (P=0.0001 and one-on-one training (P=0.0001. Instructors report differences in their education and differences in use of weightlifting platforms and various types of footwear. Non-certified instructors differ from CrossFit® certified instructors in regards to teaching of Olympic weightlifting and exercise programming.
CrossFit® Instructor Demographics and Practice Trends.
Waryasz, Gregory R; Suric, Vladimir; Daniels, Alan H; Gil, Joseph A; Eberson, Craig P
2016-11-17
CrossFit ® is an increasingly popular exercise modality that uses high intensity power training. The literature to date regarding CrossFit ® has focused on its benefits to VO2 Max, body composition and the motivational variables of participants of CrossFit ® . A computerized survey was distributed to CrossFit ® instructors using Survey Monkey ® (Palo Alto, CA, USA). One hundred and ninety-three CrossFit ® instructors responded to the survey. Of these 86.6% (155/179) reported being a certified CrossFit ® instructor with 26.7% (48/180) having a bachelor's degree in an exercise-related field. Instructors with a CrossFit ® certification have less bachelor's (P=0.04) or master's (P=0.0001) degrees compared to those without a CrossFit ® certification, more utilization of Olympic weightlifting (P=0.03), one-on-one teaching (P=0.0001), 1-RM max on snatch (P=0.004), 1-RM on clean and jerk or hang clean (P=0.0003), kettlebell use (P=0.0001) and one-on-one training (P=0.0001). Instructors report differences in their education and differences in use of weightlifting platforms and various types of footwear. Non-certified instructors differ from CrossFit ® certified instructors in regards to teaching of Olympic weightlifting and exercise programming.
Directory of Open Access Journals (Sweden)
2010-11-01
Full Text Available To control the swelling of sodium carboxymethylcellulose (CMCNa membranes, mixtures of CMCNa and glutaraldehyde (GA and mixtures of CMCNa as an organic component and tetraethoxysilane (TEOS as an inorganic component were prepared, and CMCNa/GA cross-linked membranes and CMCNa/TEOS hybrid membranes were formed. In the separation of an ethanol/water azeotrope by pervaporation (PV, the effects of the GA or TEOS content on the water/ethanol selectivity and permeability of these CMCNa/GA cross-linked and CMCNa/TEOS hybrid membranes were investigated. Cross-linked and hybrid membranes containing up to 10 wt% GA or 10 wt% TEOS exhibited higher water/ethanol selectivity than CMCNa membrane without any cross-linker. This resulted from both increased density and depressed swelling of the membranes by the formation of a cross-linked structure. The relationship between the structure of the CMCNa/GA cross-linked membranes and CMCNa/TEOS hybrid membranes and their permeation and separation characteristics for an ethanol/water azeotrope during PV is discussed in detail.
International Nuclear Information System (INIS)
Collins, T.
1985-08-01
A simple criterion governs the beam distortion and/or loss of protons on a fast resonance crossing. Results from numerical integrations are illustrated for simple sextupole, octupole, and 10-pole resonances
Energy Technology Data Exchange (ETDEWEB)
Collins, T.
1985-08-01
A simple criterion governs the beam distortion and/or loss of protons on a fast resonance crossing. Results from numerical integrations are illustrated for simple sextupole, octupole, and 10-pole resonances.
Evaluation of stream crossing methods prior to gas pipeline construction
International Nuclear Information System (INIS)
Murphy, M.H.; Rogers, J.S.; Ricca, A.
1995-01-01
Stream surveys are conducted along proposed gas pipeline routes prior to construction to assess potential impacts to stream ecosystems and to recommend preferred crossing methods. Recently, there has been a high level of scrutiny from the Public Service Commission (PSC) to conduct these stream crossings with minimal effects to the aquatic community. PSC's main concern is the effect of sediment on aquatic biota. Smaller, low flowing or intermittent streams are generally crossed using a wet crossing technique. This technique involves digging a trench for the pipeline while the stream is flowing. Sediment control measures are used to reduce sediment loads downstream. Wider, faster flowing, or protected streams are typically crossed with a dry crossing technique. A dry crossing involves placing a barrier upstream of the crossing and diverting the water around the crossing location. The pipeline trench is then dug in the dry area. O'Brien and Gere and NYSEG have jointly designed a modified wet crossing for crossing streams that exceed maximum flows for a dry crossing, and are too wide for a typical wet crossing. This method diverts water around the crossing using a pumping system, instead of constructing a dam. The trench is similar to a wet crossing, with sediment control devices in place upstream and downstream. If streams are crossed during low flow periods, the pumping system will be able to reduce the majority of water flow and volume form the crossing area, thereby reducing ecological impacts. Evaluation of effects of this crossing type on the stream biota are currently proposed and may proceed when construction begins
Injury Rate and Patterns Among CrossFit Athletes.
Weisenthal, Benjamin M; Beck, Christopher A; Maloney, Michael D; DeHaven, Kenneth E; Giordano, Brian D
2014-04-01
CrossFit is a type of competitive exercise program that has gained widespread recognition. To date, there have been no studies that have formally examined injury rates among CrossFit participants or factors that may contribute to injury rates. To establish an injury rate among CrossFit participants and to identify trends and associations between injury rates and demographic categories, gym characteristics, and athletic abilities among CrossFit participants. Descriptive epidemiology study. A survey was conducted, based on validated epidemiologic injury surveillance methods, to identify patterns of injury among CrossFit participants. It was sent to CrossFit gyms in Rochester, New York; New York City, New York; and Philadelphia, Pennsylvania, and made available via a posting on the main CrossFit website. Participants were encouraged to distribute it further, and as such, there were responses from a wide geographical location. Inclusion criteria included participating in CrossFit training at a CrossFit gym in the United States. Data were collected from October 2012 to February 2013. Data analysis was performed using Fisher exact tests and chi-square tests. A total of 486 CrossFit participants completed the survey, and 386 met the inclusion criteria. The overall injury rate was determined to be 19.4% (75/386). Males (53/231) were injured more frequently than females (21/150; P = .03). Across all exercises, injury rates were significantly different (P CrossFit was approximately 20%. Males were more likely to sustain an injury than females. The involvement of trainers in coaching participants on their form and guiding them through the workout correlates with a decreased injury rate. The shoulder and lower back were the most commonly injured in gymnastic and power lifting movements, respectively. Participants reported primarily acute and fairly mild injuries.
Deconstructing Cross-Entropy for Probabilistic Binary Classifiers
Directory of Open Access Journals (Sweden)
Daniel Ramos
2018-03-01
Full Text Available In this work, we analyze the cross-entropy function, widely used in classifiers both as a performance measure and as an optimization objective. We contextualize cross-entropy in the light of Bayesian decision theory, the formal probabilistic framework for making decisions, and we thoroughly analyze its motivation, meaning and interpretation from an information-theoretical point of view. In this sense, this article presents several contributions: First, we explicitly analyze the contribution to cross-entropy of (i prior knowledge; and (ii the value of the features in the form of a likelihood ratio. Second, we introduce a decomposition of cross-entropy into two components: discrimination and calibration. This decomposition enables the measurement of different performance aspects of a classifier in a more precise way; and justifies previously reported strategies to obtain reliable probabilities by means of the calibration of the output of a discriminating classifier. Third, we give different information-theoretical interpretations of cross-entropy, which can be useful in different application scenarios, and which are related to the concept of reference probabilities. Fourth, we present an analysis tool, the Empirical Cross-Entropy (ECE plot, a compact representation of cross-entropy and its aforementioned decomposition. We show the power of ECE plots, as compared to other classical performance representations, in two diverse experimental examples: a speaker verification system, and a forensic case where some glass findings are present.
High ET jet cross sections at CDF
International Nuclear Information System (INIS)
Flaugher, B.
1996-08-01
The inclusive jet cross section for p anti p collisions at √s = 1.8 TeV as measured by the CDF collaboration will be presented. Preliminary CDF measurements of the Σ E T cross section at √s = 1.8 TeV and the central inclusive jet cross section at √s = 0.630 TeV will also be shown
The Cross-Cultural Knowledge Sharing Challenge
DEFF Research Database (Denmark)
Persson, John Stouby
2013-01-01
Cross-cultural offshoring in software development challenges effective knowledge sharing. While research has suggested temporarily co-locating participants to address this challenge, few studies are available on what knowledge sharing practices emerge over time when co-locating cross-cultural sof...
Cross-Conjugated n-Dopable Aromatic Polyketone
Voortman, Thomas P.; Bartesaghi, Davide; Koster, L. Jan Anton; Chiechi, Ryan C.
2015-01-01
This paper describes the synthesis and characterization of a high molecular weight cross-conjugated polyketone synthesized via scalable Friedel Crafts chemistry. Cross-conjugated polyketones are precursors to conjugated polyions; they become orders of magnitude more conductive after a two-electron
34 CFR 101.79 - Cross-examination.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Cross-examination. 101.79 Section 101.79 Education...-examination. A witness may be cross-examined on any matter material to the proceeding without regard to the scope of his direct examination. ...
Cross-Domain Statistical-Sequential Dependencies Are Difficult To Learn
Directory of Open Access Journals (Sweden)
Anne McClure Walk
2016-02-01
Full Text Available Recent studies have demonstrated participants’ ability to learn cross-modal associations during statistical learning tasks. However, these studies are all similar in that the cross-modal associations to be learned occur simultaneously, rather than sequentially. In addition, the majority of these studies focused on learning across sensory modalities but not across perceptual categories. To test both cross-modal and cross-categorical learning of sequential dependencies, we used an artificial grammar learning task consisting of a serial stream of auditory and/or visual stimuli containing both within- and cross-domain dependencies. Experiment 1 examined within-modal and cross-modal learning across two sensory modalities (audition and vision. Experiment 2 investigated within-categorical and cross-categorical learning across two perceptual categories within the same sensory modality (e.g. shape and color; tones and non-words. Our results indicated that individuals demonstrated learning of the within-modal and within-categorical but not the cross-modal or cross-categorical dependencies. These results stand in contrast to the previous demonstrations of cross-modal statistical learning, and highlight the presence of modality constraints that limit the effectiveness of learning in a multimodal environment.
Intersystem crossing in complex molecules
International Nuclear Information System (INIS)
Pappalardo, R.G.
1980-01-01
The general question of singlet-triplet intersystem crossing is addressed in the context of large organic molecules, i.e., ''complex'' molecules capable of self-relaxation in the absence of collisions. Examples of spectral properties of such molecules in the vapor phase are discussed, relying on extensive Russian literature in this area. Formal expressions for the relaxation rate in the electronic excited states are derived on the basis of the formalism of collision theory, and are applied to the specific case of intersystem crossing. The derivation of the ''energy-gap'' law for triplet-singlet conversion in aromatic hydrocarbons is briefly outlined. The steep rise of internal conversion rates as a function of excess excitation energy, and its competition with the intersystem crossing process, are reviewed for the case of naphthalene vapor. A general expression for the spin-orbit interaction Hamiltonian in molecular systems is outlined. Experimental observations on singlet-triplet conversion rates and the factors that can drastically affect such rates are discussed, with emphasis on the ''in- ternal'' and ''external'' heavy-atom effects. Basic relations of ESR spectroscopy and magnetophotoselection are reviewed. Technological implications of the singlet-triplet crossing in complex molecules are discussed in the context of chelate lasers, dye lasers and luminescent displays. Effects related to singlet-triplet crossing, and generally to excited-state energy-transfer in biological systems, are exemplified by the role of aromatic amino-acids in the phosphorescence of proteins, by some recent studies of energy-transfer in models of biomembranes, and by the clustering of triplet-energy donor-acceptor pairs in micelles
CHALLENGES IN CROSS CULTURAL ADVERTISING
Yuni Retnowati
2016-01-01
At first, marketing practitioners and academics consider standardized approaches to marketing and advertising strategies in globalization, and then some studies proved that the standardization of advertising across culture is not valid. Therefore, cross cultural advertising takes local culture into account when conveying messages in advertisements. Cross cultural understanding is very important in order to produce successful localized advertising that would reflect the cultural values and nor...
Bhatti, Anant Preet
2009-01-01
With the rapid increase in the globalization of business, workforces are becoming increasingly diverse and multicultural. Managing global workforces has increased pressure on Human Resource managers to recognize and adapt to cultural differences, which when ignored can result in cross-cultural misunderstandings. With the growing significance of developing economies in the global business environment, Human Resource Management is facing increased difficulty in managing cross-border cultural re...
Cross-cultural Context and Politeness
Institute of Scientific and Technical Information of China (English)
朱芬
2012-01-01
In social interaction,politeness is a universal phenomenon existing in all languages.However,for social,ethnographic and even historical reasons,politeness strategies in a specific cultural context may vary from one to another.And for most time it is not language itself but different politeness strategies that lead to cross-cultural communicative failure.Knowing about these differences will help to overcome pragmatic failure in cross-cultural communication.
Cross plane scattering correction
International Nuclear Information System (INIS)
Shao, L.; Karp, J.S.
1990-01-01
Most previous scattering correction techniques for PET are based on assumptions made for a single transaxial plane and are independent of axial variations. These techniques will incorrectly estimate the scattering fraction for volumetric PET imaging systems since they do not take the cross-plane scattering into account. In this paper, the authors propose a new point source scattering deconvolution method (2-D). The cross-plane scattering is incorporated into the algorithm by modeling a scattering point source function. In the model, the scattering dependence both on axial and transaxial directions is reflected in the exponential fitting parameters and these parameters are directly estimated from a limited number of measured point response functions. The authors' results comparing the standard in-plane point source deconvolution to the authors' cross-plane source deconvolution show that for a small source, the former technique overestimates the scatter fraction in the plane of the source and underestimate the scatter fraction in adjacent planes. In addition, the authors also propose a simple approximation technique for deconvolution
Recommended evaluation procedure for photonuclear cross section
Energy Technology Data Exchange (ETDEWEB)
Lee, Young-Ouk; Chang, Jonghwa; Fukahori, Tokio [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1998-03-01
In order to generate photonuclear cross section library for the necessary applications, data evaluation is combined with theoretical evaluation, since photonuclear cross sections measured cannot provide all necessary data. This report recommends a procedure consisting of four steps: (1) analysis of experimental data, (2) data evaluation, (3) theoretical evaluation and, if necessary, (4) modification of results. In the stage of analysis, data obtained by different measurements are reprocessed through the analysis of their discrepancies to a representative data set. In the data evaluation, photonuclear absorption cross sections are evaluated via giant dipole resonance and quasi-deutron mechanism. With photoabsorption cross sections from the data evaluation, theoretical evaluation is applied to determine various decay channel cross sections and emission spectra using equilibrium and preequilibrium mechanism. After this, the calculated results are compared with measured data, and in some cases the results are modified to better describe measurements. (author)
Recent advances in corneal collagen cross-linking
Directory of Open Access Journals (Sweden)
Gitansha Shreyas Sachdev
2017-01-01
Full Text Available Corneal collagen cross-linking has become the preferred modality of treatment for corneal ectasia since its inception in late 1990s. Numerous studies have demonstrated the safety and efficacy of the conventional protocol. Our understanding of the cross-linking process is ever evolving, with its wide implications in the form of accelerated and pulsed protocols. Newer advancements in technology include various riboflavin formulations and the ability to deliver higher fluence protocols with customised irradiation patterns. A greater degree of customisation is likely the path forward, which will aim at achieving refractive improvements along with disease stability. The use of cross-linking for myopic correction is another avenue under exploration. Combination of half fluence cross-linking with refractive correction for high errors to prevent post LASIK regression is gaining interest. This review aims to highlight the various advancements in the cross-linking technology and its clinical applications.
Vinyldisiloxanes: their synthesis, cross coupling and applications.
Sore, Hannah F; Boehner, Christine M; Laraia, Luca; Logoteta, Patrizia; Prestinari, Cora; Scott, Matthew; Williams, Katharine; Galloway, Warren R J D; Spring, David R
2011-01-21
During the studies towards the development of pentafluorophenyldimethylsilanes as a novel organosilicon cross coupling reagent it was revealed that the active silanolate and the corresponding disiloxane formed rapidly under basic conditions. The discovery that disiloxanes are in equilibrium with the silanolate led to the use of disiloxanes as cross coupling partners under fluoride free conditions. Our previous report focused on the synthesis and base induced cross coupling of aryl substituted vinyldisiloxanes with aryl halides; good yields and selectivities were achieved. As a continuation of our research, studies into the factors which influence the successful outcome of the cross coupling reaction with both alkyl and aryl substituted vinyldisiloxanes were examined and a proposed mechanism discussed. Further investigation into expanding the breadth and diversity of substituted vinyldisiloxanes in cross coupling was explored and applied to the synthesis of unsymmetrical trans-stilbenes and cyclic structures containing the trans-alkene architecture.
40 CFR 750.20 - Cross-examination.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Cross-examination. 750.20 Section 750.20 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC SUBSTANCES CONTROL ACT... Manufacturing Exemptions § 750.20 Cross-examination. Section 750.8 shall be applicable. ...
49 CFR 236.787 - Protection, cross.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Protection, cross. 236.787 Section 236.787 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Protection, cross. An arrangement to prevent the improper operation of a signal, switch, movable-point frog...
Cross-border entrepreneurship in a global world
DEFF Research Database (Denmark)
Emontspool, Julie; Servais, Per
2017-01-01
This paper shows that international entrepreneurship and immigrant entrepreneurship increasingly intersect in a global world. Both research streams address cross-border entrepreneurial activity in parallel to each other. International entrepreneurship focuses on outgoing entrepreneurial activity......, while immigrant entrepreneurship mainly considers incoming entrepreneurial activity. This paper critically discusses such a dichotomy, highlighting how differentiating immigrant entrepreneurs and international entrepreneurs perpetuates orientalist assumptions about cross-border business activity....... Focusing on a entrepreneurship as behaviour, the paper proposes an alternative perspective to cross-border entrepreneurship, discussing cross-border opportunity identification and exploitation between an entrepreneur’s country of residence and a foreign country. This perspective provides a number...
Regenerator cross arm seal assembly
Jackman, Anthony V.
1988-01-01
A seal assembly for disposition between a cross arm on a gas turbine engine block and a regenerator disc, the seal assembly including a platform coextensive with the cross arm, a seal and wear layer sealingly and slidingly engaging the regenerator disc, a porous and compliant support layer between the platform and the seal and wear layer porous enough to permit flow of cooling air therethrough and compliant to accommodate relative thermal growth and distortion, a dike between the seal and wear layer and the platform for preventing cross flow through the support layer between engine exhaust and pressurized air passages, and air diversion passages for directing unregenerated pressurized air through the support layer to cool the seal and wear layer and then back into the flow of regenerated pressurized air.
Crossing-symmetric solutions to low equations
International Nuclear Information System (INIS)
McLeod, R.J.; Ernst, D.J.
1985-01-01
Crossing symmetric models of the pion-nucleon interaction in which crossing symmetry is kept to lowest order in msub(π)/msub(N) are investigated. Two iterative techniques are developed to solve the crossing-symmetric Low equation. The techniques are used to solve the original Chew-Low equations and their generalizations to include the coupling to the pion-production channels. Small changes are found in comparison with earlier results which used an iterative technique proposed by Chew and Low and which did not produce crossing-symmetric results. The iterative technique of Chew and Low is shown to fail because of its inability to produce zeroes in the amplitude at complex energies while physical solutions to the model require such zeroes. We also prove that, within the class of solutions such that phase shifts approach zero for infinite energy, the solution to the Low equation is unique. (orig.)
Luminosity Anti-leveling with Crossing Angle (MD 1669)
Gorzawski, Arkadiusz; Ponce, Laurette; Salvachua Ferrando, Belen Maria; Wenninger, Jorg; CERN. Geneva. ATS Department
2016-01-01
A significant fraction of the LHC luminosity ($\\sim$30\\% in 2016) is lost due to the presence (and necessity) of the crossing angles at the IPs. At the LHC the crossing angle is typically set to a value that provides sufficient separation of the beams at the start of fills for the peak bunch intensities. As the bunch intensity decays during a fill, it is possible to reduce the crossing angle and recover some luminosity. A smooth crossing angle reduction procedure must be developed to take advantage of this option during stable beam operation. During this MD a smooth procedure for luminosity leveling with crossing angle was tested. It was demonstrated that the orbit was well controlled, beam losses were low and the offset leveled experiments ALICE and LHCb were not affected by crossing angle leveling in ATLAS and CMS.
Recommended activation detector cross sections (RNDL-82)
International Nuclear Information System (INIS)
Bondars, Kh.Ya.; Lapenas, A.A.
1984-01-01
The results of the comparison between measured and calculated average cross sections in 5 benchmark experiments are presented. Calculations have been based on the data from 10 libraries of evaluated cross sections. The recommended library (RNDL-82) of the activation detector cross sections has been created on the basis of the comparison. RNDL-82, including 26 reactions, and the basic characteristics of the detectors are presented. (author)
Dielectronic recombination cross sections for H-like ions
International Nuclear Information System (INIS)
Pindzola, M.S.; Badnell, N.R.; Griffin, D.C.
1990-01-01
Dielectronic recombination cross sections for several H-like atomic ions are calculated in an isolated-resonance, distorted-wave approximation. Fine-structure and configuration-interaction effects are examined in detail for the O 7+ cross section. Hartree-Fock, intermediate-coupled, multiconfiguration dielectronic recombination cross sections for O 7+ are then compared with the recent experimental measurements obtained with the Test Storage Ring in Heidelberg. The cross-section spectra line up well in energy and the shape of the main resonance structures are comparable. The experimental integrated cross sections differ by up to 20% from theory, but this may be due in part to uncertainties in the electron distribution function
Crossed product algebras associated with topological dynamical systems
Svensson, Pär Christian
2009-01-01
We study connections between topological dynamical systems and associated algebras of crossed product type. We derive equivalences between structural properties of a crossed product and dynamical properties of the associated system and furthermore derive qualitative results concerning the crossed
Injury Rate and Patterns Among CrossFit Athletes
Weisenthal, Benjamin M.; Beck, Christopher A.; Maloney, Michael D.; DeHaven, Kenneth E.; Giordano, Brian D.
2014-01-01
Background: CrossFit is a type of competitive exercise program that has gained widespread recognition. To date, there have been no studies that have formally examined injury rates among CrossFit participants or factors that may contribute to injury rates. Purpose: To establish an injury rate among CrossFit participants and to identify trends and associations between injury rates and demographic categories, gym characteristics, and athletic abilities among CrossFit participants. Study Design: ...
Cross-training policies and team performance
Slomp, J.; Molleman, E.
Labour flexibility is an important issue in the design and development of teams. By means of an analytical study this paper investigates the impact of cross-training on team performance. Four cross-training policies are distinguished and compared according to their effects on important performance
Activation cross section and isomeric cross-section ratio for the (n,2n) reaction on {sup 132,134}Ba
Energy Technology Data Exchange (ETDEWEB)
Luo, Junhua [Hexi Univ., Zhangye (China). School of Physics and Electromechanical Engineering; Hexi Univ., Zhangye (China). Inst. of New Energy; Wu, Chunlei; Jiang, Li [Chinese Academy of Engineering Physics, Mianyang (China). Inst. of Nuclear Physics and Chemistry; Li, Suyuan [Hexi Univ., Zhangye (China). Inst. of New Energy
2017-07-01
Cross sections of the {sup 132}Ba(n,2n){sup 131m,g}Ba and {sup 134}Ba(n,2n){sup 133m,g}Ba reactions and their isomeric cross section ratios σ{sub m}/σ{sub g} have been measured by means of the activation technique at three neutron energies in the range 13-15 MeV. BaCO{sub 3} samples and Nb monitor foils were activated together to determine the reaction cross section and the incident neutron flux. The quasimonoenergetic neutrons beam were produced via the {sup 3}H(d,n){sup 4}He reaction at the Pd-300 Neutron Generator of the Chinese Academy of Engineering Physics (CAEP). The activities induced in the reaction products were measured using high-resolution γ ray spectroscopy. The pure cross section of the ground-state was derived from the absolute cross section of the metastable state and the residual nuclear decay analysis. Cross sections were also evaluated theoretically using the numerical nuclear model code, TALYS-1.8 with different level density options at neutron energies varying from the reaction threshold to 20 MeV. Results are discussed and compared with the corresponding literature.
Neutron Cross Sections for Aluminium
Energy Technology Data Exchange (ETDEWEB)
Forsberg, Leif
1963-08-15
Total, elastic, inelastic, (n, 2n), (n, {alpha}), (n, p), and (n, {gamma}) cross sections for aluminium have been compiled from thermal to 100 MeV based upon literature search and theoretical interpolations and estimates. Differential elastic cross sections in the centre of mass system are represented by the Legendre coefficients. This method was chosen in order to obtain the best description of the energy dependence of the anisotropy.
DEFF Research Database (Denmark)
Søndergaard, I; Poulsen, L K; Hagerup, M
1987-01-01
points along the precipitation curve in the curve-fitting process. The system has been tested on crossed immunoelectrophoretic patterns as well as crossed radioimmunoelectrophoretic patterns and it has been shown that the system can recognize the same precipitation curves on different immunoplates...
Application of Monte Carlo cross-validation to identify pathway cross-talk in neonatal sepsis.
Zhang, Yuxia; Liu, Cui; Wang, Jingna; Li, Xingxia
2018-03-01
To explore genetic pathway cross-talk in neonates with sepsis, an integrated approach was used in this paper. To explore the potential relationships between differently expressed genes between normal uninfected neonates and neonates with sepsis and pathways, genetic profiling and biologic signaling pathway were first integrated. For different pathways, the score was obtained based upon the genetic expression by quantitatively analyzing the pathway cross-talk. The paired pathways with high cross-talk were identified by random forest classification. The purpose of the work was to find the best pairs of pathways able to discriminate sepsis samples versus normal samples. The results found 10 pairs of pathways, which were probably able to discriminate neonates with sepsis versus normal uninfected neonates. Among them, the best two paired pathways were identified according to analysis of extensive literature. Impact statement To find the best pairs of pathways able to discriminate sepsis samples versus normal samples, an RF classifier, the DS obtained by DEGs of paired pathways significantly associated, and Monte Carlo cross-validation were applied in this paper. Ten pairs of pathways were probably able to discriminate neonates with sepsis versus normal uninfected neonates. Among them, the best two paired pathways ((7) IL-6 Signaling and Phospholipase C Signaling (PLC); (8) Glucocorticoid Receptor (GR) Signaling and Dendritic Cell Maturation) were identified according to analysis of extensive literature.
Activation cross section and isomeric cross section ratios for the (n ,2 n ) reaction on 153Eu
Luo, Junhua; Jiang, Li; Li, Suyuan
2017-10-01
The 153Eu(n ,2 n ) m1,m2,g152Eu cross section was measured by means of the activation technique at three neutron energies in the range 13-15 MeV. The quasimonoenergetic neutron beam was formed via the 3H(d ,n ) 4He reaction, in the Pd-300 Neutron Generator at the Chinese Academy of Engineering Physics (CAEP). The activities induced in the reaction products were measured using high-resolution γ-ray spectroscopy. The cross section of the population of the second high-spin (8-) isomeric state was measured along with the reaction cross section populating both the ground (3-) and the first isomeric state (0-). Cross sections were also evaluated theoretically using the numerical code TALYS-1.8, with different level density options at neutron energies varying from the reaction threshold to 20 MeV. Results are discussed and compared with the corresponding literature.
Comparative analysis among several cross section sets
International Nuclear Information System (INIS)
Caldeira, A.D.
1983-01-01
Critical parameters were calculated using the one dimensional multigroup transport theory for several cross section sets. Calculations have been performed for water mixtures of uranium metal, plutonium metal and uranium-thorium oxide, and for metallics systems, to determine the critical dimensions of geometries (sphere and cylinder). For this aim, the following cross section sets were employed: 1) multigroup cross section sets obtained from the GAMTEC-II code; 2) the HANSEN-ROACH cross section sets; 3) cross section sets from the ENDF/B-IV, processed by the NJOY code. Finally, we have also calculated the corresponding critical radius using the one dimensional multigroup transport DTF-IV code. The numerical results agree within a few percent with the critical values obtained in the literature (where the greatest discrepancy occured in the critical dimensions of water mixtures calculated with the values generated by the NJOY code), a very good results in comparison with similar works. (Author) [pt
victoria cross awards warrants concerning the victoria cross (1920)
African Journals Online (AJOL)
1. WARRANTS CONCERNING THE. VICTORIA CROSS (1920). In order to get a picture of the Royal Warrants promulgated from 1856 to 1920 in respect of the .... to confirmation by us. Eighthly. - It is ordained, where such an act shall not have been performed in the sight of a commanding officer as aforesaid, then the ...
International Nuclear Information System (INIS)
Fu, C.Y.; Hetrick, D.M.
1982-01-01
Recent ratio data, with carefully evaluated covariances, were combined with eleven of the ENDF/B-V dosimetry cross sections using the generalized least-squares method. The purpose was to improve these evaluated cross sections and covariances, as well as to generate values for the cross-reaction covariances. The results represent improved cross sections as well as realistic and usable covariances. The latter are necessary for meaningful intergral-differential comparisons and for spectrum unfolding
Nitric oxide-induced interstrand cross-links in DNA.
Caulfield, Jennifer L; Wishnok, John S; Tannenbaum, Steven R
2003-05-01
The DNA damaging effects of nitrous acid have been extensively studied, and the formation of interstrand cross-links have been observed. The potential for this cross-linking to occur through a common nitrosating intermediate derived from nitric oxide is investigated here. Using a HPLC laser-induced fluorescence (LIF) system, the amount of interstrand cross-link formed on nitric oxide treatment of the 5'-fluorescein-labeled oligomer ATATCGATCGATAT was determined. This self-complimentary sequence contains two 5'-CG sequences, which is the preferred site for nitrous acid-induced cross-linking. Nitric oxide was delivered to an 0.5 mM oligomer solution at 15 nmol/mL/min to give a final nitrite concentration of 652 microM. The resulting concentration of the deamination product, xanthine, in this sample was found to be 211 +/- 39 nM, using GC/MS, and the amount of interstrand cross-link was determined to be 13 +/- 2.5 nM. Therefore, upon nitric oxide treatment, the cross-link is found at approximately 6% of the amount of the deamination product. Using this system, detection of the cross-link is also possible for significantly lower doses of nitric oxide, as demonstrated by treatment of the same oligomer with NO at a rate of 18 nmol/mL/min resulting in a final nitrite concentration of 126 microM. The concentration of interstrand cross-link was determined to be 3.6 +/- 0.1 nM in this sample. Therefore, using the same dose rate, when the total nitric oxide concentration delivered drops by a factor of approximately 5, the concentration of cross-link drops by a factor of about 4-indicating a qausi-linear response. It may now be possible to predict the number of cross-links in a small genome based on the number of CpG sequences and the yield of xanthine derived from nitrosative deamination.
Preparation and properties of silk sericin/cellulose cross-linking films
Directory of Open Access Journals (Sweden)
Wang Kunyan
2017-01-01
Full Text Available Silk sericin/cellulose cross-linked films were successfully prepared using glutaraldehyde as cross-linkinger. FTIR was applied to characterize the chemical structure of films. Cross-linked silk sericin film was found the peak intensity of FTIR for cross-linked film decreased markedly compared to pure silk sericin, which indicating cross-linking reaction has been occurred. The increasing value of swelling ratio also indicated the cross-linking has been happened. The cross-linking reaction increased the thermal decomposition temperature.
Porous Cross-Linked Polyimide-Urea Networks
Meador, Mary Ann B. (Inventor); Nguyen, Baochau N. (Inventor)
2015-01-01
Porous cross-linked polyimide-urea networks are provided. The networks comprise a subunit comprising two anhydride end-capped polyamic acid oligomers in direct connection via a urea linkage. The oligomers (a) each comprise a repeating unit of a dianhydride and a diamine and a terminal anhydride group and (b) are formulated with 2 to 15 of the repeating units. The subunit was formed by reaction of the diamine and a diisocyanate to form a diamine-urea linkage-diamine group, followed by reaction of the diamine-urea linkage-diamine group with the dianhydride and the diamine to form the subunit. The subunit has been cross-linked via a cross-linking agent, comprising three or more amine groups, at a balanced stoichiometry of the amine groups to the terminal anhydride groups. The subunit has been chemically imidized to yield the porous cross-linked polyimide-urea network. Also provided are wet gels, aerogels, and thin films comprising the networks, and methods of making the networks.
Fission cross section measurements at intermediate energies
International Nuclear Information System (INIS)
Laptev, Alexander
2005-01-01
The activity in intermediate energy particle induced fission cross-section measurements of Pu, U isotopes, minor actinides and sub-actinides in PNPI of Russia is reviewed. The neutron-induced fission cross-section measurements are under way in the wide energy range of incident neutrons from 0.5 MeV to 200 MeV at the GNEIS facility. In number of experiments at the GNEIS facility, the neutron-induced fission cross sections were obtained for many nuclei. In another group of experiments the proton-induced fission cross-section have been measured for proton energies ranging from 200 to 1000 MeV at 100 MeV intervals using the proton beam of PNPI synchrocyclotron. (author)
Classical scattering cross section in sputtering transport theory
International Nuclear Information System (INIS)
Zhang Zhulin
2002-01-01
For Lindhard scaling interaction potential scattering commonly used in sputtering theory, the authors analyzed the great difference between Sigmund's single power and the double power cross sections calculated. The double power cross sections can give a much better approximation to the Born-Mayer scattering in the low energy region (m∼0.1). In particular, to solve the transport equations by K r -C potential interaction given by Urbassek few years ago, only the double power cross sections (m∼0.1) can yield better approximate results for the number of recoils. Therefore, the Sigmund's single power cross section might be replaced by the double power cross sections in low energy collision cascade theory
Cross section data for ionization of important cyanides
International Nuclear Information System (INIS)
Kaur, Jaspreet; Antony, Bobby
2015-01-01
Highlights: • Multi centre spherical complex optical potential formalism used to find the CS. • Effective method (CSP-ic) to derive ionization contribution from inelastic CS. • Result shows excellent accord with previous results and consistent behaviour. • Maiden attempt to find CS for many cyanide molecules. • Strong correlation observed between peak of ionization with target properties. - Abstract: This article presents cross section calculations for interactions of important cyanides with electrons possessing energies beginning from ionization threshold of the target molecule to 5 keV. These data are pursued to meet the ever increasing demand for cross sections by the relevant atomic and molecular community for modelling astrophysical, atmospheric and technological domains. The calculations have been executed using an amalgam of multi centre spherical complex optical potential (MSCOP) formalism and complex scattering potential-ionization contribution (CSP-ic) method. Cross sections are compared with experimental and theoretical data wherever available. Strong correlations are observed for the cross sections which affirms consistent and reliable cross sections. Isomeric effect has been interpreted using variation of cross section with structure and target properties. Our cross sections will be tabulated in atomic collision database for use in modelling various statistical and dynamical quantities.
Cross section data for ionization of important cyanides
Energy Technology Data Exchange (ETDEWEB)
Kaur, Jaspreet; Antony, Bobby, E-mail: bka.ism@gmail.com
2015-11-15
Highlights: • Multi centre spherical complex optical potential formalism used to find the CS. • Effective method (CSP-ic) to derive ionization contribution from inelastic CS. • Result shows excellent accord with previous results and consistent behaviour. • Maiden attempt to find CS for many cyanide molecules. • Strong correlation observed between peak of ionization with target properties. - Abstract: This article presents cross section calculations for interactions of important cyanides with electrons possessing energies beginning from ionization threshold of the target molecule to 5 keV. These data are pursued to meet the ever increasing demand for cross sections by the relevant atomic and molecular community for modelling astrophysical, atmospheric and technological domains. The calculations have been executed using an amalgam of multi centre spherical complex optical potential (MSCOP) formalism and complex scattering potential-ionization contribution (CSP-ic) method. Cross sections are compared with experimental and theoretical data wherever available. Strong correlations are observed for the cross sections which affirms consistent and reliable cross sections. Isomeric effect has been interpreted using variation of cross section with structure and target properties. Our cross sections will be tabulated in atomic collision database for use in modelling various statistical and dynamical quantities.
Cross-sample entropy of foreign exchange time series
Liu, Li-Zhi; Qian, Xi-Yuan; Lu, Heng-Yao
2010-11-01
The correlation of foreign exchange rates in currency markets is investigated based on the empirical data of DKK/USD, NOK/USD, CAD/USD, JPY/USD, KRW/USD, SGD/USD, THB/USD and TWD/USD for a period from 1995 to 2002. Cross-SampEn (cross-sample entropy) method is used to compare the returns of every two exchange rate time series to assess their degree of asynchrony. The calculation method of confidence interval of SampEn is extended and applied to cross-SampEn. The cross-SampEn and its confidence interval for every two of the exchange rate time series in periods 1995-1998 (before the Asian currency crisis) and 1999-2002 (after the Asian currency crisis) are calculated. The results show that the cross-SampEn of every two of these exchange rates becomes higher after the Asian currency crisis, indicating a higher asynchrony between the exchange rates. Especially for Singapore, Thailand and Taiwan, the cross-SampEn values after the Asian currency crisis are significantly higher than those before the Asian currency crisis. Comparison with the correlation coefficient shows that cross-SampEn is superior to describe the correlation between time series.
Cross section homogenization analysis for a simplified Candu reactor
International Nuclear Information System (INIS)
Pounders, Justin; Rahnema, Farzad; Mosher, Scott; Serghiuta, Dumitru; Turinsky, Paul; Sarsour, Hisham
2008-01-01
The effect of using zero current (infinite medium) boundary conditions to generate bundle homogenized cross sections for a stylized half-core Candu reactor problem is examined. Homogenized cross section from infinite medium lattice calculations are compared with cross sections homogenized using the exact flux from the reference core environment. The impact of these cross section differences is quantified by generating nodal diffusion theory solutions with both sets of cross sections. It is shown that the infinite medium spatial approximation is not negligible, and that ignoring the impact of the heterogeneous core environment on cross section homogenization leads to increased errors, particularly near control elements and the core periphery. (authors)
2016-05-05
Train-vehicle/train collisions at highway-rail grade crossings (crossings) continue to be a major issue in the US and around the world. Although the United States has made great strides in improving safety at crossings since the 1970s, vehicle-train ...
Xie, Chi; Zhou, Yingying; Wang, Gangjin; Yan, Xinguo
We use the multifractal detrended cross-correlation analysis (MF-DCCA) method to explore the multifractal behavior of the cross-correlation between exchange rates of onshore RMB (CNY) and offshore RMB (CNH) against US dollar (USD). The empirical data are daily prices of CNY/USD and CNH/USD from May 1, 2012 to February 29, 2016. The results demonstrate that: (i) the cross-correlation between CNY/USD and CNH/USD is persistent and its fluctuation is smaller when the order of fluctuation function is negative than that when the order is positive; (ii) the multifractal behavior of the cross-correlation between CNY/USD and CNH/USD is significant during the sample period; (iii) the dynamic Hurst exponents obtained by the rolling windows analysis show that the cross-correlation is stable when the global economic situation is good and volatile in bad situation; and (iv) the non-normal distribution of original data has a greater effect on the multifractality of the cross-correlation between CNY/USD and CNH/USD than the temporary correlation.
Level crossing analysis of growing surfaces
International Nuclear Information System (INIS)
Shahbazi, F; Sobhanian, S; Tabar, M Reza Rahimi; Khorram, S; Frootan, G R; Zahed, H
2003-01-01
We investigate the average frequency of positive slope ν + α , crossing the height α = h - h-bar in the surface growing processes. The exact level crossing analysis of the random deposition model and the Kardar-Parisi-Zhang equation in the strong coupling limit before creation of singularities is given
Stream-crossing structure for deer fence
Robert M. Blair; James A. Hays; Louis Brunett
1963-01-01
Stream crossings are the most vulnerable points in a deer-proof fence. When an inadequately constructed crossing washes out, enclosed deer may escape and unwanted animals enter. Structures of the type described here have withstood 2 years of frequent, severe flooding in the pine-hardwood hills of central Louisiana.
Expatriation and Cross Cultural Training
Kangas, Laura
2012-01-01
The aim of this research was to find out how expatriation and cross cultural training are implemented in practice. This thesis studied the challenges expatriates face during and after their assignments. In this thesis the effectiveness of cross cultural training is studied and improvements considered. This thesis explains the reasons, challenges, assignments and roles of expatriates as well as how expatriates are trained. It also deals with different staffing approaches and the difference be...
Tomonari, H; Ikemori, T; Kubota, T; Uehara, S; Miyawaki, S
2014-12-01
A posterior cross-bite is defined as an abnormal bucco-lingual relationship between opposing molars, pre-molars or both in centric occlusion. Although it has been reported that patients with unilateral posterior cross-bite often show unique chewing patterns, the relationship between the form of cross-bite and masticatory jaw movement remains unclear in adult patients. The objective of this study was to investigate masticatory jaw movement among different forms of cross-bite. One hundred and one adults were recruited in this study: 27 had unilateral first molar cross-bite (MC group); 28, unilateral pre-molar cross-bite (PC group); 23, anterior cross-bite (AC group); and 23, normal occlusion (control group). Masticatory jaw movement of the lower incisor point was recorded with six degrees of freedom jaw-tracking system during unilateral mastication. Our results showed that the reverse chewing ratio during deliberate unilateral mastication was significantly larger in the MC group than in the PA (P chewing cycle. © 2014 John Wiley & Sons Ltd.
Cross-Cultural Psychology Newsletter. Volume 7, Number 2.
Dawson, John, Ed.
The Cross-Cultural Psychology Newsletter, an official publication of the International Association for Cross-Cultural Psychology, reports on recent publications and research in cross-cultural psychology. Notes on international conferences in the field are followed by annotations of new publications. In addition, recent research projects are…
Criticality benchmark comparisons leading to cross-section upgrades
International Nuclear Information System (INIS)
Alesso, H.P.; Annese, C.E.; Heinrichs, D.P.; Lloyd, W.R.; Lent, E.M.
1993-01-01
For several years criticality benchmark calculations with COG. COG is a point-wise Monte Carlo code developed at Lawrence Livermore National Laboratory (LLNL). It solves the Boltzmann equation for the transport of neutrons and photons. The principle consideration in developing COG was that the resulting calculation would be as accurate as the point-wise cross-sectional data, since no physics computational approximations were used. The objective of this paper is to report on COG results for criticality benchmark experiments in concert with MCNP comparisons which are resulting in corrections an upgrades to the point-wise ENDL cross-section data libraries. Benchmarking discrepancies reported here indicated difficulties in the Evaluated Nuclear Data Livermore (ENDL) cross-sections for U-238 at thermal neutron energy levels. This led to a re-evaluation and selection of the appropriate cross-section values from several cross-section sets available (ENDL, ENDF/B-V). Further cross-section upgrades anticipated
Modeling the Perceptions and Preferences of Pedestrians on Crossing Facilities
Directory of Open Access Journals (Sweden)
Hongwei Guo
2014-01-01
Full Text Available Pedestrian’s street-crossing behaviour has a significant effect on traffic performance and safety. The crossing behaviour is determined by human factors and environmental factors. Aiming at examining the pedestrian perceptions toward crossing facilities and preferences for crossing locations, an observational study of pedestrian crossing behaviour at urban street is conducted. The perceptions and preferences of pedestrians are collected using stated preference technique. A specific questionnaire is designed to conduct the stated preference survey. A multinomial logit model is proposed to describe the perceptions and preferences of pedestrians on crossing facilities and locations. The sensitivity analysis is performed to discuss the influence of various factors on crossing behaviour. Then the relationship between crossing locations and crossing distances is analyzed by a new proposed method. With the theoretical analysis, the engineering solutions considering pedestrian behaviour are suggested. The results are helpful to design human-centered crossing facilities in urban traffic.
Multifractal detrended cross-correlation analysis in the MENA area
El Alaoui, Marwane; Benbachir, Saâd
2013-12-01
In this paper, we investigated multifractal cross-correlations qualitatively and quantitatively using a cross-correlation test and the Multifractal detrended cross-correlation analysis method (MF-DCCA) for markets in the MENA area. We used cross-correlation coefficients to measure the level of this correlation. The analysis concerns four stock market indices of Morocco, Tunisia, Egypt and Jordan. The countries chosen are signatory of the Agadir agreement concerning the establishment of a free trade area comprising Arab Mediterranean countries. We computed the bivariate generalized Hurst exponent, Rényi exponent and spectrum of singularity for each pair of indices to measure quantitatively the cross-correlations. By analyzing the results, we found the existence of multifractal cross-correlations between all of these markets. We compared the spectrum width of these indices; we also found which pair of indices has a strong multifractal cross-correlation.
Cross-calibration of interferometric SAR data
DEFF Research Database (Denmark)
Dall, Jørgen
2003-01-01
Generation of digital elevation models from interferometric synthetic aperture radar (SAR) data is a well established technique. Achieving a high geometric fidelity calls for a calibration accounting for inaccurate navigation data and system parameters as well as system imperfections. Fully...... automated calibration techniques are preferable, especially for operational mapping. The author presents one such technique, called cross-calibration. Though developed for single-pass interferometry, it may be applicable to multi-pass interferometry, too. Cross-calibration requires stability during mapping...... ground control point is often needed. The paper presents the principles and mathematics of the cross-calibration technique and illustrates its successful application to EMISAR data....
24 CFR 241.1235 - Cross default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Cross default. 241.1235 Section 241... Rights and Obligations § 241.1235 Cross default. In the event the borrower commits a default under a prior recorded insured mortgage and the holder thereof initiates a foreclosure proceeding, said default...
Cross-Cultural Contact in Counseling Training.
Diaz-Lazaro, Carlos M.; Cohen, B. Beth
2001-01-01
Reports on the importance of cross-cultural contact in the development of multicultural counseling competencies (MCCs). Results reveal that the greater the prior cross-cultural life experience, the higher were students' MCCs measured at the beginning of a multicultural counseling course. MCCs measured at the end of the course were significantly…
7 CFR 15.118 - Cross-examination.
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Cross-examination. 15.118 Section 15.118 Agriculture Office of the Secretary of Agriculture NONDISCRIMINATION Rules of Practice and Procedure for Hearings...-examination. Cross-examination will be limited to the scope of direct examination and matters at issue in the...
Cross-talk in straw tube chambers
Energy Technology Data Exchange (ETDEWEB)
Marzec, J. E-mail: janusz.marzec@ire.pw.edu.pl
2003-05-11
An analytical model of the signal transmission between neighboring straw tubes with resistive cathodes (cross-talk) is presented. The dependence of the cross-talk level on the cathode resistance, tube length, particle detection point, the distance of the tube from the shielding planes, and termination of the tube ends is analyzed.
Cross-talk in straw tube chambers
International Nuclear Information System (INIS)
Marzec, J.
2003-01-01
An analytical model of the signal transmission between neighboring straw tubes with resistive cathodes (cross-talk) is presented. The dependence of the cross-talk level on the cathode resistance, tube length, particle detection point, the distance of the tube from the shielding planes, and termination of the tube ends is analyzed
ion in crossed gradient electric and magnetic fields
Indian Academy of Sciences (India)
Photodetachment cross-section for variousexternal fields and the laser polarization are calculated and displayed. A comparison with the photodetachment cross-section in crossed uniform electric and magnetic fields or in a single gradient electric field has been made.The agreement of our results with the above two special ...
Social Organization and Leadership in Cross-Cultural Psychology.
Chemers, Martin M.
There is little research by social psychologists in the areas of leadership and social organization, especially from a cross-cultural perspective, though such research offers an understanding of both leadership and culture. Existing cross-cultural management studies suffer from a lack of understanding of important social and cross-cultural…
Czech Academy of Sciences Publication Activity Database
Gouix, N.; Šebek, Pavel; Valladares, L.; Brustel, H.; Brin, A.
2015-01-01
Roč. 8, č. 5 (2015), s. 418-427 ISSN 1752-458X Grant - others:GA JU(CZ) 144/2010/100; European Social Fund(CZ) CZ.1.07/2.3.00/20.0064 Institutional support: RVO:60077344 Keywords : conservation management * Natura 200 * saproxylic Subject RIV: EH - Ecology, Behaviour Impact factor: 2.367, year: 2015 http://onlinelibrary.wiley.com/doi/10.1111/icad.12119/epdf
Cross-border reprogenetic services.
Couture, V; Drouin, R; Tan, S-L; Moutquin, J-M; Bouffard, C
2015-01-01
The purpose of this review is to synthesize the current knowledge on the international movement of patients and biopsied embryo cells for pre-implantation genetic diagnosis and its different applications. Thus far, few attempts have been made to identify the specific nature of this phenomenon called 'cross-border reprogenetic services'. There is scattered evidence, both empirical and speculative, suggesting that these services raise major issues in terms of service provision, risks for patients and the children-to-come, the legal liabilities of physicians, as well as social justice. To compile this evidence, this review uses the narrative overview protocol combined with thematic analysis. Five major themes have emerged from the literature at the conjunction of cross-border treatments and reprogenetics: 'scope', 'scale', 'motivations', 'concerns', and 'governance'. Similar themes have already been observed in the case of other medical tourism activities, but this review highlights their singularity with reprogenetic services. It emphasizes the diagnostic and autologous feature of reprogenetics, the constant risk of misdiagnosis, the restriction on certain tests for medically controversial conditions, and the uncertain accessibility of genetic counseling in cross-border settings. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Import/Export: Trafficking in Cross-Cultural Shakespearean Spaces
Directory of Open Access Journals (Sweden)
Desmet Christy
2017-09-01
Full Text Available This essay examines the phenomenon of cross-cultural Shakespearean “traffic” as an import/export “business” by analyzing the usefulness of the concept cross-cultural through a series of theoretical binaries: Global vs. Local Shakespeares, Glocal and Intercultural Shakespeare; and the very definition of space and place within the Shakespearean lexicon. The essay argues that theoretically, the opposition of global and local Shakespeares has a tendency to collapse, and both glocal and intercultural Shakespeares are the object of serious critique. However, the project of cross-cultural Shakespeare is sustained by the dialectic between memorialization and forgetting that attends all attempts to record these cross-cultural experiences. The meaning of cross-cultural Shakespeare lies in the interpreter’s agency.
Fission cross section measurements of actinides at LANSCE
Energy Technology Data Exchange (ETDEWEB)
Tovesson, Fredrik [Los Alamos National Laboratory; Laptev, Alexander B [Los Alamos National Laboratory; Hill, Tony S [INL
2010-01-01
Fission cross sections of a range of actinides have been measured at the Los Alamos Neutron Science Center (LANSCE) in support of nuclear energy applications. By combining measurement at two LANSCE facilities, Lujan Center and the Weapons Neutron Research center (WNR), differential cross sections can be measured from sub-thermal energies up to 200 MeV. Incident neutron energies are determined using the time-of-flight method, and parallel-plate ionization chambers are used to measure fission cross sections relative to the {sup 235}U standard. Recent measurements include the {sup 233,238}U, {sup 239,242}Pu and {sup 243}Am neutron-induced fission cross sections. In this paper preliminary results for cross section data of {sup 243}Am and {sup 233}U will be presented.
CANFLEX fuel bundle cross-flow endurance test (test report)
International Nuclear Information System (INIS)
Hong, Sung Deok; Chung, C. H.; Chang, S. K.; Kim, B. D.
1997-04-01
As part of the normal refuelling sequence of CANDU nuclear reactor, both new and irradiated bundles can be parked in the cross-flow region of the liner tubes. This situation occurs normally for a few minutes. The fuel bundle which is subjected to the cross-flow should be capable of withstanding the consequences of cross flow for normal periods, and maintain its mechanical integrity. The cross-flow endurance test was conducted for CANFLEX bundle, latest developed nuclear fuel, at CANDU-Hot Test Loop. The test was carried out during 4 hours at the inlet cross-flow region. After the test, the bundle successfully met all acceptance criteria after the 4 hours cross-flow test. (author). 2 refs., 3 tabs
CANFLEX fuel bundle cross-flow endurance test (test report)
Energy Technology Data Exchange (ETDEWEB)
Hong, Sung Deok; Chung, C. H.; Chang, S. K.; Kim, B. D.
1997-04-01
As part of the normal refuelling sequence of CANDU nuclear reactor, both new and irradiated bundles can be parked in the cross-flow region of the liner tubes. This situation occurs normally for a few minutes. The fuel bundle which is subjected to the cross-flow should be capable of withstanding the consequences of cross flow for normal periods, and maintain its mechanical integrity. The cross-flow endurance test was conducted for CANFLEX bundle, latest developed nuclear fuel, at CANDU-Hot Test Loop. The test was carried out during 4 hours at the inlet cross-flow region. After the test, the bundle successfully met all acceptance criteria after the 4 hours cross-flow test. (author). 2 refs., 3 tabs.
Crossed-Slot Cavity-Backed Antenna with Improved Hemispherical Coverage
DEFF Research Database (Denmark)
Kim, Oleksiy S.; Breinbjerg, Olav; Østergaard, Allan
2005-01-01
The paper presents the results of the investigation of the crossed-slot cavity-backed antenna with the complementary crossed electric dipoles added to compensate the circularly polarized (CP) radiation pattern degradation near the horizon. Dependences of the radiation characteristics...... of the modified crossed-slot cavity-backed antenna on the length, width and height of the crossed electric dipoles are shown. Effects of a finite size ground plane are taken into account due to a full wave electromagnetic analysis software utilized in the parametrical investigations. Simulated and measured...... results for a selected antenna configuration prove that the properly adjusted crossed electric dipoles are able to improve the coverage and CP polarization characteristics of the crossed-slot cavity-backed antenna....
Encouraging emergence of cross-business strategic initiatives
Canales, J. Ignacio; Caldart, Adrián
2017-01-01
We explore how strategic initiatives emerge at the business unit level in the context of multi-business firms. Findings show that such initiatives create cross-business synergies in the absence of any direct intervention from the headquarters. Four factors appeared to foster the development of autonomous cross-business collaboration: a sense of urgency at the level of the firm, the existence of a few broad but strong corporate strategic guidelines, the existence of a set of cross-business int...
Pharmaceutical product cross-contamination: industrial and clinical ...
African Journals Online (AJOL)
problems. Pharmaceutical product cross-contamination is a serious problem which has been detected as an obstacle ... In the pharmaceutical care of patients in developed countries, cross-contamination ..... neonatal intensive care units.
CBP Customs Rulings Online Search System (CROSS)
Department of Homeland Security — CROSS is a searchable database of CBP rulings that can be retrieved based on simple or complex search characteristics using keywords and Boolean operators. CROSS has...
The Propositional vs. Hermeneutic Models of Cross-Cultural ...
African Journals Online (AJOL)
What the authors attempts to address in this paper is a Kantian question: not whether, but how is cross-cultural understanding possible? And specifically, what is a more effective approach for cross-cultural understanding? The answer lies in an analysis of two different models of cross-cultural understanding, that is, ...
Curriculum Integration and Cross-Cultural Psychology.
Goldstein, Susan B.
While many undergraduate disciplines are revising curricula to address issues of diversity more effectively, it is commonly assumed that courses in cross-cultural psychology are less in need of revision due to their inherent multi-cultural focus. The field of cross-cultural psychology, however, is not immune to Eurocentric and androcentric biases.…
An Evolutionary Formulation of the Crossing Number Problem
Directory of Open Access Journals (Sweden)
Che Sheng Gan
2009-01-01
Full Text Available A graph drawing algorithm is presented which results in complete graphs having minimum crossings equal to that of Guy's conjecture. It is then generalized and formulated in an evolutionary algorithm (EA to perform constrained search for the crossing numbers. The main objective of this work is to present a suitable two-dimensional scheme which can greatly reduce the complexity of finding crossing numbers by using computer. Program performance criteria are presented and discussed. It is shown that the EA implementation provides good confirmation of the predicted crossing numbers.
Measuring cross-border regional integration with composite indicators
DEFF Research Database (Denmark)
Makkonen, Teemu
2016-01-01
Earlier quantitative studies on cross-border regional integration processes have commonly neglected science, technology and innovation (STI) indicators: even the most notable example of a composite indicator approach to measuring cross-border regional integration, i.e. the Oresund index, lacks...... a sub-category for STI. Consequently, by ignoring cross-border innovation and knowledge flows, the Oresund integration index fails to take into account one of the most important drivers of economic growth in cross-border regions. Therefore, a new composite STI indicator (sub-category) was introduced......-border regions....
Methodology series module 3: Cross-sectional studies
Directory of Open Access Journals (Sweden)
Maninder Singh Setia
2016-01-01
Full Text Available Cross-sectional study design is a type of observational study design. In a cross-sectional study, the investigator measures the outcome and the exposures in the study participants at the same time. Unlike in case–control studies (participants selected based on the outcome status or cohort studies (participants selected based on the exposure status, the participants in a cross-sectional study are just selected based on the inclusion and exclusion criteria set for the study. Once the participants have been selected for the study, the investigator follows the study to assess the exposure and the outcomes. Cross-sectional designs are used for population-based surveys and to assess the prevalence of diseases in clinic-based samples. These studies can usually be conducted relatively faster and are inexpensive. They may be conducted either before planning a cohort study or a baseline in a cohort study. These types of designs will give us information about the prevalence of outcomes or exposures; this information will be useful for designing the cohort study. However, since this is a 1-time measurement of exposure and outcome, it is difficult to derive causal relationships from cross-sectional analysis. We can estimate the prevalence of disease in cross-sectional studies. Furthermore, we will also be able to estimate the odds ratios to study the association between exposure and the outcomes in this design.
Methodology Series Module 3: Cross-sectional Studies.
Setia, Maninder Singh
2016-01-01
Cross-sectional study design is a type of observational study design. In a cross-sectional study, the investigator measures the outcome and the exposures in the study participants at the same time. Unlike in case-control studies (participants selected based on the outcome status) or cohort studies (participants selected based on the exposure status), the participants in a cross-sectional study are just selected based on the inclusion and exclusion criteria set for the study. Once the participants have been selected for the study, the investigator follows the study to assess the exposure and the outcomes. Cross-sectional designs are used for population-based surveys and to assess the prevalence of diseases in clinic-based samples. These studies can usually be conducted relatively faster and are inexpensive. They may be conducted either before planning a cohort study or a baseline in a cohort study. These types of designs will give us information about the prevalence of outcomes or exposures; this information will be useful for designing the cohort study. However, since this is a 1-time measurement of exposure and outcome, it is difficult to derive causal relationships from cross-sectional analysis. We can estimate the prevalence of disease in cross-sectional studies. Furthermore, we will also be able to estimate the odds ratios to study the association between exposure and the outcomes in this design.
The cross-country implications of alternative climate policies
International Nuclear Information System (INIS)
Li, Aijun; Du, Nan; Wei, Qian
2014-01-01
Because of worldwide growing concerns about global climate change, great interest has been expressed in the potential of alternative climate policies to reduce global carbon emissions. In this paper, we compare cross-country implications of alternative climate policies, including unilateral and multilateral climate policies. Our main findings are as follows. Firstly, there are large differences in cross-country effects of alternative unilateral climate policies, when the same given carbon emission reductions are achieved in each abating country respectively. Meanwhile, cross-border externalities undermine efficiency of unilateral climate policies. Secondly, there are significant differences in cross-country implications of alternative multilateral climate policies, when the same global emission reductions are allocated in several different ways among abating countries. Thirdly, it is difficult to reach a stable global climate treaty, since any abating country has the incentive to argue for small carbon emission reductions. Finally, multilateral climate policies can reduce the negative impacts of cross-border externalities, but cannot cure all cross-border externalities. Looking ahead, it will be a great policy challenge for the world to reduce carbon emissions in a cost-effective way. - highlights: • We compare impacts of unilateral climate policies across countries. • We compare effects of alternative multilateral climate policies. • We explore whether cross-border externalities disappear under multilateral climate policies
Statistical tests for power-law cross-correlated processes
Podobnik, Boris; Jiang, Zhi-Qiang; Zhou, Wei-Xing; Stanley, H. Eugene
2011-12-01
For stationary time series, the cross-covariance and the cross-correlation as functions of time lag n serve to quantify the similarity of two time series. The latter measure is also used to assess whether the cross-correlations are statistically significant. For nonstationary time series, the analogous measures are detrended cross-correlations analysis (DCCA) and the recently proposed detrended cross-correlation coefficient, ρDCCA(T,n), where T is the total length of the time series and n the window size. For ρDCCA(T,n), we numerically calculated the Cauchy inequality -1≤ρDCCA(T,n)≤1. Here we derive -1≤ρDCCA(T,n)≤1 for a standard variance-covariance approach and for a detrending approach. For overlapping windows, we find the range of ρDCCA within which the cross-correlations become statistically significant. For overlapping windows we numerically determine—and for nonoverlapping windows we derive—that the standard deviation of ρDCCA(T,n) tends with increasing T to 1/T. Using ρDCCA(T,n) we show that the Chinese financial market's tendency to follow the U.S. market is extremely weak. We also propose an additional statistical test that can be used to quantify the existence of cross-correlations between two power-law correlated time series.
8 CFR 1212.6 - Border crossing identification cards.
2010-01-01
... combined B-1/B-2 visitor visa and non-biometric border crossing identification card or (a similar stamp in... non-biometric border crossing identification card (or similar stamp in a passport), issued by the DOS... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Border crossing identification cards. 1212...
Cross Sections for Inner-Shell Ionization by Electron Impact
Energy Technology Data Exchange (ETDEWEB)
Llovet, Xavier, E-mail: xavier@ccit.ub.edu [Centres Científics i Tecnològics, Universitat de Barcelona, Lluís Solé i Sabarís 1-3, 08028 Barcelona (Spain); Powell, Cedric J. [Materials Measurement Science Division, National Institute of Standards and Technology, Gaithersburg, Maryland 20899-8370 (United States); Salvat, Francesc [Facultat de Física (ECM and ICC), Universitat de Barcelona, Diagonal 645, 08028 Barcelona (Spain); Jablonski, Aleksander [Institute of Physical Chemistry, Polish Academy of Sciences, ul. Kasprzaka 44/52, 01-224 Warsaw (Poland)
2014-03-15
An analysis is presented of measured and calculated cross sections for inner-shell ionization by electron impact. We describe the essentials of classical and semiclassical models and of quantum approximations for computing ionization cross sections. The emphasis is on the recent formulation of the distorted-wave Born approximation by Bote and Salvat [Phys. Rev. A 77, 042701 (2008)] that has been used to generate an extensive database of cross sections for the ionization of the K shell and the L and M subshells of all elements from hydrogen to einsteinium (Z = 1 to Z = 99) by electrons and positrons with kinetic energies up to 1 GeV. We describe a systematic method for evaluating cross sections for emission of x rays and Auger electrons based on atomic transition probabilities from the Evaluated Atomic Data Library of Perkins et al. [Lawrence Livermore National Laboratory, UCRL-ID-50400, 1991]. We made an extensive comparison of measured K-shell, L-subshell, and M-subshell ionization cross sections and of Lα x-ray production cross sections with the corresponding calculated cross sections. We identified elements for which there were at least three (for K shells) or two (for L and M subshells) mutually consistent sets of cross-section measurements and for which the cross sections varied with energy as expected by theory. The overall average root-mean-square deviation between the measured and calculated cross sections was 10.9% and the overall average deviation was −2.5%. This degree of agreement between measured and calculated ionization and x-ray production cross sections was considered to be very satisfactory given the difficulties of these measurements.
Daniel Tudor
2014-01-01
This paper analyzes two special cases of C* -algebras, the cases of universal crossed product and reduced crossed product of a group by a C* -algebra. In the hypothesis that the universal crossed product is a continuous trace C* -algebra or a type I C* -algebra, it is proved that the reduced crossed product is a continuous trace C* -algebra or, respectively, a type I C* -algebra. Moreover, these results can be extended in the case when the crossed products are obtained from a groupoid an...
Shell-crossing in quasi-one-dimensional flow
Rampf, Cornelius; Frisch, Uriel
2017-10-01
Blow-up of solutions for the cosmological fluid equations, often dubbed shell-crossing or orbit crossing, denotes the breakdown of the single-stream regime of the cold-dark-matter fluid. At this instant, the velocity becomes multi-valued and the density singular. Shell-crossing is well understood in one dimension (1D), but not in higher dimensions. This paper is about quasi-one-dimensional (Q1D) flow that depends on all three coordinates but differs only slightly from a strictly 1D flow, thereby allowing a perturbative treatment of shell-crossing using the Euler-Poisson equations written in Lagrangian coordinates. The signature of shell-crossing is then just the vanishing of the Jacobian of the Lagrangian map, a regular perturbation problem. In essence, the problem of the first shell-crossing, which is highly singular in Eulerian coordinates, has been desingularized by switching to Lagrangian coordinates, and can then be handled by perturbation theory. Here, all-order recursion relations are obtained for the time-Taylor coefficients of the displacement field, and it is shown that the Taylor series has an infinite radius of convergence. This allows the determination of the time and location of the first shell-crossing, which is generically shown to be taking place earlier than for the unperturbed 1D flow. The time variable used for these statements is not the cosmic time t but the linear growth time τ ˜ t2/3. For simplicity, calculations are restricted to an Einstein-de Sitter universe in the Newtonian approximation, and tailored initial data are used. However it is straightforward to relax these limitations, if needed.
Crossed Wernicke's Aphasia: A Case Report
Sheehy, Laurie M.; Haines, Mary E.
2004-01-01
Crossed aphasia is a phenomenon in which an individual sustains a lesion in the right hemisphere (typically non-language dominant), but who exhibits an aphasic syndrome. The authors present a case study of an individual with crossed aphasia (CA) in an attempt to provide anecdotal information for four questions posed by Pita, Karavelis, and…
ENDF/B-5 fission product cross section evaluations
International Nuclear Information System (INIS)
Schenter, R.E.; England, T.R.
1979-12-01
Cross section evaluations were made for the 196 fission product nuclides on the ENDF/B-5 data files. Most of the evaluations involve updating the capture cross sections of the important absorbers for fast and thermal reactor systems. This included updating thermal values, resonance integrals, resonance parameter sets, and fast capture cross sections. For the fast capture results generalized least-squares calculations were made with the computer code FERRET. Input for these cross section adjustments included nuclear models calculations and both integral and differential experimental data results. The differential cross sections and their uncertainties were obtained from the CSIRS library. Integral measurement results came from CFRMF and STEK Assemblies 500, 1000, 2000, 3000, 4000. Comparisons of these evaluations with recent capture measurements are shown. 15 figures, 10 tables
Nuclear fission and neutron-induced fission cross-sections
Energy Technology Data Exchange (ETDEWEB)
James, G.D.; Lynn, J.E.; Michaudon, A.; Rowlands, J.; de Saussure, G.
1981-01-01
A general presentation of current knowledge of the fission process is given with emphasis on the low energy fission of actinide nuclei and neutron induced fission. The need for and the required accuracy of fission cross section data in nuclear energy programs are discussed. A summary is given of the steps involved in fission cross section measurement and the range of available techniques. Methods of fission detection are described with emphasis on energy dependent changed and detector efficiency. Examples of cross section measurements are given and data reduction is discussed. The calculation of fission cross sections is discussed and relevant nuclear theory including the formation and decay of compound nuclei and energy level density is introduced. A description of a practical computation of fission cross sections is given.
Current status of accelerated corneal cross-linking
Directory of Open Access Journals (Sweden)
Michael Mrochen
2013-01-01
Full Text Available Corneal cross-linking with riboflavin is a technique to stabilize or reduce corneal ectasia, in diseases such as keratoconus and post-laser-assisted in situ keratomileusis (LASIK ectasia. There is an interest by patient as well as clinicians to reduce the overall treatment time. Especially, the introduction of corneal cross-linking in combination with corneal laser surgery demands a shorter treatment time to assure a sufficient patient flow. The principles and techniques of accelerated corneal cross-linking is discussed.
Evaluation of fusion-evaporation cross-section calculations
Blank, B.; Canchel, G.; Seis, F.; Delahaye, P.
2018-02-01
Calculated fusion-evaporation cross sections from five different codes are compared to experimental data. The present comparison extents over a large range of nuclei and isotopic chains to investigate the evolution of experimental and calculated cross sections. All models more or less overestimate the experimental cross sections. We found reasonable agreement by using the geometrical average of the five model calculations and dividing the average by a factor of 11.2. More refined analyses are made for example for the 100Sn region.
Cross-linked structure of network evolution
International Nuclear Information System (INIS)
Bassett, Danielle S.; Wymbs, Nicholas F.; Grafton, Scott T.; Porter, Mason A.; Mucha, Peter J.
2014-01-01
We study the temporal co-variation of network co-evolution via the cross-link structure of networks, for which we take advantage of the formalism of hypergraphs to map cross-link structures back to network nodes. We investigate two sets of temporal network data in detail. In a network of coupled nonlinear oscillators, hyperedges that consist of network edges with temporally co-varying weights uncover the driving co-evolution patterns of edge weight dynamics both within and between oscillator communities. In the human brain, networks that represent temporal changes in brain activity during learning exhibit early co-evolution that then settles down with practice. Subsequent decreases in hyperedge size are consistent with emergence of an autonomous subgraph whose dynamics no longer depends on other parts of the network. Our results on real and synthetic networks give a poignant demonstration of the ability of cross-link structure to uncover unexpected co-evolution attributes in both real and synthetic dynamical systems. This, in turn, illustrates the utility of analyzing cross-links for investigating the structure of temporal networks
Cross-linked structure of network evolution
Energy Technology Data Exchange (ETDEWEB)
Bassett, Danielle S., E-mail: dsb@seas.upenn.edu [Department of Bioengineering, University of Pennsylvania, Philadelphia, Pennsylvania 19104 (United States); Department of Physics, University of California, Santa Barbara, California 93106 (United States); Sage Center for the Study of the Mind, University of California, Santa Barbara, California 93106 (United States); Wymbs, Nicholas F.; Grafton, Scott T. [Department of Psychology and UCSB Brain Imaging Center, University of California, Santa Barbara, California 93106 (United States); Porter, Mason A. [Oxford Centre for Industrial and Applied Mathematics, Mathematical Institute, University of Oxford, Oxford OX2 6GG (United Kingdom); CABDyN Complexity Centre, University of Oxford, Oxford, OX1 1HP (United Kingdom); Mucha, Peter J. [Carolina Center for Interdisciplinary Applied Mathematics, Department of Mathematics, University of North Carolina, Chapel Hill, North Carolina 27599 (United States); Department of Applied Physical Sciences, University of North Carolina, Chapel Hill, North Carolina 27599 (United States)
2014-03-15
We study the temporal co-variation of network co-evolution via the cross-link structure of networks, for which we take advantage of the formalism of hypergraphs to map cross-link structures back to network nodes. We investigate two sets of temporal network data in detail. In a network of coupled nonlinear oscillators, hyperedges that consist of network edges with temporally co-varying weights uncover the driving co-evolution patterns of edge weight dynamics both within and between oscillator communities. In the human brain, networks that represent temporal changes in brain activity during learning exhibit early co-evolution that then settles down with practice. Subsequent decreases in hyperedge size are consistent with emergence of an autonomous subgraph whose dynamics no longer depends on other parts of the network. Our results on real and synthetic networks give a poignant demonstration of the ability of cross-link structure to uncover unexpected co-evolution attributes in both real and synthetic dynamical systems. This, in turn, illustrates the utility of analyzing cross-links for investigating the structure of temporal networks.
DEFF Research Database (Denmark)
Würtz Jessen, Søren; Linnet, Andreas; Tscherning, Rasmus Wiinstedt
2013-01-01
The aim of this handbook is to help improve your opportunities for getting started on innovative and business development projects that reach beyond your own sector, commonly known as ’Cross-sector innovation’, or ’Cross innovation’ for short. We believe that there is a need for an easily read...... innovation handbook that can reach out to all sectors and potential partners whose point of departure, language use and understanding of customers is often very different to that of businesses. These differences constitute a resource for business development. If exploited they can lead to new ways of doing...... things and help us breakaway from the lull of the modes of expression and methods ‘customarily’ employed in business development. The handbook focuses on the interaction of “traditional’ businesses and sectors that belong to those known as the creative and the experience industries, i.e. designers...
Exel's crossed product and crossed products by completely positive maps
DEFF Research Database (Denmark)
Kwaśniewski, Bartosz Kosma
2017-01-01
construction we extend a result of Brownlowe, Raeburn and Vittadello, by showing that the C∗-algebra of an arbitrary infinite graph E can be realized as a crossed product of the diagonal algebra DE by a 'Perron-Frobenius' operator L. The important difference to the previous result is that in general...
Cross-border regional innovation system integration
DEFF Research Database (Denmark)
Makkonen, Teemu; Weidenfeld, Adi; Williams, Allan
2017-01-01
The importance of inter-regional cooperation and innovation are widely accepted in the development rhetoric of the European Union. The highlighted importance of both themes in the context of borderlands has recently led to the coining of a new concept, cross-border regional innovation system...... of cross-border cooperation in a regional innovation system setting. The framework was further tested with illustrative empirical cases that demonstrate its feasibility........ However, little attention has been given to the empirical analysis of the concept. This paper suggests a framework for empirically validating the concept by examining the levels of integration between cross-border regions. The outcome is a proposed framework can be operationalized by measurable indicators...
Total cross sections for electron scattering by He
International Nuclear Information System (INIS)
De Heer, F.J.; Jansen, R.H.J.
1977-01-01
A set of total cross sections for scattering of electrons by He has been evaluated over the energy range of zero to 3000 eV by means of the analysis of experiments and theories on total cross sections for elastic scattering, ionisation and excitation, and on differential cross sections for elastic and inelastic scattering. Between 0 and 19.8 eV, where no inelastic processes occur, the total cross sections for scattering are equal to those for elastic scattering. Above 19.8 eV total cross sections for scattering of electrons have been evaluated by adding those for ionisation, excitation and elastic scattering. The total cross sections thus obtained are probably accurate to about 5% over a large part of the energy range. They appear to be in very good agreement with the recent experimental results of Blaauw et al. (J. Phys. B.; 10:L299 (1977)). The present results have already proved useful for application in the dispersion relation for forward scattering in electron-helium collisions. (author)
Shaped articles of cross-linked fluorocarbon polymers
International Nuclear Information System (INIS)
Gotcher, A.J.; Germeraad, P.B.
1981-01-01
A process is described which comprises (1) contacting (a) a shaped article of a polymeric composition wherein the polymer is a fluorocarbon polymer having a melting point of at least 200 0 C, the article having a tensile strength of at least 3,000 psi, with (b) a fluid composition comprising a cross-linking agent, until the article contains at least 2.5% by weight of the cross-linking agent; and (2) irradiating the shaped article with ionising radiation to a dosage not exceeding 50 Mrads under conditions such that the composition is cross-linked sufficiently to impart thereto an M 100 value of at least 300 psi, while maintaining a tensile strength of at least 3000 psi, the shaped article containing a specified proportion of the cross-linking agent. (author)
Charged Triazole Cross-Linkers for Hyaluronan-Based Hybrid Hydrogels
Directory of Open Access Journals (Sweden)
Maike Martini
2016-09-01
Full Text Available Polyelectrolyte hydrogels play an important role in tissue engineering and can be produced from natural polymers, such as the glycosaminoglycan hyaluronan. In order to control charge density and mechanical properties of hyaluronan-based hydrogels, we developed cross-linkers with a neutral or positively charged triazole core with different lengths of spacer arms and two terminal maleimide groups. These cross-linkers react with thiolated hyaluronan in a fast, stoichiometric thio-Michael addition. Introducing a positive charge on the core of the cross-linker enabled us to compare hydrogels with the same interconnectivity, but a different charge density. Positively charged cross-linkers form stiffer hydrogels relatively independent of the size of the cross-linker, whereas neutral cross-linkers only form stable hydrogels at small spacer lengths. These novel cross-linkers provide a platform to tune the hydrogel network charge and thus the mechanical properties of the network. In addition, they might offer a wide range of applications especially in bioprinting for precise design of hydrogels.
Total and ionization cross sections of electron scattering by fluorocarbons
International Nuclear Information System (INIS)
Antony, B K; Joshipura, K N; Mason, N J
2005-01-01
Electron impact total cross sections (50-2000 eV) and total ionization cross sections (threshold to 2000 eV) are calculated for typical plasma etching molecules CF 4 , C 2 F 4 , C 2 F 6 , C 3 F 8 and CF 3 I and the CF x (x 1-3) radicals. The total elastic and inelastic cross sections are determined in the spherical complex potential formalism. The sum of the two gives the total cross section and the total inelastic cross section is used to calculate the total ionization cross sections. The present total and ionization cross sections are found to be consistent with other theories and experimental measurements, where they exist. Our total cross section results for CF x (x = 1-3) radicals presented here are first estimates on these species
Accurate Cross Sections for Microanalysis
Rez, Peter
2002-01-01
To calculate the intensity of x-ray emission in electron beam microanalysis requires a knowledge of the energy distribution of the electrons in the solid, the energy variation of the ionization cross section of the relevant subshell, the fraction of ionizations events producing x rays of interest and the absorption coefficient of the x rays on the path to the detector. The theoretical predictions and experimental data available for ionization cross sections are limited mainly to K shells of a...
Tables of RCN-2 fission-product cross section evaluation
International Nuclear Information System (INIS)
Gruppelaar, H.
1979-05-01
This report (continuation of ECN-13 and ECN-33) describes the third part of the RCN-2 evaluation of neutron cross sections for fission product nuclides in KEDAK format. It contains evaluated data for nine nuclides, i.e. 142 Nd, 143 Nd, 144 Nd, 145 Nd, 146 Nd, 147 Nd, 148 Nd, 150 Nd and 147 Pm. Most emphasis has been given to the evaluation of the radiative capture cross section, in order to provide a data base for adjustment calculations using results of integral measurements. Short evaluation reports are given for this cross section. The evaluated capture cross sections are compared with recent experimental differential and integral data. Graphs are given of the capture cross sections at neutron energies above 1 keV, in which also adjusted point cross sections, based upon integral STEK and CFRMF data have been plotted. Moreover, the results are compared with those of the well-known ENDF/B-IV evaluation for fission product nucleides. Finally, evaluation summaries are given, which include tables of other important neutron cross sections, such as the total, elastic scattering and inelastic scattering cross sections
Compilation of cross-sections. Pt. 1
International Nuclear Information System (INIS)
Flaminio, V.; Moorhead, W.G.; Morrison, D.R.O.; Rivoire, N.
1983-01-01
A compilation of integral cross-sections for hadronic reactions is presented. This is an updated version of CERN/HERA 79-1, 79-2, 79-3. It contains all data published up to the beginning of 1982, but some more recent data have also been included. Plots of the cross-sections versus incident laboratory momentum are also given. (orig.)
Compilation of cross-sections. Pt. 4
International Nuclear Information System (INIS)
Alekhin, S.I.; Ezhela, V.V.; Lugovsky, S.B.; Tolstenkov, A.N.; Yushchenko, O.P.; Baldini, A.; Cobal, M.; Flaminio, V.; Capiluppi, P.; Giacomelli, G.; Mandrioli, G.; Rossi, A.M.; Serra, P.; Moorhead, W.G.; Morrison, D.R.O.; Rivoire, N.
1987-01-01
This is the fourth volume in our series of data compilations on integrated cross-sections for weak, electromagnetic, and strong interaction processes. This volume covers data on reactions induced by photons, neutrinos, hyperons, and K L 0 . It contains all data published up to June 1986. Plots of the cross-sections versus incident laboratory momentum are also given. (orig.)
Volume conduction effects on wavelet cross-bicoherence analysis
International Nuclear Information System (INIS)
Memon, I.A.; Channa, C.
2013-01-01
Cross-bicoherence analysis is one of the important nonlinear signal processing tools which is used to measure quadratic phase coupling between frequencies of two different time series. It is frequently used in the diagnosis of various cognitive and neurological disorders in EEG (Electroencephalography) analysis. Volume conduction effects of various uncorrelated sources present in the brain can produce biased estimates into the estimated values of cross-bicoherence function. Previous studies have discussed volume conduction effects on coherence function which is used to measure linear relationship between EEG signals in terms of their phase and amplitude. However, volume conduction effect on cross-bicoherence analysis which is quite a different technique has not been investigated up to now to the best of our knowledge. This study is divided into two major parts, the first part deals with the investigation of VCUS (Volume Conduction effects due to Uncorrelated Sources) characteristics on EEG-cross-bicoherence analysis. The simulated EEG data due to uncorrelated sources present in the brain was used in this part of study. The next part of study is based upon investigating the effects of VCUS on the statistical analysis of results of EEG-based cross-bicoherence analysis. The study provides an important clinical application because most of studies based on EEG cross-bicoherence analysis have avoided the issue of VCUS. The cross-bicoherence analysis was performed by detecting the change in MSCB (Magnitude Square Cross-Bicoherence Function) between EEG activities of change detection and no-change detection trials. The real EEG signals were used. (author)
CrossFit Overview: Systematic Review and Meta-analysis.
Claudino, João Gustavo; Gabbett, Tim J; Bourgeois, Frank; Souza, Helton de Sá; Miranda, Rafael Chagas; Mezêncio, Bruno; Soncin, Rafael; Cardoso Filho, Carlos Alberto; Bottaro, Martim; Hernandez, Arnaldo Jose; Amadio, Alberto Carlos; Serrão, Julio Cerca
2018-02-26
CrossFit is recognized as one of the fastest growing high-intensity functional training modes in the world. However, scientific data regarding the practice of CrossFit is sparse. Therefore, the objective of this study is to analyze the findings of scientific literature related to CrossFit via systematic review and meta-analysis. Systematic searches of the PubMed, Web of Science, Scopus, Bireme/MedLine, and SciELO online databases were conducted for articles reporting the effects of CrossFit training. The systematic review followed the PRISMA guidelines. The Oxford Levels of Evidence was used for all included articles, and only studies that investigated the effects of CrossFit as a training program were included in the meta-analysis. For the meta-analysis, effect sizes (ESs) with 95% confidence interval (CI) were calculated and heterogeneity was assessed using a random-effects model. Thirty-one articles were included in the systematic review and four were included in the meta-analysis. However, only two studies had a high level of evidence at low risk of bias. Scientific literature related to CrossFit has reported on body composition, psycho-physiological parameters, musculoskeletal injury risk, life and health aspects, and psycho-social behavior. In the meta-analysis, significant results were not found for any variables. The current scientific literature related to CrossFit has few studies with high level of evidence at low risk of bias. However, preliminary data has suggested that CrossFit practice is associated with higher levels of sense of community, satisfaction, and motivation.
Low Energy Neutrino Cross Sections
International Nuclear Information System (INIS)
Zeller, G.P.
2004-01-01
Present atmospheric and accelerator based neutrino oscillation experiments operate at low neutrino energies (Ev ∼ 1 GeV) to access the relevant regions of oscillation parameter space. As such, they require precise knowledge of the cross sections for neutrino-nucleon interactions in the sub-to-few GeV range. At these energies, neutrinos predominantly interact via quasi-elastic (QE) or single pion production processes, which historically have not been as well studied as the deep inelastic scattering reactions that dominate at higher energies.Data on low energy neutrino cross sections come mainly from bubble chamber, spark chamber, and emulsion experiments that collected their data decades ago. Despite relatively poor statistics and large neutrino flux uncertainties, these measurements provide an important and necessary constraint on Monte Carlo models in present use. The following sections discuss the current status of QE, resonant single pion, coherent pion, and single kaon production cross section measurements at low energy
A tandem cross-metathesis/semipinacol rearrangement reaction.
Plummer, Christopher W; Soheili, Arash; Leighton, James L
2012-05-18
An efficient and (E)-selective synthesis of a 6-alkylidenebicyclo[3.2.1]octan-8-one has been developed. The key step is a tandem cross-metathesis/semipinacol rearrangement reaction, wherein the Hoveyda-Grubbs II catalyst, or more likely a derivative thereof, serves as the Lewis acid for the rearrangement. Despite the fact that both the starting alkene and the cross-metathesis product are viable rearrangement substrates, only the latter rearranges, suggesting that the Lewis acidic species is generated only after the cross-metathesis reaction is complete.
Global reinforcement training of CrossNets
Ma, Xiaolong
2007-10-01
Hybrid "CMOL" integrated circuits, incorporating advanced CMOS devices for neural cell bodies, nanowires as axons and dendrites, and latching switches as synapses, may be used for the hardware implementation of extremely dense (107 cells and 1012 synapses per cm2) neuromorphic networks, operating up to 10 6 times faster than their biological prototypes. We are exploring several "Cross- Net" architectures that accommodate the limitations imposed by CMOL hardware and should allow effective training of the networks without a direct external access to individual synapses. Our studies have show that CrossNets based on simple (two-terminal) crosspoint devices can work well in at least two modes: as Hop-field networks for associative memory and multilayer perceptrons for classification tasks. For more intelligent tasks (such as robot motion control or complex games), which do not have "examples" for supervised learning, more advanced training methods such as the global reinforcement learning are necessary. For application of global reinforcement training algorithms to CrossNets, we have extended Williams's REINFORCE learning principle to a more general framework and derived several learning rules that are more suitable for CrossNet hardware implementation. The results of numerical experiments have shown that these new learning rules can work well for both classification tasks and reinforcement tasks such as the cartpole balancing control problem. Some limitations imposed by the CMOL hardware need to be carefully addressed for the the successful application of in situ reinforcement training to CrossNets.
Fragmentation cross sections outside the limiting-fragmentation regime
Sümmerer, K
2003-01-01
The empirical parametrization of fragmentation cross sections, EPAX, has been successfully applied to estimate fragment production cross sections in reactions of heavy ions at high incident energies. It is checked whether a similar parametrization can be found for proton-induced spallation around 1 GeV, the range of interest for ISOL-type RIB facilities. The validity of EPAX for medium-energy heavy-ion induced reactions is also checked. Only a few datasets are available, but in general EPAX predicts the cross sections rather well, except for fragments close to the projectile, where the experimental cross sections are found to be larger.
Preparation of next generation set of group cross sections. 3
International Nuclear Information System (INIS)
Kaneko, Kunio
2002-03-01
This fiscal year, based on the examination result about the evaluation energy range of heavy element unresolved resonance cross sections, the upper energy limit of the energy range, where ultra-fine group cross sections are produced, was raised to 50 keV, and an improvement of the group cross section processing system was promoted. At the same time, reflecting the result of studies carried out till now, a function producing delayed neutron data was added to the general-purpose group cross section processing system , thus the preparation of general purpose group cross section processing system has been completed. On the other hand, the energy structure, data constitution and data contents of next generation group cross section set were determined, and the specification of a 151 groups next generation group cross section set was defined. Based on the above specification, a concrete library format of the next generation cross section set has been determined. After having carried out the above-described work, using the general-purpose group cross section processing system , which was complete in this study, with use of the JENDL-3. 2 evaluated nuclear data, the 151 groups next generation group cross section of 92 nuclides and the ultra fine group resonance cross section library for 29 nuclides have been prepared. Utilizing the 151 groups next generation group cross section set and the ultra-fine group resonance cross-section library, a bench mark test calculation of fast reactors has been performed by using an advanced lattice calculation code. It was confirmed, by comparing the calculation result with a calculation result of continuous energy Monte Carlo code, that the 151 groups next generation cross section set has sufficient accuracy. (author)
Koo Moon, Hyoung; Kwon Choi, Byoung; Shik Jung, Jae
2012-01-01
Although various antecedents of expatriates' cross-cultural adjustment have been addressed, previous international experience, predeparture cross-cultural training, and cultural intelligence (CQ) have been most frequently examined. However, there are few attempts that explore the effects of these antecedents simultaneously or consider the possible…
Cross-spectrum symbol synchronization
Mccallister, R. D.; Simon, M. K.
1981-01-01
A popular method of symbol synchronization exploits one aspect of generalized harmonic analysis, normally referred to as the cross-spectrum. Utilizing nonlinear techniques, the input symbol energy is effectively concentrated onto multiples of the symbol clock frequency, facilitating application of conventional phase lock synchronization techniques. A general treatment of the cross-spectrum technique is developed and shown to be applicable across a broad class of symbol modulation formats. An important specific symbol synchronization application is then treated, focusing the general development to provide both insight and quantitative measure of the performance impact associated with variation in these key synchronization parameters: symbol modulation format, symbol transition probability, symbol energy to noise density ratio, and symbol rate to filter bandwidth ratio.
Multifractal Detrended Cross-Correlation Analysis of agricultural futures markets
International Nuclear Information System (INIS)
He Lingyun; Chen Shupeng
2011-01-01
Highlights: → We investigated cross-correlations between China's and US agricultural futures markets. → Power-law cross-correlations are found between the geographically far but correlated markets. → Multifractal features are significant in all the markets. → Cross-correlation exponent is less than averaged GHE when q 0. - Abstract: We investigated geographically far but temporally correlated China's and US agricultural futures markets. We found that there exists a power-law cross-correlation between them, and that multifractal features are significant in all the markets. It is very interesting that the geographically far markets show strong cross-correlations and share much of their multifractal structure. Furthermore, we found that for all the agricultural futures markets in our studies, the cross-correlation exponent is less than the averaged generalized Hurst exponents (GHE) when q 0.
Calculation of atom displacement cross section for structure material
International Nuclear Information System (INIS)
Liu Ping; Xu Yiping
2015-01-01
The neutron radiation damage in material is an important consideration of the reactor design. The radiation damage of materials mainly comes from atom displacements of crystal structure materials. The reaction cross sections of charged particles, cross sections of displacements per atom (DPA) and KERMA are the basis of radiation damage calculation. In order to study the differences of DPA cross sections with different codes and different evaluated nuclear data libraries, the DPA cross sections for structure materials were calculated with UNF and NJOY codes, and the comparisons of results were given. The DPA cross sections from different evaluated nuclear data libraries were compared. And the comparison of DPA cross sections between NJOY and Monte Carlo codes was also done. The results show that the differences among these evaluated nuclear data libraries exist. (authors)
Target dependence of K+-nucleus total cross sections
International Nuclear Information System (INIS)
Jiang, M.F.; Ernst, D.J.; Chen, C.M.
1995-01-01
We investigate the total cross section and its target dependence for K + -nucleus scattering using a relativistic momentum-space optical potential model which incorporates relativistically normalized wave functions, invariant two-body amplitudes, covariant kinematics, and an exact full-Fermi averaging integral. The definition of the total cross section in the presence of a Coulomb interaction is reviewed and the total cross section is calculated in a way that is consistent with what is extracted from experiment. In addition, the total cross sections for a nucleus and for the deuteron are calculated utilizing the same theory. This minimizes the dependence of the ratio of these cross sections on the details of the theory. The model dependence of the first-order optical potential calculations is investigated. The theoretical results are found to be systematically below all existing data
Fatal accidents at railway level crossings in Great Britain 1946-2009.
Evans, Andrew W
2011-09-01
This paper investigates fatal accidents and fatalities at level crossings in Great Britain over the 64-year period 1946-2009. The numbers of fatal accidents and fatalities per year fell by about 65% in the first half of that period, but since then have remained more or less constant at about 11 fatal accidents and 12 fatalities per year. At the same time other types of railway fatalities have fallen, so level crossings represent a growing proportion of the total. Nevertheless, Britain's level crossing safety performance remains good by international standards. The paper classifies level crossings into three types: railway-controlled, automatic, and passive. The safety performance of the three types of crossings has been very different. Railway-controlled crossings are the best-performing crossing type, with falling fatal accident rates. Automatic crossings have higher accident rates per crossing than railway controlled or passive crossings, and the accident rates have not decreased. Passive crossings are by far the most numerous, but many have low usage by road users. Their fatal accident rate has remained remarkably constant over the whole period at about 0.9 fatal accidents per 1000 crossings per year. A principal reason why fatal accidents and fatalities have not fallen in the second half of the period as they did in the first half is the increase in the number of automatic crossings, replacing the safer railway controlled crossings on some public roads. However, it does not follow that this replacement was a mistake, because automatic crossings have advantages over controlled crossings in reducing delays to road users and in not needing staff. Based on the trends for each type of crossing and for pedestrian and non-pedestrian accidents separately, in 2009 a mean of about 5% of fatal accidents were at railway controlled crossings, 52% were at automatic crossings, and 43% were at passive crossings. Fatalities had similar proportions. About 60% of fatalities were
Crossing seas and occurrence of rogue waves
Bitner-Gregersen, Elzbieta; Toffoli, Alessandro
2017-04-01
The study is addressing crossing wave systems which may lead to formation of rogue waves. Onorato et al. (2006, 2010) have shown using the Nonlinear Schr?dringer (NLS) equations that the modulational instability and rogue waves can be triggered by a peculiar form of directional sea state, where two identical, crossing, narrow-banded random wave systems interact with each other. Such results have been underpinned by numerical simulations of the Euler equations solved with a Higher Order Spectral Method (HOSM) and experimental observations (Toffoli et al., 2011). They substantiate a dependence of the angle between the mean directions of propagation of the two crossing wave systems, with a maximum rogue wave probability for angles of approximately 40 degrees. Such an unusual sea state of two almost identical wave systems (approximately the same significant wave height and mean frequency) with high steepness and different directions was observed during the accident to the cruise ship Louis Majesty (Cavaleri et al. 2012). Occurrence of wind sea and swell having almost the same spectral period and significant wave height and crossing at the angle 40o low and intermediate wave conditions. They have not been found in a location off coast of Australia and Nigeria. There are some indications that in the future climate we may expect an increase number of occurrence of rogue-prone crossing sea states in some ocean regions An adopted partitioning procedure of a wave spectrum will impact the results. References Bitner-Gregersen, E.M. and Toffoli, A., 2014. Probability of occurrence of rogue sea states and consequences for design of marine structures. Special Issue of Ocean Dynamics, ISSN 1616-7341, 64(10), DOI 10.1007/s10236-014-0753-2. Cavaleri, L., Bertotti, L., Torrisi, L. Bitner-Gregersen, E., Serio, M. and Onorato, M., 2012. Rogue Waves in Crossing Seas: The Louis Majesty accident. J. Geophysical Research, 117, C00J10, doi:10.1029/2012JC007923 Onorato, M., A. Osborne, A
A Pebble Bed Reactor cross section methodology
International Nuclear Information System (INIS)
Hudson, Nathanael H.; Ougouag, Abderrafi M.; Rahnema, Farzad; Gougar, Hans
2009-01-01
A method is presented for the evaluation of microscopic cross sections for the Pebble Bed Reactor (PBR) neutron diffusion computational models during convergence to an equilibrium (asymptotic) fuel cycle. This method considers the isotopics within a core spectral zone and the leakages from such a zone as they arise during reactor operation. The randomness of the spatial distribution of fuel grains within the fuel pebbles and that of the fuel and moderator pebbles within the core, the double heterogeneity of the fuel, and the indeterminate burnup of the spectral zones all pose a unique challenge for the computation of the local microscopic cross sections. As prior knowledge of the equilibrium composition and leakage is not available, it is necessary to repeatedly re-compute the group constants with updated zone information. A method is presented to account for local spectral zone composition and leakage effects without resorting to frequent spectrum code calls. Fine group data are pre-computed for a range of isotopic states. Microscopic cross sections and zone nuclide number densities are used to construct fine group macroscopic cross sections, which, together with fission spectra, flux modulation factors, and zone buckling, are used in the solution of the slowing down balance to generate a new or updated spectrum. The microscopic cross-sections are then re-collapsed with the new spectrum for the local spectral zone. This technique is named the Spectral History Correction (SHC) method. It is found that this method accurately recalculates local broad group microscopic cross sections. Significant improvement in the core eigenvalue, flux, and power peaking factor is observed when the local cross sections are corrected for the effects of the spectral zone composition and leakage in two-dimensional PBR test problems.
Acute Exercise and Oxidative Stress: CrossFit™ vs. Treadmill Bout
Directory of Open Access Journals (Sweden)
Kliszczewicz Brian
2015-09-01
Full Text Available CrossFit™, a popular high-intensity training modality, has been the subject of scrutiny, with concerns of elevated risk of injury and health. Despite these concerns empirical evidence regarding physiologic stresses including acute oxidative stress is lacking. Therefore, the purpose of this investigation was to examine the acute redox response to a CrossFit™ bout. Furthermore, these findings were compared to a high-intensity treadmill bout as a point of reference. Ten males 26.4 ± 2.7 yrs having three or more months of CrossFit™ experience participated in the present study. Blood plasma was collected at four time points: Pre-exercise (PRE, immediately-post-exercise (IPE, 1 hr-post (1-HP and 2 hr-post (2-HP, to examine oxidative damage and antioxidant capacity. Regarding plasma oxidative damage, CrossFit™ and Treadmill elicited a time-dependent increase of lipid peroxides 1-HP (CrossFit™=+143%,Treadmill=+115% and 2-HP (CrossFit™=+256%,Treadmill+167%. Protein Carbonyls were increased IPE in CF only (+5%, while a time-dependent decrease occurred 1-HP (CrossFit™=−16%,Treadmill=−8% and 2-HP (CF=−16%,TM=−1% compared to IPE. Regarding antioxidant capacity, Ferric Reducing Antioxidant Power also demonstrated a time-dependent increase within CrossFit™ and Treadmill: IPE (CrossFit™=+25%,Treadmill=+17%, 1-HP (CrossFit™=+26%,Treadmill=+4.8%, 2-HP (CrossFit™=+20%,Treadmill=+12%. Total Enzymatic Antioxidant Capacity showed a time-dependent decrease in IPE (CrossFit™= −10%,Treadmill=−12%, 1-HP (CrossFit™= −12%,Treadmill=−6%, 2-HP (CrossFit™= −7%,Treadmill=−11%. No trial-dependent differences were observed in any biomarker of oxidative stress. The CrossFit™ bout elicited an acute blood oxidative stress response comparable to a traditional bout of high-intensity treadmill running. Results also confirm that exercise intensity and the time course of exercise recovery influence oxidative responses.
Acute Exercise and Oxidative Stress: CrossFit™ vs. Treadmill Bout
Kliszczewicz, Brian; Quindry, C. John; Blessing, L. Daniel; Oliver, D. Gretchen; Esco, R. Michael; Taylor, J. Kyle
2015-01-01
CrossFit™, a popular high-intensity training modality, has been the subject of scrutiny, with concerns of elevated risk of injury and health. Despite these concerns empirical evidence regarding physiologic stresses including acute oxidative stress is lacking. Therefore, the purpose of this investigation was to examine the acute redox response to a CrossFit™ bout. Furthermore, these findings were compared to a high-intensity treadmill bout as a point of reference. Ten males 26.4 ± 2.7 yrs having three or more months of CrossFit™ experience participated in the present study. Blood plasma was collected at four time points: Pre-exercise (PRE), immediately-post-exercise (IPE), 1 hr-post (1-HP) and 2 hr-post (2-HP), to examine oxidative damage and antioxidant capacity. Regarding plasma oxidative damage, CrossFit™ and Treadmill elicited a time-dependent increase of lipid peroxides 1-HP (CrossFit™=+143%, Treadmill=+115%) and 2-HP (CrossFit™=+256%, Treadmill+167%). Protein Carbonyls were increased IPE in CF only (+5%), while a time-dependent decrease occurred 1-HP (CrossFit™=−16%, Treadmill=−8%) and 2-HP (CF=−16%, TM=−1%) compared to IPE. Regarding antioxidant capacity, Ferric Reducing Antioxidant Power also demonstrated a time-dependent increase within CrossFit™ and Treadmill: IPE (CrossFit™=+25%, Treadmill=+17%), 1-HP (CrossFit™=+26%, Treadmill=+4.8%), 2-HP (CrossFit™=+20%, Treadmill=+12%). Total Enzymatic Antioxidant Capacity showed a time-dependent decrease in IPE (CrossFit™=−10%, Treadmill=−12%), 1-HP (CrossFit™=−12%, Treadmill=−6%), 2-HP (CrossFit™=−7%, Treadmill=−11%). No trial-dependent differences were observed in any biomarker of oxidative stress. The CrossFit™ bout elicited an acute blood oxidative stress response comparable to a traditional bout of high-intensity treadmill running. Results also confirm that exercise intensity and the time course of exercise recovery influence oxidative responses. PMID:26557192
The crossed phrenic phenomenon
Ghali, Michael George Zaki
2017-01-01
The cervical spine is the most common site of traumatic vertebral column injuries. Respiratory insufficiency constitutes a significant proportion of the morbidity burden and is the most common cause of mortality in these patients. In seeking to enhance our capacity to treat specifically the respiratory dysfunction following spinal cord injury, investigators have studied the “crossed phrenic phenomenon”, wherein contraction of a hemidiaphragm paralyzed by a complete hemisection of the ipsilateral cervical spinal cord above the phrenic nucleus can be induced by respiratory stressors and recovers spontaneously over time. Strengthening of latent contralateral projections to the phrenic nucleus and sprouting of new descending axons have been proposed as mechanisms contributing to the observed recovery. We have recently demonstrated recovery of spontaneous crossed phrenic activity occurring over minutes to hours in C1-hemisected unanesthetized decerebrate rats. The specific neurochemical and molecular pathways underlying crossed phrenic activity following injury require further clarification. A thorough understanding of these is necessary in order to develop targeted therapies for respiratory neurorehabilitation following spinal trauma. Animal studies provide preliminary evidence for the utility of neuropharmacological manipulation of serotonergic and adenosinergic pathways, nerve grafts, olfactory ensheathing cells, intraspinal microstimulation and a possible role for dorsal rhizotomy in recovering phrenic activity following spinal cord injury PMID:28761411
The crossed phrenic phenomenon
Directory of Open Access Journals (Sweden)
Michael George Zaki Ghali
2017-01-01
Full Text Available The cervical spine is the most common site of traumatic vertebral column injuries. Respiratory insufficiency constitutes a significant proportion of the morbidity burden and is the most common cause of mortality in these patients. In seeking to enhance our capacity to treat specifically the respiratory dysfunction following spinal cord injury, investigators have studied the “crossed phrenic phenomenon”, wherein contraction of a hemidiaphragm paralyzed by a complete hemisection of the ipsilateral cervical spinal cord above the phrenic nucleus can be induced by respiratory stressors and recovers spontaneously over time. Strengthening of latent contralateral projections to the phrenic nucleus and sprouting of new descending axons have been proposed as mechanisms contributing to the observed recovery. We have recently demonstrated recovery of spontaneous crossed phrenic activity occurring over minutes to hours in C1-hemisected unanesthetized decerebrate rats. The specific neurochemical and molecular pathways underlying crossed phrenic activity following injury require further clarification. A thorough understanding of these is necessary in order to develop targeted therapies for respiratory neurorehabilitation following spinal trauma. Animal studies provide preliminary evidence for the utility of neuropharmacological manipulation of serotonergic and adenosinergic pathways, nerve grafts, olfactory ensheathing cells, intraspinal microstimulation and a possible role for dorsal rhizotomy in recovering phrenic activity following spinal cord injury
The crossed phrenic phenomenon.
Ghali, Michael George Zaki
2017-06-01
The cervical spine is the most common site of traumatic vertebral column injuries. Respiratory insufficiency constitutes a significant proportion of the morbidity burden and is the most common cause of mortality in these patients. In seeking to enhance our capacity to treat specifically the respiratory dysfunction following spinal cord injury, investigators have studied the "crossed phrenic phenomenon", wherein contraction of a hemidiaphragm paralyzed by a complete hemisection of the ipsilateral cervical spinal cord above the phrenic nucleus can be induced by respiratory stressors and recovers spontaneously over time. Strengthening of latent contralateral projections to the phrenic nucleus and sprouting of new descending axons have been proposed as mechanisms contributing to the observed recovery. We have recently demonstrated recovery of spontaneous crossed phrenic activity occurring over minutes to hours in C 1 -hemisected unanesthetized decerebrate rats. The specific neurochemical and molecular pathways underlying crossed phrenic activity following injury require further clarification. A thorough understanding of these is necessary in order to develop targeted therapies for respiratory neurorehabilitation following spinal trauma. Animal studies provide preliminary evidence for the utility of neuropharmacological manipulation of serotonergic and adenosinergic pathways, nerve grafts, olfactory ensheathing cells, intraspinal microstimulation and a possible role for dorsal rhizotomy in recovering phrenic activity following spinal cord injury.
Transport cross section for small-angle scattering
International Nuclear Information System (INIS)
D'yakonov, M.I.; Khaetskii, A.V.
1991-01-01
Classical mechanics is valid for describing potential scattering under the conditions (1) λ much-lt α and (2) U much-gt ℎυ/α, where λ is the de Broglie wavelength, α is the characteristic size of the scatterer, U is the characteristic value of the potential energy, and υ is the velocity of the scattered particle. The second of these conditions means that the typical value of the classical scattering angle is far larger than the diffraction angle λ/α. In this paper the authors show that this second condition need not hold in a derivation of the transport cross section. In other words, provided that the condition λ much-lt α holds, it is always possible to calculate the transport cross section from the expressions of classical mechanics, even in the region U approx-lt ℎυ/α, where the scattering is diffractive,and the differential cross section is greatly different from the classical cross section. The transport cross section is found from the classical expression even in the anticlassical case U much-lt ℎυ/α, where the Born approximation can be used
Multilevel parametrization of fissile nuclei resonance cross sections
International Nuclear Information System (INIS)
Lukyanov, A.A.; Kolesov, V.V.; Janeva, N.
1987-01-01
Because the resonance interference has an important influence on the resonance structure of neutron cross sections energy dependence at lowest energies, multilevel scheme of the cross section parametrization which take into account the resonance interference is used for the description with the same provisions in the regions of the interferential maximum and minimum of the resonance cross sections of the fissile nuclei
Stochastic systems with cross-correlated Gaussian white noises
International Nuclear Information System (INIS)
Wang Cheng-Yu; Song Yu-Min; Zhou Peng; Yang Hai; Gao Yun
2010-01-01
This paper theoretically investigates three stochastic systems with cross-correlation Gaussian white noises. Both steady state properties of the stochastic nonlinear systems and the nonequilibrium transitions induced by the cross-correlated noises are studied. The stationary solutions of the Fokker—Planck equation for three specific examples are analysed. It is shown explicitly that the cross-correlation of white noises can induce nonequilibrium transitions
Nonelastic-scattering cross sections of elemental nickel
International Nuclear Information System (INIS)
Smith, A.B.; Guenther, P.T.; Whalen, J.F.
1980-06-01
Neutron total cross sections of elemental nickel were measured from 1.3 to 4.5 MeV, at intervals of approx. 50 keV, with resolutions of 30 to 50 keV and to accuracies of 1 to 2.5%. Neutron differential-elastic-scattering cross sections were measured from 1.45 to 3.8 MeV, at intervals and with resolutions comparable to those of the total cross sections, and to accuracies of 3 to 5%. The nonelastic-scattering cross section is derived from the measured values to accuracies of greater than or equal to 6%. The experimental results are compared with previously reported values as represented by ENDF/B-V, and areas of consistency and discrepancy, noted. The measured results are shown to be in good agreement with the predictions of a model previously reported by the authors. 4 figures, 1 table
Contract-Based Transaction Management in Cross-Organizational Workflow Management
Grefen, P.W.P.J.
Cross-organizational workflow management is an essential ingredient for process integration in virtual enterprises. To obtain cross-organizational workflow processes with robust semantics, these processes should be supported by highlevel cross-organizational transaction management. In this context,
Model cross section calculations using LAHET
International Nuclear Information System (INIS)
Prael, R.E.
1992-01-01
The current status of LAHET is discussed. The effect of a multistage preequilibrium exciton model following the INC is examined for neutron emission benchmark calculations, as is the use of a Fermi breakup model for light nuclei rather than an evaporation model. Comparisons are made also for recent fission cross section experiments, and a discussion of helium production cross sections is presented
Interference analysis of fission cross section
International Nuclear Information System (INIS)
Toshkov, S.A.; Yaneva, N.B.
1976-01-01
The formula for the reaction cross-section based on the R-matrix formalism considering the interference between the two neighbouring resonances, referred to the same value of total momentum was used for the analysis of the cross-section of resonance neutron induced fission of 230Pu. The experimental resolution and thermal motion of the target nuclei were accounted for numerical integration
Cross-language psycholinguistics
Cutler, A.
1985-01-01
Cross-linguistic research can be of valaue to psycholinguistics by allowing tests of hypotheses the testing of which would be severely confounded in a single language, and by providing simple and readily available control conditions. For a long time the resources of this kind of research were
Measurements of fission cross-sections. Chapter 4
International Nuclear Information System (INIS)
James, G.D.
1981-01-01
The steps involved in the measurement of fission cross sections are summarized and the range of techniques available are considered. Methods of fission detection are described with particular emphasis on the neutron energy dependent properties of the fission process and the details of fragment energy loss which can lead to energy-dependent changes in detector efficiency. Selected examples of fission cross-section measurements are presented and methods of data reduction, storage, analysis and evaluation, are examined. Finally requested accuracies for fission cross section data are compared to estimated available accuracies. (U.K.)
New mechanism to cross the phantom divide
Du, Yunshuang; Zhang, Hongsheng; Li, Xin-Zhou
2010-01-01
Recently, type Ia supernovae data appear to support a dark energy whose equation of state $w$ crosses -1, which is a much more amazing problem than the acceleration of the universe. We show that it is possible for the equation of state to cross the phantom divide by a scalar field in the gravity with an additional inverse power-law term of Ricci scalar in the Lagrangian. The necessary and sufficient condition for a universe in which the dark energy can cross the phantom divide is obtained. So...
Directory of Open Access Journals (Sweden)
Hsing-Sheng Tai
2015-02-01
Full Text Available Resilience thinking has strongly influenced how people understand and pursue sustainability of linked social-ecological systems. Resilience thinking highlights the need to build capacity and manage general system properties in a complex, constantly changing world. I modified an analytical framework to address associations among cross-scale and cross-level dynamics, attributes of governance, and capacity to enhance resilience. The Danungdafu Forestation Area represents one of Taiwan’s most controvisal cases concerning land use, indigenous rights, and environmental issues. Analysis of this Taiwanese experience from a social-ecological perspective can show how current capacities for managing resilience are related to critical governance attributes. Analysis helped identify fundamental flaws in current governance and key issues needing to be addressed. The Danungdafu Forestation Area should transition towards a governance regime that is more participatory, deliberative, multi-layered, accountable, just, and networked. This can be done by developing an intermediate level institution that coordinates the cross-scale and cross-level interactions that better fit this social-ecological system.
Vibrational enhancement of total breakup cross sections
International Nuclear Information System (INIS)
Haftel, M.I.; Lim, T.K.
1984-01-01
This paper considers the role of multi-two-body bound states, namely vibrational excitations, on total three-body breakup cross-sections. Total cross-sections are usually easy to measure, and they play a fundamental role in chemical kinetics. (orig.)
Cross relaxation in nitroxide spin labels
DEFF Research Database (Denmark)
Marsh, Derek
2016-01-01
Cross relaxation, and mI-dependence of the intrinsic electron spin-lattice relaxation rate We, are incorporated explicitly into the rate equations for the electron-spin population differences that govern the saturation behaviour of 14N- and 15N-nitroxide spin labels. Both prove important in spin......-label EPR and ELDOR, particularly for saturation recovery studies. Neither for saturation recovery, nor for CW-saturation EPR and CW-ELDOR, can cross relaxation be described simply by increasing the value of We, the intrinsic spin-lattice relaxation rate. Independence of the saturation recovery rates from...... the hyperfine line pumped or observed follows directly from solution of the rate equations including cross relaxation, even when the intrinsic spin-lattice relaxation rate We is mI-dependent....
An Epidemiological Profile of CrossFit Athletes in Brazil.
Sprey, Jan W C; Ferreira, Thiago; de Lima, Marcos V; Duarte, Aires; Jorge, Pedro B; Santili, Claudio
2016-08-01
CrossFit is a conditioning and training program that has been gaining recognition and interest among the physically active population. Approximately 440 certified and registered CrossFit fitness centers and gyms exist in Brazil, with approximately 40,000 athletes. To date, there have been no epidemiological studies about the CrossFit athlete in Brazil. To evaluate the profile, sports history, training routine, and presence of injuries among athletes of CrossFit. Descriptive epidemiological study. This cross-sectional study was based on a questionnaire administered to CrossFit athletes from various specialized fitness centers in Brazil. Data were collected from May 2015 to July 2015 through an electronic questionnaire that included demographic data, level of sedentary lifestyle at work, sports training history prior to starting CrossFit, current sports activities, professional monitoring, and whether the participants experienced any injuries while practicing CrossFit. A total of 622 questionnaires were received, including 566 (243 women [42.9%] and 323 men [57.1%]) that were completely filled out and met the inclusion criteria and 9% that were incompletely filled out. Overall, 176 individuals (31.0%) mentioned having experienced some type of injury while practicing CrossFit. We found no significant difference in injury incidence rates regarding demographic data. There was no significant difference regarding previous sports activities because individuals who did not practice prior physical activity showed very similar injury rates to those who practiced at any level. CrossFit injury rates are comparable to those of other recreational or competitive sports, and the injuries show a profile similar to weight lifting, power lifting, weight training, Olympic gymnastics, and running, which have an injury incidence rate nearly half that of soccer.
Donor cross-linking for keratoplasty: a laboratory evaluation.
Mukherjee, Achyut; Hayes, Sally; Aslanides, Ioannis; Lanchares, Elena; Meek, Keith M
2015-12-01
This laboratory-based investigation compares the topographic outcomes of conventional penetrating keratoplasty with that of a novel procedure in which donor corneas are cross-linked prior to keratoplasty. Penetrating keratoplasty procedures with continuous running sutures were carried out in a porcine whole globe model. Sixty eyes were randomly paired as 'donor' and 'host' tissue before being assigned to one of two groups. In the cross-linked group, donor corneas underwent riboflavin/UVA cross-linking prior to being trephined and sutured to untreated hosts. In the conventional keratoplasty group, both host and donor corneas remained untreated prior to keratoplasty. Topographic and corneal wavefront measurements were performed following surgery, and technical aspects of the procedure evaluated. Mean keratometric astigmatism was significantly lower in the cross-linked donor group at 3.67D (SD 1.8 D), vs. 8.43 D (SD 2.4 D) in the conventional keratoplasty group (p < 0.005). Mean wavefront astigmatism was also significantly reduced in the cross-linked donor group 4.71 D (SD 2.1) vs. 8.29D (SD 3.6) in the conventional keratoplasty group (p < 0.005). Mean RMS higher order aberration was significantly lower in the cross-linked donor group at 1.79 um (SD 0.98), vs. 3.05 um (SD 1.9) in the conventional keratoplasty group (P = 0.02). Qualitative analysis revealed less tissue distortion at the graft-host junction in the cross-linked group. Cross-linking of donor corneas prior to keratoplasty reduces intraoperative induced astigmatism and aberrations in an animal model. Further studies are indicated to evaluate the implications of this potential modification of keratoplasty surgery.
Extended analysis of retrodirective cross-eye jamming
CSIR Research Space (South Africa)
Du Plessis, WP
2009-09-01
Full Text Available An extended and rigorous analysis of retrodirective cross-eye jamming in a radar system scenario is presented. This analysis removes the approximations that limit the validity of other analyses of cross-eye jamming. These results imply that under...
An Epidemiological Profile of CrossFit Athletes in Brazil
Sprey, Jan W.C.; Ferreira, Thiago; de Lima, Marcos V.; Duarte, Aires; Jorge, Pedro B.; Santili, Claudio
2016-01-01
Background: CrossFit is a conditioning and training program that has been gaining recognition and interest among the physically active population. Approximately 440 certified and registered CrossFit fitness centers and gyms exist in Brazil, with approximately 40,000 athletes. To date, there have been no epidemiological studies about the CrossFit athlete in Brazil. Purpose: To evaluate the profile, sports history, training routine, and presence of injuries among athletes of CrossFit. Study Des...
Cross-cultural dimensions : organisational culture in Philip Morris, Lietuva
Grundey, Dainora
2008-01-01
Business globalization raised the new priorities for cross-cultural management theory and practice. The goal of this article is according to cross-cultural management and organizational culture theories to propose a new model of organizational culture with cross-cultural dimensions. The objectives of the paper are as follows: a) to disclose the essence of cross-cultural management and organizational culture; b) to carry out the empirical research of organizational culture in a selected Lithua...
DEVELOPMENT OF CROSS-BORDER AREAS. STUDY CASES REVIEW
Directory of Open Access Journals (Sweden)
Marcela\tȘLUSARCIUC
2015-06-01
Full Text Available The paper aims to review study cases found in the scientific literature concerning the development of cross- border areas in European Union and its neighbourhood. The introductory part of the paper is drawing few considerations about the cross-border areas. Further we identified in the specific literature relevant study cases that provide lessons learned, tools and models that can contribute to the development of the cross-border areas. The last part of the paper is focusing on an inquiry about how this lessons, learned, tools and models may be adapted in case of cross-border areas along the Romanian border with the EU Eastern Neighbourhood.
Positive Scattering Cross Sections using Constrained Least Squares
International Nuclear Information System (INIS)
Dahl, J.A.; Ganapol, B.D.; Morel, J.E.
1999-01-01
A method which creates a positive Legendre expansion from truncated Legendre cross section libraries is presented. The cross section moments of order two and greater are modified by a constrained least squares algorithm, subject to the constraints that the zeroth and first moments remain constant, and that the standard discrete ordinate scattering matrix is positive. A method using the maximum entropy representation of the cross section which reduces the error of these modified moments is also presented. These methods are implemented in PARTISN, and numerical results from a transport calculation using highly anisotropic scattering cross sections with the exponential discontinuous spatial scheme is presented
Exploring communication of resistance in cross-sector collaboration:
DEFF Research Database (Denmark)
Plotnikof, Mie
his study addresses the role of resistance in cross-sector collaboration. It explores how resistance is communicated during collaboration to better understand not just its destructive, but also constructive effects on organizing cross-sector collaboration. In so doing, the paper conceptualizes...... to the process. Thereby, the study contributes with theorizing resistance and offers analytical insights on its dynamics and effects on organizing cross-sector collaboration....
Cross-border regional innovation systems
DEFF Research Database (Denmark)
Makkonen, Teemu; Rohde, Stephan
2016-01-01
. This paper discusses the reasons behind this mismatch which means that the concept still rests upon and draws policy suggestions based on a thin evidence base. Directions for further research are pointed out by underlining the need for holistic empirical validations of the concept together with the need......The concept of cross-border regional innovation systems (CBRIS) surfaced in the literature on economic geography through discourses that highlighted the need of broadening innovation systems to cross-border contexts. Since these early discussions, the theoretical backgrounds of CBRIS have been...
DEFF Research Database (Denmark)
Peterson, Adam; Jacobsen, Sven-Erik; Bonifacio, Alejandro
2015-01-01
will require a reliable technique for crossing quinoa plants using hand emasculation. The technique described herein focuses on the isolation of small flower clusters produced low on the plant, emasculation of male flowers, and subsequent pairing of the emasculated female parent with a male parent undergoing...... anthesis. Various traits, such as plant color, seed color, and axil pigmentation can be used to confirm the successful production of F1 plants. The manual hybridization technology provides a significant advantage over pairing plants and relying on chance cross-pollination, and has been successfully used...
Health Insurance without Single Crossing
DEFF Research Database (Denmark)
Boone, Jan; Schottmüller, Christoph
2017-01-01
Standard insurance models predict that people with high risks have high insurance coverage. It is empirically documented that people with high income have lower health risks and are better insured. We show that income differences between risk types lead to a violation of single crossing...... in an insurance model where people choose treatment intensity. We analyse different market structures and show the following: If insurers have market power, the violation of single crossing caused by income differences and endogenous treatment choice can explain the empirically observed outcome. Our results do...
Cross section library DOSCROS77 (in the SAND-II format)
International Nuclear Information System (INIS)
Zijp, W.L.; Nolthenius, H.J.; Borg, N.J.C.M. van der.
1977-08-01
The dosimetry cross section library DOSCROS77 is documented with tables, plots and cross section values averaged over a few reference spectra. This library is based on the ENDF/B-IV dosimetry file, supplemented with some other evaluations. The total number of reaction cross section sets incorporated in this library is 49 (+3 cover cross sections sets). The cross section data are available in a format which is suitable for the program SAND-II
Cross-channel coupling in positron-atom scattering
International Nuclear Information System (INIS)
McAlinden, M.T.; Kernoghan, A.A.; Walters, H.R.J.
1994-01-01
Coupled-state calculations including positronium channels are reported for positron scattering by atomic hydrogen, lithium and sodium. Integrated cross sections and total cross sections are presented for all three atoms. For lithium differential cross sections are also given. Throughout, comparison is made between results calculated with and without inclusion of the positronium channels. S-wave cross sections for positron scattering by atomic hydrogen in the Ps(1s, 2s, 2p) + H(1s, 2s, 2p) approximation show the high energy resonance first observed by Higgins and Burke in the coupled-static approximation. This resonance has now moved up to 51.05 eV and narrowed in width to 2.92 eV. Other pronounced structure is seen in the S-wave cross sections between 10 and 20 eV; it is tentatively suggested that this structure may be due to the formation of a temporary pseudo-molecular collision complex. Results calculated in the Ps(1s, 2s, anti 3 anti s, anti 4 anti s, 2p, anti 3 anti p, anti 4 anti p, anti 3 anti d, anti 4 anti d) + H(1s, 2s, anti 3 anti s, anti 4 anti s, 2p, anti 3 anti p, anti 4 anti p, anti 3 anti d, anti 4 anti d) approximation show convergence towards accurate values in the energy region below and in the Ore gap. Contrary to previous work on lithium using only an atomic basis, it is found that coupling to the 3d state of lithium is not so important when positronium channels are included; this is because a mixed basis of atom and positronium states gives a more rapidly convergent approximation than an expansion based on atom states alone. The threshold behaviour of the elastic cross section and the Ps(1s) formation cross section for lithium is investigated. Results in the Ps(1s, 2s, 2p) + Na(3s, 3p) approximation for sodium show good agreement with the total cross section measurements of Kwan et al. (orig.)
JSD1000: multi-group cross section sets for shielding materials
International Nuclear Information System (INIS)
Yamano, Naoki
1984-03-01
A multi-group cross section library for shielding safety analysis has been produced by using ENDF/B-IV. The library consists of ultra-fine group cross sections, fine-group cross sections, secondary gamma-ray production cross sections and effective macroscopic cross sections for typical shielding materials. Temperature dependent data at 300, 560 and 900 K have been also provided. Angular distributions of the group to group transfer cross section are defined by a new method of ''Direct Angular Representation'' (DAR) instead of the method of finite Legendre expansion. The library designated JSD1000 are stored in a direct access data base named DATA-POOL and data manipulations are available by using the DATA-POOL access package. The 3824 neutron group data of the ultra-fine group cross sections and the 100 neutron, 20 photon group cross sections are applicable to shielding safety analyses of nuclear facilities. This report provides detailed specifications and the access method for the JSD1000 library. (author)
Cross-training in a cellular manufacturing environment
Slomp, J.; Bokhorst, J.A.C.; Molleman, E.
This study addresses the need for cross-training in a cellular manufacturing environment. It is demonstrated that an effective cross-training situation results if workers and machines are connected, directly or indirectly, by task assignment decisions. The connections between workers and machines
[Biophysical principles of collagen cross-linking].
Spörl, E; Raiskup-Wolf, F; Pillunat, L E
2008-02-01
The reduced mechanical stability of the cornea in keratoconus or in keratectasia after Lasik may be increased by photooxidative cross-linking of corneal collagen. The biophysical principles are compiled for the safe and effective application of this new treatment method. The setting of the therapy parameters should be elucidated from the absorption behaviour of the cornea. The safety of the method for the endothelium cells and the lens will be discussed. The induced cross-links are shown to be the result of changes in the physico-chemical properties of the cornea. To reach a high absorption of the irradiation energy in the cornea, riboflavin of a concentration of 0.1% and UV light of a wavelength of 370 nm, corresponding to the relative maximum of absorption of riboflavin, were used. An irradiance of 3 mW/cm(2) and an irradiation time of 30 min lead to an increase of the mechanical stiffness. The endothelium cells will be protected due to the high absorption within the cornea, that means the damaging threshold of the endothelium cells will not be reached in a 400 microm thick stroma. As evidence for cross-links we can consider the increase of the biomechanical stiffness, the increased resistance against enzymatic degradation, a higher shrinkage temperature, a lower swelling rate and an increased diameter of collagen fibres. The therapy parameters were tested experimentally and have been proven clinically in the corneal collagen cross-linking. These parameters should be respected to reach a safe cross-linking effect without damage of the adjacent tissues.
Thurber, Kent R; Tycko, Robert
2012-08-28
We present theoretical calculations of dynamic nuclear polarization (DNP) due to the cross effect in nuclear magnetic resonance under magic-angle spinning (MAS). Using a three-spin model (two electrons and one nucleus), cross effect DNP with MAS for electron spins with a large g-anisotropy can be seen as a series of spin transitions at avoided crossings of the energy levels, with varying degrees of adiabaticity. If the electron spin-lattice relaxation time T(1e) is large relative to the MAS rotation period, the cross effect can happen as two separate events: (i) partial saturation of one electron spin by the applied microwaves as one electron spin resonance (ESR) frequency crosses the microwave frequency and (ii) flip of all three spins, when the difference of the two ESR frequencies crosses the nuclear frequency, which transfers polarization to the nuclear spin if the two electron spins have different polarizations. In addition, adiabatic level crossings at which the two ESR frequencies become equal serve to maintain non-uniform saturation across the ESR line. We present analytical results based on the Landau-Zener theory of adiabatic transitions, as well as numerical quantum mechanical calculations for the evolution of the time-dependent three-spin system. These calculations provide insight into the dependence of cross effect DNP on various experimental parameters, including MAS frequency, microwave field strength, spin relaxation rates, hyperfine and electron-electron dipole coupling strengths, and the nature of the biradical dopants.
Atypical mycobacterial infection mimicking carbuncle in an elderly patient: A case report
Directory of Open Access Journals (Sweden)
Terlinda Barros
2015-08-01
Full Text Available Background: Atypical mycobacterium infection occurs under certain skin conditions, namely the disruption of skin integrity and mucous membranes accompanied by the reduction of cellular immunity. However, atypical mycobacterial infection in elderly patients is rarely reported. Case: A 64 years old male patient, complained of red lumps on the upper-backfor a month, accompanied by mild fever and minimal pain. Three months before, the patient had accupuncture on the neck and upper back. Physical examination showed multiple miliar to lenticular sized papules and pustules on an erythematous-violaceus base with hard and immobile palpable nodes and infiltrate. After clinical and laboratory workup, the patient was diagnosed withcarbuncle with Candida spp colonization. The treatment consisted of systemicantibiotics and topical antifungals. There was no clinical improvement after 3 weeks. Histopathology and laboratory results suggested atypical mycobacterium infection. Discussion: Atypical mycobacterium infection should be considered in elderly patients with skin and soft tissue infections that show no clinical improvement tostandard therapy.
The influence of substrate material on ascidian larval settlement.
Chase, Anna L; Dijkstra, Jennifer A; Harris, Larry G
2016-05-15
Submerged man-made structures present novel habitat for marine organisms and often host communities that differ from those on natural substrates. Although many factors are known to contribute to these differences, few studies have directly examined the influence of substrate material on organism settlement. We quantified larval substrate preferences of two species of ascidians, Ciona intestinalis (cryptogenic, formerly C. intestinalis type B) and Botrylloides violaceus (non-native), on commonly occurring natural (granite) and man-made (concrete, high-density polyethylene, PVC) marine materials in laboratory trials. Larvae exhibited species-specific settlement preferences, but generally settled more often than expected by chance on concrete and HDPE. Variation in settlement between materials may reflect preferences for rougher substrates, or may result from the influence of leached chemicals on ascidian settlement. These findings indicate that an experimental plate material can influence larval behavior and may help us understand how substrate features may contribute to differences in settlement in the field. Copyright © 2016 Elsevier Ltd. All rights reserved.
Neutral sheet crossings in the distant magnetotail
International Nuclear Information System (INIS)
Heikkila, W.J.; Slavin, J.A.; Smith, E.J.; Baker, D.N.; Zwickl, R.D.
1985-01-01
We have analyzed the magnetic field data from ISEE-3 in the distant magnetotail for 18 crossings of the cross-tail current sheet (or so-called natural sheet) to determine the direction of the normal component B/sub z/. The crossings occurred near the middle of the aberrated magnetotail (0 0.4 nT), consistent with closed field lines connected to the earth. In 3 cases B/sub z/ was very close to zero; in several instances there was structure in B/sub y/, suggesting localized currents with x or z directions. One may have been a magnetopause crossing. The strong preponderance of northward B/sub z/ favors a model of the magnetotail which is dominated by boundary layer plasma, flowing tailward on closed magnetic field lines, which requires the existence of an electric field in the sense from dusk to dawn. 37 refs., 15 figs., 1 tab
New mechanism to cross the phantom divide
International Nuclear Information System (INIS)
Du, Yunshuang; Zhang, Hongsheng; Li, Xin-Zhou
2011-01-01
Recently, type Ia supernova data appear to support a dark energy whose equation of state w crosses -1, which is a much more amazing problem than the acceleration of the universe. We show that it is possible for the equation of state to cross the phantom divide by a scalar field in gravity with an additional inverse power-law term of the Ricci scalar in the Lagrangian. The necessary and sufficient condition for a universe in which the dark energy can cross the phantom divide is obtained. Some analytical solutions with w -1 are obtained. A minimally coupled scalar with different potentials, including quadratic, cubic, quantic, exponential and logarithmic potentials are investigated via numerical methods, respectively. All these potentials lead to the crossing behavior. We show that it is a robust result which is hardly dependent on the concrete form of the potential of the scalar. (orig.)
Cross subsidy removal in electricity pricing in India
International Nuclear Information System (INIS)
Bhattacharyya, Ranajoy; Ganguly, Amrita
2017-01-01
In India electricity price for agriculture is cross subsidized by the industries. The Indian government has started a process through which the extent of cross subsidization is gradually being reduced. The idea is to replace the cross subsidization by 2030 and introduce a rate structure that will increase with the amount of electricity usage. This paper uses the Computable General Equilibrium framework to evaluate the ex-ante impact of these policy changes on the Indian economy. The paper finds that removal of cross subsidies will increase inflation particularly food inflation resulting in a decline in household incomes more so in rural areas. Replacing cross subsidies with a progressive rate structure will compensate for only a small part of the negative effects of the removal of cross subsidies. Four other policy options are also investigated targeting household incomes, food inflation and general inflation. Most of these options do not work as the required increase in budget deficit is unlikely to be bearable to the government. The only feasible option appears to be a direct price subsidy to agricultural sector: in this case food prices are held down, inflation is moderate and effect on household incomes is minimal. - Highlights: • Removal of cross subsidies in electricity sector will increase inflation in India. • Different policy options are investigated targeting household incomes, food inflation and general inflation. • Feasible option appears to be a direct price subsidy to agricultural sector.
Interpersonal Influence in Cross-Cultural Interactions
2010-10-01
Berry, J. W., Poortinga, Y. H., Segall, M. H., & Dasen, P. R. (2002). Cross - cultural psychology : Research and applications (Second Edition). Cambridge...Annual Review of Psychology , 51, 93–120. Matsumoto , D. (1996). Culture and psychology . Pacific Grove, CA: Brooks/Cole. Oyserman, D., Coon, H. M...interpreters. Infantry, Spring, 22–27. Shiraev, E., & Levy, D. (2004). Cross - cultural psychology : Critical thinking and contemporary applications. Boston
Taiwan’s Security Calculus of Cross-Strait Migration
Directory of Open Access Journals (Sweden)
Ching Chang
2015-08-01
Full Text Available Migration across the Taiwan Strait is relatively insignificant by its scale but it is indeed indisputably politically sensitive. Given the long-term political separation and military rivalry across the Taiwan Strait in the past six decades while both sides of the Taiwan Strait nevertheless intensively engaged each other economically, commercially and culturally, a social trend of cross-Strait migration inevitably results. There are various interpretations on such a demographic development which has raised security concerns, which are in turn creating a biased judiciary arrangement on the migration activities. What are the factors behind the security calculus of cross-Strait migration? How can the security calculus justify its arguments and subsequently maintain unequal treatments with respect to cross-Strait immigrants? Are the rationales for maintaining a tight grip on cross-Strait migration in line with the political ideal proclaimed by the political factions in Taiwan still sensible? What is the potential for the trend of cross-Strait migration affecting the security calculus in the future? On the other hand, for the migration from Taiwan to Mainland China, how influential can it be on the security decision-making process of the Beijing leadership? Is there any impact possibly caused by cross-Strait migration – and is it essentially overstated? Or alternatively, is the overstated influence potentially caused by cross-Strait migration an intentionally staged political myth? What are the substantial impacts actually ever achieved by cross-Strait migration on the security dimension? What is the self-fulfilled conviction of cross-Strait migration? For all the inquiries noted above, the author of this paper would like to scrutinize the truth and separate it from numerous myths ever advocated by the different factions in Taiwan politics. A sound and neutral judgment to tell the exact influences likely enacted by cross-Strait migration would
Average cross sections for the 252Cf neutron spectrum
International Nuclear Information System (INIS)
Dezso, Z.; Csikai, J.
1977-01-01
A number of average cross sections have been measured for 252 Cf neutrons in (n, γ), (n,p), (n,2n), (n,α) reactions by the activation method and for fission by fission chamber. Cross sections have been determined for 19 elements and 45 reactions. The (n,γ) cross section values lie in the interval from 0.3 to 200 mb. The data as a function of target neutron number increases up to about N=60 with minimum near to dosed shells. The values lie between 0.3 mb and 113 mb. These cross sections decrease significantly with increasing the threshold energy. The values are below 20 mb. The data do not exceed 10 mb. Average (n,p) cross sections as a function of the threshold energy and average fission cross sections as a function of Zsup(4/3)/A are shown. The results obtained are summarized in tables
Impact of CrossFit-Related Spinal Injuries.
Hopkins, Benjamin S; Cloney, Michael B; Kesavabhotla, Kartik; Yamaguchi, Jonathon; Smith, Zachary A; Koski, Tyler R; Hsu, Wellington K; Dahdaleh, Nader S
2017-11-16
Exercise-related injuries (ERIs) are a common cause of nonfatal emergency department and hospital visits. CrossFit is a high-intensity workout regimen whose popularity has grown rapidly. However, ERIs due to CrossFit remained under investigated. All patients who presented to the main hospital at a major academic center complaining of an injury sustained performing CrossFit between June 2010 and June 2016 were identified. Injuries were classified by anatomical location (eg, knee, spine). For patients with spinal injuries, data were collected including age, sex, body mass index (BMI), CrossFit experience level, symptom duration, type of symptoms, type of clinic presentation, cause of injury, objective neurological examination findings, imaging type, number of clinic visits, and treatments prescribed. Four hundred ninety-eight patients with 523 CrossFit-related injuries were identified. Spine injuries were the most common injuries identified, accounting for 20.9%. Among spine injuries, the most common location of injury was the lumbar spine (83.1%). Average symptom duration was 6.4 months ± 15.1, and radicular complaints were the most common symptom (53%). A total of 30 (32%) patients had positive findings on neurologic examination. Six patients (6.7%) required surgical intervention for treatment after failing an average of 9.66 months of conservative treatment. There was no difference in age, sex, BMI, or duration of symptoms of patients requiring surgery with those who did not. CrossFit is a popular, high-intensity style workout with the potential to injure its participants. Spine injuries were the most common type of injury observed and frequently required surgical intervention.
Cross-resistance to herbicides in annual ryegrass (lolium rigidum)
International Nuclear Information System (INIS)
Christopher, J.T.; Powles, S.B.; Liljegren, D.R.; Holtum, J.A.M.
1991-01-01
Lolium rigidum Gaud. biotype SLR31 is resistant to the herbicide diclofop-methyl and cross-resistant to several sulfonylurea herbicides. Wheat and the cross-resistant ryegrass exhibit similar patterns of resistance to sulfonylurea herbicides, suggesting that the mechanism of resistance may be similar. Cross-resistant ryegrass is also resistant to the wheat-selective imidazolinone herbicide imazamethabenz. The cross-resistant biotype SLR31 metabolized [phenyl-U- 14 C]chlorsulfuron at a faster rate than a biotype which is susceptible to both diclofop-methyl and chlorsulfuron. A third biotype which is resistant to diclofop-methyl but not to chlorsulfuron metabolized chlorsulfuron at the same rate as the susceptible biotype. The increased metabolism of chlorsulfuron observed in the cross-resistant biotype is, therefore, correlated with the patterns of resistance observed in these L. rigidum biotypes. During high performance liquid chromatography analysis the major metabolite of chlorsulfuron in both susceptible and cross-resistant ryegrass coeluted with the major metabolite produced in wheat. The major product is clearly different from the major product in the tolerant dicot species, flax (Linium usitatissimum). The elution pattern of metabolites of chlorsulfuron was the same for both the susceptible and cross-resistant ryegrass but the cross-resistant ryegrass metabolized chlorsulfuron more rapidly. The investigation of the dose response to sulfonylurea herbicides at the whole plant level and the study of the metabolism of chlorsulfuron provide two independent sets of data which both suggest that the resistance to chlorsulfuron in cross-resistant ryegrass biotype SLR31 involves a wheat-like detoxification system
Cross sections for hadron and lepton production processes
International Nuclear Information System (INIS)
Bhattacharya, R.
1976-01-01
Charged heavy lepton production in proton-proton collisions is studied. Motivated by recent experimental results from the Stanford Linear Accelerator Center a parton model analysis is given of the reaction p + p → L + + L - + x → μ +- + e/ -+ / + neutrinos + x. Results are presented for the total cross section and the differential cross sections with respect to the invariant mass squared of the final charged leptons and the transverse momenta of each one of them. The two-photon mechanism for pair production in colliding beam exeriments is considered. Through the use of mapped invariant integration variables, a reliable exact numerical calculation of the cross section for the production of muon and pion pairs by the two-photon mechanism is provided. Results are given for the exact total cross sections and also the differential cross sections with respect to the invariant mass squared of the pair. These are compared to the results obtained from the equivalent photon approximation method
Biocatalytic cross-linking of pectic polysaccharides for designed food functionality
DEFF Research Database (Denmark)
Zaidel, Dayang Norulfairuz Abang; Meyer, Anne S.
2012-01-01
the mechanisms of formation of functional pectic polysaccharide cross-links, including covalent cross-links (notably phenolic esters and uronyl ester linkages) and non-covalent, ionic cross-links (which involve calcium and borate ester links). The treatise examines how such cross-links can be designed via......Recent research has demonstrated how cross-linking of pectic polysaccharides to obtain gel formation can be promoted by enzymatic catalysis reactions, and provide opportunities for functional upgrading of pectic polysaccharides present in agro-industrial sidestreams. This review highlights...... specific enzymatic reactions, and highlights the most recent data concerning enzyme catalyzed engineering of cross-links for in situ structural design of functional properties of foods....
Cross-Border Tourism and its Significance for Tourism Destinations
Directory of Open Access Journals (Sweden)
Roman LIVANDOVSCHI
2017-06-01
Full Text Available This article is concerned with cross-border tourism. It enhances the importance of cross-border cooperation in tourism. Cross-border cooperation is a form of international cooperation, along with interregional, transitional and trans-frontier cooperation. Cross-border regions often share the same historical and cultural traditions and attractive natural landscapes, such is the case of the Republic of Moldova and Romania. In both cases, cross-border regions can benefit from cooperation – cooperation can help create greater diversity and differentiation of the range of tourism and environmental products; create economies of scale and make promotion more effective, and can help better address specific problems or issues for tourism development.
Microscopic cross-section measurements by thermal neutron activation
International Nuclear Information System (INIS)
Avila L, J.
1987-08-01
Microscopic cross sections measured by thermal neutron activation using RP-0 reactor at the Peruvian Nuclear Energy Institute. The method consists in measuring microscopic cross section ratios through activated samples, requiring being corrected in thermal and epithermal energetic range by Westcott formalism. Furthermore, the comptage ratios measured for each photopeak to its decay fraction should be normalized from interrelation between both processes above, activation microscopic cross sections are obtained
Distorted eikonal cross sections: A time-dependent view
International Nuclear Information System (INIS)
Turner, R.E.
1982-01-01
For Hamiltonians with two potentials, differential cross sections are written as time-correlation functions of reference and distorted transition operators. Distorted eikonal differential cross sections are defined in terms of straight-line and reference classical trajectories. Both elastic and inelastic results are obtained. Expressions for the inelastic cross sections are presented in terms of time-ordered cosine and sine memory functions through the use of the Zwanzig-Feshbach projection-operator method
Discussion of electron cross sections for transport calculations
International Nuclear Information System (INIS)
Berger, M.J.
1983-01-01
This paper deals with selected aspects of the cross sections needed as input for transport calculations and for the modeling of radiation effects in biological materials. Attention is centered mainly on the cross sections for inelastic interactions between electrons and water molecules and the use of these cross sections for the calculation of energy degradation spectra and of ionization and excitation yields. 40 references, 3 figures, 1 table
How do western abyssal currents cross the equator?
Nof, Doron; Olson, Donald B.
1993-02-01
Previous investigations of upper ocean currents on a β-plane have shown that it is quite difficult for a parcel of fluid to cross the equator in the open ocean. Boundary currents sometimes can cross the equator, but even this crossing is not easily achieved. The main barrier for equatorial crossing of inviscid western boundary currents is the presence of a front on the open ocean side ( NOF, 1990, Deep-Sea Research, 37, 853-875). One-and-a-half and 2 1/2 layer models are used to examine how this frontal blocking constraint is modified by bottom topography. Both models show that some topographic features, such as the Mid-Atlantic Ridge, may entirely relax the frontal blocking constraint. The single layer crossing is modeled in terms of a heavy double-fronted inertial current (overlaid by a stagnant infinitely deep upper layer) flowing northward in a parabolic channel. Analytic solutions show that the current's position "flips" as it crosses the equator, it is situated next to the left flank of the channel (i.e. the western boundary) in the southern hemisphere and next to the right flank (i.e. the eastern part of the channel corresponding to the western side of the the mid-ocean ridge) in the northern hemisphere. With the aid of the above model, a 2 1/2 layer model, which contains an additional intermediate current above the core, is considered. It is found that the nonfrontal southward (or northward) intermediate flow crosses the equator and remains adjacent to the western boundary. In contrast, the deep frontal flow underneath again "flips" from the left to the right boundary as it crosses the equator. Possible application of this theory to the dense Antarctic Bottom Water (AABW) and the Lower North Atlantic Deep Water (LNADW) is discussed.
Tannen, Deborah
A two-part presentation on cross-cultural communication consists of a discussion of cultural differences in interpersonal communication and an article from a Greek English-language publication concerning telephone use skills in a foreign country. Cultural differences in communication are divided into eight types and illustrated: (1) when to talk;…
Cross-Cultural Communication in Oncology: Challenges and Training Interests.
Weber, Orest; Sulstarova, Brikela; Singy, Pascal
2016-01-01
To survey oncology nurses and oncologists about difficulties in taking care of culturally and linguistically diverse patients and about interests in cross-cultural training. . Descriptive, cross-sectional. . Web-based survey. . 108 oncology nurses and 44 oncologists. . 31-item questionnaire derived from preexisting surveys in the United States and Switzerland. . Self-rated difficulties in taking care of culturally and linguistically diverse patients and self-rated interests in cross-cultural training. . All respondents reported communication difficulties in encounters with culturally and linguistically diverse patients. Respondents considered the absence of written materials in other languages, absence of a shared common language with patients, and sensitive subjects (e.g., end of life, sexuality) to be particularly problematic. Respondents also expressed a high level of interest in all aspects of cross-cultural training (task-oriented skills, background knowledge, reflexivity, and attitudes). Nurses perceived several difficulties related to care of migrants as more problematic than physicians did and were more interested in all aspects of cross-cultural training. . The need for cross-cultural training is high among oncology clinicians, particularly among nurses. . The results reported in the current study may help nurses in decision-making positions and educators in introducing elements of cross-cultural education into oncology curricula for nurses. Cross-cultural training should be offered to oncology nurses.
[Prevalence of cross-bite in Mexican children].
Ojeda León, S; De la Teja Angeles, E
1990-10-01
As observed, the problem of lining and accommodation of teeth in the child population is increasingly larger. This fact prompted the authors to attempt determining the prevalence of cross-bite in a sample of Mexican children. A total of 306 patients, aged between two and 17 and attending the Stomatology service of the National Institute of Pediatrics, were evaluated, from which all pertinent data regarding age, sex, molar-temporal relationship (terminal, rectus, distal, messial and exaggerated messial planes), permanent molar status (Angle I, II, III), cross-bite, type of dentition affected (primary, mixed or permanent), cross-bite classification (anterior, posterior or mixed), whether unilateral, bilateral, dental or skeletal, right or left, and number of teeth affected, were duly recorded. Out of 306 evaluated patients (160 males, 146 female), 112 evidenced cross-bite (36.6%), 56 of each sex; in 69.6% the teeth were anterior, in 17.8% they were posterior, and in 15.5% their position was mixed. Their average age was 8 years, and malocclusion was Angle class I. From this experience, it is to be concluded that early detection and correction of any dental occlusion abnormality will permit correcting defects in dentofacial development; it is thus necessary to ascertain the frequency of cross-bite.
PDS4 Data Within the PSA — A Cross-Mission and Cross-Discipline Approach to a PDS4 Archive
Lim, T. L.; Martinez, S.; Coia, D.; Barbarisi, I.; Barthelemy, M.; Besse, S.; Fraga Agudo, D.; Grotheer, E.; Heather, D.; Vallat, C.
2018-04-01
The cross-mission and cross-discipline nature of the European Space Agency planetary science archive has led to a degree of standardization of PDS4 data structures and attributes housed by the archive demonstrating that the PDS core could adopt a similar approach.
Microscopic cross sections: An utopia?
Energy Technology Data Exchange (ETDEWEB)
Hilaire, S. [CEA Bruyeres-le-Chatel, DIF 91 (France); Koning, A.J. [Nuclear Research and Consultancy Group, PO Box 25, 1755 ZG Petten (Netherlands); Goriely, S. [Institut d' Astronomie et d' Astrophysique, Universite Libre de Bruxelles, Campus de la Plaine, CP 226, 1050 Brussels (Belgium)
2010-07-01
The increasing need for cross sections far from the valley of stability poses a challenge for nuclear reaction models. So far, predictions of cross sections have relied on more or less phenomenological approaches, depending on parameters adjusted to available experimental data or deduced from systematical relations. While such predictions are expected to be reliable for nuclei not too far from the experimentally known regions, it is clearly preferable to use more fundamental approaches, based on sound physical bases, when dealing with very exotic nuclei. Thanks to the high computer power available today, all major ingredients required to model a nuclear reaction can now be (and have been) microscopically (or semi-microscopically) determined starting from the information provided by a nucleon-nucleon effective interaction. We have implemented all these microscopic ingredients in the TALYS nuclear reaction code, and we are now almost able to perform fully microscopic cross section calculations. The quality of these ingredients and the impact of using them instead of the usually adopted phenomenological parameters will be discussed. (authors)
Microscopic cross sections: An utopia?
International Nuclear Information System (INIS)
Hilaire, S.; Koning, A.J.; Goriely, S.
2010-01-01
The increasing need for cross sections far from the valley of stability poses a challenge for nuclear reaction models. So far, predictions of cross sections have relied on more or less phenomenological approaches, depending on parameters adjusted to available experimental data or deduced from systematical relations.While such predictions are expected to be reliable for nuclei not too far from the experimentally known regions, it is clearly preferable to use more fundamental approaches, based on sound physical bases, when dealing with very exotic nuclei. Thanks to the high computer power available today, all major ingredients required to model a nuclear reaction can now be (and have been) microscopically (or semi-microscopically) determined starting from the information provided by a nucleon-nucleon effective interaction. We have implemented all these microscopic ingredients in the TALYS nuclear reaction code, and we are now almost able to perform fully microscopic cross section calculations. The quality of these ingredients and the impact of using them instead of the usually adopted phenomenological parameters will be discussed. (authors)
Parameterized representation of macroscopic cross section for PWR reactor
International Nuclear Information System (INIS)
Fiel, João Cláudio Batista; Carvalho da Silva, Fernando; Senra Martinez, Aquilino; Leal, Luiz C.
2015-01-01
Highlights: • This work describes a parameterized representation of the homogenized macroscopic cross section for PWR reactor. • Parameterization enables a quick determination of problem-dependent cross-sections to be used in few group calculations. • This work allows generating group cross-section data to perform PWR core calculations without computer code calculations. - Abstract: The purpose of this work is to describe, by means of Chebyshev polynomials, a parameterized representation of the homogenized macroscopic cross section for PWR fuel element as a function of soluble boron concentration, moderator temperature, fuel temperature, moderator density and 235 92 U enrichment. The cross-section data analyzed are fission, scattering, total, transport, absorption and capture. The parameterization enables a quick and easy determination of problem-dependent cross-sections to be used in few group calculations. The methodology presented in this paper will allow generation of group cross-section data from stored polynomials to perform PWR core calculations without the need to generate them based on computer code calculations using standard steps. The results obtained by the proposed methodology when compared with results from the SCALE code calculations show very good agreement
The total collision cross section in the glory region
International Nuclear Information System (INIS)
Biesen, J.J.H. van den.
1982-01-01
Chapter 1 presents a calculation of approximate total cross sections in the glory region from noble gas potentials. The relations between the main features of the total cross section and the properties of the potential to which these are sensitive are extensively investigated in chapter II. A beam apparatus has been developed, which allows for accurate measurements on the total cross section. All effects due to the finite angular and velocity resolution of the apparatus can be eliminated from the data to yield actual total cross sections as a function of the relative velocity. This facilitates a comparison to total cross sections predicted by potentials available in the literature. A brief description of the apparatus and of the data reduction is given in chapter III. The total cross section data obtained for various noble gas combinations are presented and analysed in chapter IV, where also a large number of potentials proposed in the literature is tested. In chapter V the quenching of the glories in the case of a non-spherical interaction is analysed. Subsequently, total cross section data for some atom-molecule systems are discussed. (Auth.)
Fuel Loss and Jams due to Pausing Railroad Crossings
Tomoeda, Akiyasu; Nishinari, Katsuhiro; Harada, Yoshiaki
2008-01-01
In Japan, all cars must pause before crossing the railroad for avoiding the accidents. This rule was established by a law in 1960. In fact, however, railroad crossings come to the serious bottlenecks because of this pausing rule and this bottleneck causes heavy jams. In this study, by using cellular automaton model we have investigated the traffic flow at railroad crossings in two cases: with pausing and without pausing. Moreover, the lost time due to pausing at railroad crossings have been a...
Floodplain Cross Section Lines
Department of Homeland Security — This table is required for any Digital Flood Insurance Rate Map database where cross sections are shown on the Flood Insurance Rate Map (FIRM). Normally any FIRM...
Neutron cross section libraries for analysis of fusion neutronics experiments
International Nuclear Information System (INIS)
Kosako, Kazuaki; Oyama, Yukio; Maekawa, Hiroshi; Nakamura, Tomoo
1988-03-01
We have prepared two computer code systems producing neutron cross section libraries to analyse fusion neutronics experiments. First system produces the neutron cross section library in ANISN format, i.e., the multi-group constants in group independent format. This library can be obtained by using the multi-group constant processing code system MACS-N and the ANISN format cross section compiling code CROKAS. Second system is for the continuous energy cross section library for the MCNP code. This library can be obtained by the nuclear data processing system NJOY which generates pointwise energy cross sections and the cross section compiling code MACROS for the MCNP library. In this report, we describe the production procedures for both types of the cross section libraries, and show six libraries with different conditions in ANISN format and a library for the MCNP code. (author)
Memory-induced acceleration and slowdown of barrier crossing
Kappler, Julian; Daldrop, Jan O.; Brünig, Florian N.; Boehle, Moritz D.; Netz, Roland R.
2018-01-01
We study the mean first-passage time τMFP for the barrier crossing of a single massive particle with non-Markovian memory by Langevin simulations in one dimension. In the Markovian limit of short memory time τΓ, the expected Kramers turnover between the overdamped (high-friction) and the inertial (low-friction) limits is recovered. Compared to the Markovian case, we find barrier crossing to be accelerated for intermediate memory time, while for long memory time, barrier crossing is slowed down and τMFP increases with τΓ as a power law τM F P˜τΓ2. Both effects are derived from an asymptotic propagator analysis: while barrier crossing acceleration at intermediate memory can be understood as an effective particle mass reduction, slowing down for long memory is caused by the slow kinetics of energy diffusion. A simple and globally accurate heuristic formula for τMFP in terms of all relevant time scales of the system is presented and used to establish a scaling diagram featuring the Markovian overdamped and the Markovian inertial regimes, as well as the non-Markovian intermediate memory time regime where barrier crossing is accelerated and the non-Markovian long memory time regime where barrier crossing is slowed down.
Identifying Critical Cross-Cultural School Psychology Competencies.
Rogers, Margaret R.; Lopez, Emilia C.
2002-01-01
Study sought to identify critical cross-cultural competencies for school psychologists. To identify the competencies, an extensive literature search about cross-cultural school psychology competencies was conducted, as well as a questionnaire to ask expert panelists. The 102 competencies identified cover 14 major domains of professional activities…
Cross-cultural Communication as a Way of Achievement of Cross-cultural Communicative Competence
Directory of Open Access Journals (Sweden)
Olga A. Andreyeva
2015-03-01
Full Text Available In this article authors made an attempt to consider a question of cross-cultural communication as a way of achievement of cross-cultural communicative competence. In the process of Kazakhstan entry into the world community in several plans at once – economic, social and cultural – the need for the highly qualified specialists who know foreign language at the productive level, i.e. capable to conduct communication in foreign language and who have linguocultural knowledge increases. For achievement of this purpose it is necessary to consider features of students’ training which are determined by the needs of society for the improvement of their education quality, and dynamism of social phenomena demands from the future specialists constant increment of knowledge.
International Nuclear Information System (INIS)
Pashchenko, A.B.; Wienke, H.; Ganesan, S.; McLaughlin, P.K.
1996-01-01
This document presents the description of a physical tape containing the basic evaluated nuclear data library of neutron nuclear interaction cross-sections and photon production cross-sections and photon-atom interaction cross-sections for fusion applications. It is part of FENDL, the evaluated nuclear data library for fusion applications. The nuclear data are available cost-free for distribution to interested scientists upon request. The data can also be retrieved by the user via online access through international computer networks. (author). 11 refs, 1 tab
Heisenberg rise of total cross sections
International Nuclear Information System (INIS)
Ezhela, V.V.; Yushchenko, O.P.
1988-01-01
It is shown that on the basis of the original idea of Heisenberg on the quasiclassical picture of extended particle interactions one can construct a satisfactory description of the total cross sections, elastic cross sections, elastic diffractive slopes and mean charged multiplicities in the cm energy range from 5 to 900 GeV, and produce reasonable extrapolations up to several tens of TeV. 14 refs.; 7 figs.; 2 tabs
Tachyonic ionization cross sections of hydrogenic systems
Energy Technology Data Exchange (ETDEWEB)
Tomaschitz, Roman [Department of Physics, Hiroshima University, 1-3-1 Kagami-yama, Higashi-Hiroshima 739-8526 (Japan)
2005-03-11
Transition rates for induced and spontaneous tachyon radiation in hydrogenic systems as well as the transversal and longitudinal ionization cross sections are derived. We investigate the interaction of the superluminal radiation field with matter in atomic bound-bound and bound-free transitions. Estimates are given for Ly-{alpha} transitions effected by superluminal quanta in hydrogen-like ions. The tachyonic photoelectric effect is scrutinized, in the Born approximation and at the ionization threshold. The angular maxima occur at different scattering angles in the transversal and longitudinal cross sections, which can be used to sift out longitudinal tachyonic quanta in a photon flux. We calculate the tachyonic ionization and recombination cross sections for Rydberg states and study their asymptotic scaling with respect to the principal quantum number. At the ionization threshold of highly excited states of order n {approx} 10{sup 4}, the longitudinal cross section starts to compete with photoionization, in recombination even at lower levels.
Symmetric charge transfer cross section of uranium
International Nuclear Information System (INIS)
Shibata, Takemasa; Ogura, Koichi
1995-03-01
Symmetric charge transfer cross section of uranium was calculated under consideration of reaction paths. In the charge transfer reaction a d 3/2 electron in the U atom transfers into the d-electron site of U + ( 4 I 9/2 ) ion. The J value of the U atom produced after the reaction is 6, 5, 4 or 3, at impact energy below several tens eV, only resonant charge transfer in which the product atom is ground state (J=6) takes place. Therefore, the cross section is very small (4-5 x 10 -15 cm 2 ) compared with that considered so far. In the energy range of 100-1000eV the cross section increases with the impact energy because near resonant charge transfer in which an s-electron in the U atom transfers into the d-electron site of U + ion. Charge transfer cross section between U + in the first excited state (289 cm -1 ) and U in the ground state was also obtained. (author)
Cross-border shopping and tourism destination marketing
DEFF Research Database (Denmark)
Makkonen, Teemu
2016-01-01
This article addresses the economic impact that cross-border shopping has on the local tourism industry and the ways that cross-border shopping is taken advantage of in tourism destination marketing. Southern Jutland–situated in Denmark just north of the German border, where border shops situated......-border shopping into tourism destination marketing strategies. The results have wider relevance for other border regions.......This article addresses the economic impact that cross-border shopping has on the local tourism industry and the ways that cross-border shopping is taken advantage of in tourism destination marketing. Southern Jutland–situated in Denmark just north of the German border, where border shops situated...... just south of the same border enable Danes to capitalize on the lower value added tax levels in Germany–is utilized as an illustrative case example. The data was collected by analysing the relevant tourism destination marketing material and via interviews with local destination marketing organizations...
2014-01-01
Background As the diversity of the European population evolves, measuring providers’ skillfulness in cross-cultural care and understanding what contextual factors may influence this is increasingly necessary. Given limited information about differences in cultural competency by provider role, we compared cross-cultural skillfulness between physicians and nurses working at a Swiss university hospital. Methods A survey on cross-cultural care was mailed in November 2010 to front-line providers in Lausanne, Switzerland. This questionnaire included some questions from the previously validated Cross-Cultural Care Survey. We compared physicians’ and nurses’ mean composite scores and proportion of “3-good/4-very good” responses, for nine perceived skillfulness items (4-point Likert-scale) using the validated tool. We used linear regression to examine how provider role (physician vs. nurse) was associated with composite skillfulness scores, adjusting for demographics (gender, non-French dominant language), workplace (time at institution, work-unit “sensitized” to cultural-care), reported cultural-competence training, and cross-cultural care problem-awareness. Results Of 885 questionnaires, 368 (41.2%) returned the survey: 124 (33.6%) physicians and 244 (66.4%) nurses, reflecting institutional distribution of providers. Physicians had better mean composite scores for perceived skillfulness than nurses (2.7 vs. 2.5, p cross-cultural training (β = 0.14, p = 0.01) and lack of practical experience caring for diverse populations (β = 0.11, p = 0.04). In stratified analyses among physicians alone, having French as a dominant language (β = −0.34, p cross-cultural skills training with an inter-professional focus on nurses, education that attunes provider awareness to the local issues in cross-cultural care, and increased diversity efforts in the work force, particularly among physicians. PMID:24479405
Casillas, Alejandra; Paroz, Sophie; Green, Alexander R; Wolff, Hans; Weber, Orest; Faucherre, Florence; Ninane, Françoise; Bodenmann, Patrick
2014-01-30
As the diversity of the European population evolves, measuring providers' skillfulness in cross-cultural care and understanding what contextual factors may influence this is increasingly necessary. Given limited information about differences in cultural competency by provider role, we compared cross-cultural skillfulness between physicians and nurses working at a Swiss university hospital. A survey on cross-cultural care was mailed in November 2010 to front-line providers in Lausanne, Switzerland. This questionnaire included some questions from the previously validated Cross-Cultural Care Survey. We compared physicians' and nurses' mean composite scores and proportion of "3-good/4-very good" responses, for nine perceived skillfulness items (4-point Likert-scale) using the validated tool. We used linear regression to examine how provider role (physician vs. nurse) was associated with composite skillfulness scores, adjusting for demographics (gender, non-French dominant language), workplace (time at institution, work-unit "sensitized" to cultural-care), reported cultural-competence training, and cross-cultural care problem-awareness. Of 885 questionnaires, 368 (41.2%) returned the survey: 124 (33.6%) physicians and 244 (66.4%) nurses, reflecting institutional distribution of providers. Physicians had better mean composite scores for perceived skillfulness than nurses (2.7 vs. 2.5, p cross-cultural training (β = 0.14, p = 0.01) and lack of practical experience caring for diverse populations (β = 0.11, p = 0.04). In stratified analyses among physicians alone, having French as a dominant language (β = -0.34, p cultural competency improvement among providers. These results support the need for cross-cultural skills training with an inter-professional focus on nurses, education that attunes provider awareness to the local issues in cross-cultural care, and increased diversity efforts in the work force, particularly among physicians.
National Oceanic and Atmospheric Administration, Department of Commerce — PIFSC and Scripps Institution of Oceanography (SIO) conducted passive acoustic monitoring for cetaceans at Cross Seamount in 2005 and 2006 using a High-Frequency...
The Benefits and Risks of CrossFit: A Systematic Review.
Meyer, Jena; Morrison, Janet; Zuniga, Julie
2017-12-01
With the increase in popularity of the CrossFit exercise program, occupational health nurses may be asked questions about the appropriateness of CrossFit training for workers. This systematic literature review was conducted to analyze the current research on CrossFit, and assess the benefits and risks of this exercise strategy. Thirteen studies ( N = 2,326 participants) examined the use of CrossFit training among adults; CrossFit is comparable to other exercise programs with similar injury rates and health outcomes. Occupational health nurses should assess previous injuries prior to recommending this form of exercise. Ideal candidates for CrossFit are adults who seek high-intensity exercise with a wide variety of exercise components.
Fitness-valley crossing with generalized parent-offspring transmission.
Osmond, Matthew M; Otto, Sarah P
2015-11-01
Simple and ubiquitous gene interactions create rugged fitness landscapes composed of coadapted gene complexes separated by "valleys" of low fitness. Crossing such fitness valleys allows a population to escape suboptimal local fitness peaks to become better adapted. This is the premise of Sewall Wright's shifting balance process. Here we generalize the theory of fitness-valley crossing in the two-locus, bi-allelic case by allowing bias in parent-offspring transmission. This generalization extends the existing mathematical framework to genetic systems with segregation distortion and uniparental inheritance. Our results are also flexible enough to provide insight into shifts between alternate stable states in cultural systems with "transmission valleys". Using a semi-deterministic analysis and a stochastic diffusion approximation, we focus on the limiting step in valley crossing: the first appearance of the genotype on the new fitness peak whose lineage will eventually fix. We then apply our results to specific cases of segregation distortion, uniparental inheritance, and cultural transmission. Segregation distortion favouring mutant alleles facilitates crossing most when recombination and mutation are rare, i.e., scenarios where crossing is otherwise unlikely. Interactions with more mutable genes (e.g., uniparental inherited cytoplasmic elements) substantially reduce crossing times. Despite component traits being passed on poorly in the previous cultural background, small advantages in the transmission of a new combination of cultural traits can greatly facilitate a cultural transition. While peak shifts are unlikely under many of the common assumptions of population genetic theory, relaxing some of these assumptions can promote fitness-valley crossing. Copyright © 2015 Elsevier Inc. All rights reserved.
Signal Digitizer and Cross-Correlation Application Specific Integrated Circuit
Baranauskas, Dalius (Inventor); Baranauskas, Gytis (Inventor); Zelenin, Denis (Inventor); Kangaslahti, Pekka (Inventor); Tanner, Alan B. (Inventor); Lim, Boon H. (Inventor)
2017-01-01
According to one embodiment, a cross-correlator comprises a plurality of analog front ends (AFEs), a cross-correlation circuit and a data serializer. Each of the AFEs comprises a variable gain amplifier (VGA) and a corresponding analog-to-digital converter (ADC) in which the VGA receives and modifies a unique analog signal associates with a measured analog radio frequency (RF) signal and the ADC produces digital data associated with the modified analog signal. Communicatively coupled to the AFEs, the cross-correlation circuit performs a cross-correlation operation on the digital data produced from different measured analog RF signals. The data serializer is communicatively coupled to the summing and cross-correlating matrix and continuously outputs a prescribed amount of the correlated digital data.
CVTresh: R Package for Level-Dependent Cross-Validation Thresholding
Directory of Open Access Journals (Sweden)
Donghoh Kim
2006-04-01
Full Text Available The core of the wavelet approach to nonparametric regression is thresholding of wavelet coefficients. This paper reviews a cross-validation method for the selection of the thresholding value in wavelet shrinkage of Oh, Kim, and Lee (2006, and introduces the R package CVThresh implementing details of the calculations for the procedures. This procedure is implemented by coupling a conventional cross-validation with a fast imputation method, so that it overcomes a limitation of data length, a power of 2. It can be easily applied to the classical leave-one-out cross-validation and K-fold cross-validation. Since the procedure is computationally fast, a level-dependent cross-validation can be developed for wavelet shrinkage of data with various sparseness according to levels.
CVTresh: R Package for Level-Dependent Cross-Validation Thresholding
Directory of Open Access Journals (Sweden)
Donghoh Kim
2006-04-01
Full Text Available The core of the wavelet approach to nonparametric regression is thresholding of wavelet coefficients. This paper reviews a cross-validation method for the selection of the thresholding value in wavelet shrinkage of Oh, Kim, and Lee (2006, and introduces the R package CVThresh implementing details of the calculations for the procedures.This procedure is implemented by coupling a conventional cross-validation with a fast imputation method, so that it overcomes a limitation of data length, a power of 2. It can be easily applied to the classical leave-one-out cross-validation and K-fold cross-validation. Since the procedure is computationally fast, a level-dependent cross-validation can be developed for wavelet shrinkage of data with various sparseness according to levels.
The validity of vignettes in cross country health studies
DEFF Research Database (Denmark)
Pozzoli, Dario; Gupta, Nabanita Datta; Kristensen, Nicolai
Cross-country comparisons of subjective assessments may be ham-pered by sub-population speci.c response style. To correct for this, the use of vignettes has become increasingly popular - notably within cross-country health studies. However, the validity of vignettes as a means to re-scale across ...... that the assumption of RC is not innocous and that our extended model improves the fit and significantly changes the cross-country rankings of health vis-á-vis the standard Chopit model.......Cross-country comparisons of subjective assessments may be ham-pered by sub-population speci.c response style. To correct for this, the use of vignettes has become increasingly popular - notably within cross-country health studies. However, the validity of vignettes as a means to re-scale across...
Temperature-dependent absorption cross sections for hydrogen peroxide vapor
Nicovich, J. M.; Wine, P. H.
1988-01-01
Relative absorption cross sections for hydrogen peroxide vapor were measured over the temperature ranges 285-381 K for lambda = 230 nm-295 nm and 300-381 K for lambda = 193 nm-350 nm. The well established 298 K cross sections at 202.6 and 228.8 nm were used as an absolute calibration. A significant temperature dependence was observed at the important tropospheric photolysis wavelengths lambda over 300 nm. Measured cross sections were extrapolated to lower temperatures, using a simple model which attributes the observed temperature dependence to enhanced absorption by molecules possessing one quantum of O-O stretch vibrational excitation. Upper tropospheric photodissociation rates calculated using the extrapolated cross sections are about 25 percent lower than those calculated using currently recommended 298 K cross sections.
National CrossTalk. Volume 17, Number 2
Trombley, William, Ed.
2009-01-01
"National CrossTalk" is a publication of the National Center for Public Policy and Higher Education. The National Center promotes public policies that enhance opportunities for quality education and training beyond high school. The primary purpose of "National CrossTalk" is to stimulate informed discussion and debate of higher…
National CrossTalk. Volume 18, Number 2
National Center for Public Policy and Higher Education, 2010
2010-01-01
"National CrossTalk" is a publication of the National Center for Public Policy and Higher Education. The National Center promotes public policies that enhance opportunities for quality education and training beyond high school. The primary purpose of "National CrossTalk" is to stimulate informed discussion and debate of higher…
National CrossTalk. Volume 18, Number 1
National Center for Public Policy and Higher Education, 2010
2010-01-01
"National CrossTalk" is a publication of the National Center for Public Policy and Higher Education. The National Center promotes public policies that enhance opportunities for quality education and training beyond high school. The primary purpose of "National CrossTalk" is to stimulate informed discussion and debate of higher…
National CrossTalk. Volume 19, Number 1
National Center for Public Policy and Higher Education, 2011
2011-01-01
"National CrossTalk" is a publication of the National Center for Public Policy and Higher Education. The National Center promotes public policies that enhance opportunities for quality education and training beyond high school. The primary purpose of "National CrossTalk" is to stimulate informed discussion and debate of higher…
First measurement of the Rayleigh cross section
Naus, H.; Ubachs, W.
2000-01-01
Rayleigh cross section for N2, Ar and SF6 was performed using the technique of cavity ring-down spectroscopy (CRDS). The experiment was based on the assumption that scattering cross section is equal to the extinction in the absence of absorption. The theory explains the molecular origin of
Advertising and Marketing in Cross-Functional Instruction.
Treise, Debbie; Schumann, David
1995-01-01
States that advertising educators have been concerned with the lack of cooperation between advertising and marketing disciplines. Describes a cross-functional educational experiment in which two instructors (one from marketing and one from advertising) formed cross-functional teams for two projects. Concludes that the experiment was successful,…
The development of cross-border economic relations
van Houtum, H.J.
1998-01-01
This dissertation investigates the influence of a state border on the development of cross-border economic relations in the European Union. The focus is on the frequency, number, and success of cross-border relations between firms in the border regions of the Netherlands and Belgium. The study fills
Hidden cross-correlation patterns in stock markets based on permutation cross-sample entropy and PCA
Lin, Aijing; Shang, Pengjian; Zhong, Bo
2014-12-01
In this article, we investigate the hidden cross-correlation structures in Chinese stock markets and US stock markets by performing PCSE combined with PCA approach. It is suggested that PCSE can provide a more faithful and more interpretable description of the dynamic mechanism between time series than cross-correlation matrix. We show that this new technique can be adapted to observe stock markets especially during financial crisis. In order to identify and compare the interactions and structures of stock markets during financial crisis, as well as in normal periods, all the samples are divided into four sub-periods. The results imply that the cross-correlations between Chinese group are stronger than the US group in the most sub-periods. In particular, it is likely that the US stock markets are more integrated with each other during global financial crisis than during Asian financial crisis. However, our results illustrate that Chinese stock markets are not immune from the global financial crisis, although less integrated with other markets if they are compared with US stock markets.
Modelisation of the fission cross section
International Nuclear Information System (INIS)
Morariu, Claudia
2013-03-01
The neutron cross sections of four nuclear systems (n+ 235 U, n+ 233 U, n+ 241 Am and n+ 237 Np) are studied in the present document. The target nuclei of the first case, like 235 U and 239 Pu, have a large fission cross section after the absorption of thermal neutrons. These nuclei are called 'fissile' nuclei. The other type of nuclei, like 237 Np and 241 Am, fission mostly with fast neutrons, which exceed the fission threshold energy. These types of nuclei are called 'fertile'. The compound nuclei of the fertile nuclei have a binding energy higher than the fission barrier, while for the fissile nuclei the binding energy is lower than the fission barrier. In this work, the neutron induced cross sections for both types of nuclei are evaluated in the fast energy range. The total, reaction and shape-elastic cross sections are calculated by the coupled channel method of the optical model code ECIS, while the compound nucleus mechanism are treated by the statistical models implemented in the codes STATIS, GNASH and TALYS. The STATIS code includes a refined model of the fission process. Results from the theoretical calculations are compared with data retrieved from the experimental data base EXFOR. (author) [fr
DNA cross-linking by dehydromonocrotaline lacks apparent base sequence preference.
Rieben, W Kurt; Coulombe, Roger A
2004-12-01
Pyrrolizidine alkaloids (PAs) are ubiquitous plant toxins, many of which, upon oxidation by hepatic mixed-function oxidases, become reactive bifunctional pyrrolic electrophiles that form DNA-DNA and DNA-protein cross-links. The anti-mitotic, toxic, and carcinogenic action of PAs is thought to be caused, at least in part, by these cross-links. We wished to determine whether the activated PA pyrrole dehydromonocrotaline (DHMO) exhibits base sequence preferences when cross-linked to a set of model duplex poly A-T 14-mer oligonucleotides with varying internal and/or end 5'-d(CG), 5'-d(GC), 5'-d(TA), 5'-d(CGCG), or 5'-d(GCGC) sequences. DHMO-DNA cross-links were assessed by electrophoretic mobility shift assay (EMSA) of 32P endlabeled oligonucleotides and by HPLC analysis of cross-linked DNAs enzymatically digested to their constituent deoxynucleosides. The degree of DNA cross-links depended upon the concentration of the pyrrole, but not on the base sequence of the oligonucleotide target. Likewise, HPLC chromatograms of cross-linked and digested DNAs showed no discernible sequence preference for any nucleotide. Added glutathione, tyrosine, cysteine, and aspartic acid, but not phenylalanine, threonine, serine, lysine, or methionine competed with DNA as alternate nucleophiles for cross-linking by DHMO. From these data it appears that DHMO exhibits no strong base preference when forming cross-links with DNA, and that some cellular nucleophiles can inhibit DNA cross-link formation.
Reactive electrospinning and biodegradation of cross-linked methacrylated polycarbonate nanofibers
Energy Technology Data Exchange (ETDEWEB)
Wu Ruizhi; Zhang Jianfeng; Fan Yuwei; Xu Xiaoming [Department of Comprehensive Dentistry and Biomaterials, Louisiana State University Health Sciences Center, 1100 Florida Avenue, Box 137, New Orleans, LA 70119 (United States); Stoute, Diana; Lallier, Thomas, E-mail: xxu@lsuhsc.edu [Department of Cell Biology and Anatomy, Louisiana State University Health Science Center, 1100 Florida Avenue, Box 137, New Orleans, LA 70119 (United States)
2011-06-15
The objectives of this study were to fabricate cross-linked biodegradable polycarbonate nanofibers and to investigate their biodegradability by different enzymes. Poly(2,3-dihydroxycarbonate) was synthesized from naturally occurring l-tartaric acid. The hydroxyl groups on the functional polycarbonate were converted to methacrylate groups to enable the polymer to cross-link under UV irradiation. Smooth cross-linked methacrylated polycarbonate nanofibers (300-1800 nm) were fabricated by a reactive electrospinning process with in situ UV radiation from a mixed solution of linear methacrylated polycarbonate (MPC) and poly(ethylene oxide) (PEO) (MPC:PEO = 9:1) in methanol/chloroform (50/50). These cross-linked nanofibers have shown excellent solvent resistance and their solubility decreases with increasing degree of cross-linking. The thermal properties of linear and cross-linked polycarbonate nanofibers were investigated by differential scanning calorimetry and thermogravimetric analysis. The cross-linked polycarbonate nanofibers show no melting point below 200 {sup 0}C and their decomposition temperature increases with increasing cross-linking degree. Their biodegradation products by five different enzymes were analyzed using liquid chromatography-mass spectrometry (LC-MS). The biodegradability of the polycarbonate nanofibers decreases with increasing cross-linking degree. These nanofibers were found to support human fibroblast survival and to promote cell attachment. This study demonstrates that cross-linked biodegradable polycarbonate nanofibers with different chemical properties and biodegradability can be fabricated using the novel reactive electrospinning technology to meet the needs of different biomedical applications.
Distortion dependent intersystem crossing
DEFF Research Database (Denmark)
Stephansen, Anne Boutrup; Sølling, Theis Ivan
2017-01-01
. The effect is observed to increase in the presence of methyl-groups on the pinnacle carbon-atoms, where largest extents of r and p orbital-mixing are observed. This is fully consistent with the time-resolved spectroscopy data: Toluene and p-xylene show evidence for ultrafast triplet formation competing......The competition between ultrafast intersystem crossing and internal conversion in benzene, toluene, and p-xylene is investigated with time-resolved photoelectron spectroscopy and quantum chemical calculations. By exciting to S2 out-of-plane symmetry breaking, distortions are activated at early...... times whereupon spin-forbidden intersystem crossing becomes (partly) allowed. Natural bond orbital analysis suggests that the pinnacle carbon atoms distorting from the aromatic plane change hybridization between the planar Franck-Condon geometry and the deformed (boat-shaped) S2 equilibrium geometry...
14 CFR 61.93 - Solo cross-country flight requirements.
2010-01-01
... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Solo cross-country flight requirements. 61... Solo cross-country flight requirements. (a) General. (1) Except as provided in paragraph (b) of this section, a student pilot must meet the requirements of this section before— (i) Conducting a solo cross...
Crossing statistics of laser light scattered through a nanofluid.
Arshadi Pirlar, M; Movahed, S M S; Razzaghi, D; Karimzadeh, R
2017-09-01
In this paper, we investigate the crossing statistics of speckle patterns formed in the Fresnel diffraction region by a laser beam scattering through a nanofluid. We extend zero-crossing statistics to assess the dynamical properties of the nanofluid. According to the joint probability density function of laser beam fluctuation and its time derivative, the theoretical frameworks for Gaussian and non-Gaussian regimes are revisited. We count the number of crossings not only at zero level but also for all available thresholds to determine the average speed of moving particles. Using a probabilistic framework in determining crossing statistics, a priori Gaussianity is not essentially considered; therefore, even in the presence of deviation from Gaussian fluctuation, this modified approach is capable of computing relevant quantities, such as mean value of speed, more precisely. Generalized total crossing, which represents the weighted summation of crossings for all thresholds to quantify small deviation from Gaussian statistics, is introduced. This criterion can also manipulate the contribution of noises and trends to infer reliable physical quantities. The characteristic time scale for having successive crossings at a given threshold is defined. In our experimental setup, we find that increasing sample temperature leads to more consistency between Gaussian and perturbative non-Gaussian predictions. The maximum number of crossings does not necessarily occur at mean level, indicating that we should take into account other levels in addition to zero level to achieve more accurate assessments.
Exertional and CrossFit-Induced Rhabdomyolysis.
Meyer, Michelle; Sundaram, Sneha; Schafhalter-Zoppoth, Ingeborg
2017-07-14
Few publications of exercise-induced rhabomyolysis currently exist in the medical literature besides case reports. However, this condition can be severe, resulting in hospitalization and IV fluid administration to prevent serious sequelae. This report describes a case of exercise-induced rhabdomyolysis caused by a CrossFit workout. A 31-year-old female presented with 2 days of bilateral upper extremity pain and soreness, which began 2 days after she completed a CrossFit workout. Workup revealed an elevated creatine phosphokinase (CPK) of 18 441 U/L, consistent with exercise-induced rhabdomyolysis, and elevated liver function tests and elevated D-dimer, although her renal function was normal. She was hospitalized for 2 days and treated with IV fluids. This case report demonstrates that CrossFit exercises can lead to rhabdomyolysis, highlighting a condition that may be underdiagnosed and underreported.
NNLO jet cross sections by subtraction
Energy Technology Data Exchange (ETDEWEB)
Somogyi, G.; Bolzoni, P. [DESY, Platanenallee 6, D-15738 Zeuthen (Germany); Trocsanyi, Z. [CERN PH-TH, on leave from University of Debrecen and Institute of Nuclear Research of HAS, H-4001 P.O.Box 51 (Hungary)
2010-08-15
We report on the computation of a class of integrals that appear when integrating the so-called iterated singly-unresolved approximate cross section of the NNLO subtraction scheme of Refs. [G. Somogyi, Z. Trocsanyi, and V. Del Duca, JHEP 06, 024 (2005), (arXiv:hep-ph/0502226); G. Somogyi and Z. Trocsanyi, (2006), (arXiv:hep-ph/0609041); G. Somogyi, Z. Trocsanyi, and V. Del Duca, JHEP 01, 070 (2007), (arXiv:hep-ph/0609042); G. Somogyi and Z. Trocsanyi, JHEP 01, 052 (2007), (arXiv:hep-ph/0609043)] over the factorised phase space of unresolved partons. The integrated approximate cross section itself can be written as the product of an insertion operator (in colour space) times the Born cross section. We give selected results for the insertion operator for processes with two and three hard partons in the final state.
NNLO jet cross sections by subtraction
International Nuclear Information System (INIS)
Somogyi, G.; Bolzoni, P.; Trocsanyi, Z.
2010-01-01
We report on the computation of a class of integrals that appear when integrating the so-called iterated singly-unresolved approximate cross section of the NNLO subtraction scheme of Refs. [G. Somogyi, Z. Trocsanyi, and V. Del Duca, JHEP 06, 024 (2005), (arXiv:hep-ph/0502226); G. Somogyi and Z. Trocsanyi, (2006), (arXiv:hep-ph/0609041); G. Somogyi, Z. Trocsanyi, and V. Del Duca, JHEP 01, 070 (2007), (arXiv:hep-ph/0609042); G. Somogyi and Z. Trocsanyi, JHEP 01, 052 (2007), (arXiv:hep-ph/0609043)] over the factorised phase space of unresolved partons. The integrated approximate cross section itself can be written as the product of an insertion operator (in colour space) times the Born cross section. We give selected results for the insertion operator for processes with two and three hard partons in the final state.
Cross-media within the Facebook newsfeed
DEFF Research Database (Denmark)
Mathieu, David; Pavlíčková, Tereza
2017-01-01
This study investigates the role of interpretation in cross-media uses. Highlighting the specificity of cross-media uses within meta-media environments such as Facebook, we argue that interpretative processes play a crucial role in the formation of cross-media repertoires. The methodology relies...... on a reception analysis for which we conducted interviews with eleven expatriates using Facebook on a daily basis, in conjunction with a commented consultation of their newsfeed. In the analysis, we show that reading Facebook’s newsfeed is an activity that contributes to the construction of the user’s mediated...... lifeworld. Schutz’s phenomenological approach allows us to explore how users develop reading strategies to typify their experience of the social world within Facebook, to maintain the relevance of their newsfeed and to negotiate the technological features of Facebook, shedding light on how users assemble...
Rojon, C; McDowall, A
2010-01-01
This paper outlines a cross-validation of the Cultural Orientations Framework assessment questionnaire\\ud (COF, Rosinski, 2007; a new tool designed for cross-cultural coaching) with the Saville Consulting\\ud Wave Focus Styles questionnaire (Saville Consulting, 2006; an existing validated measure of\\ud occupational personality), using data from UK and German participants (N = 222). The convergent and\\ud divergent validity of the questionnaire was adequate. Contrary to previous findings which u...
Indonesian Students’ Cross-Cultural Adaptation in Busan, Korea
Directory of Open Access Journals (Sweden)
Deddy Mulyana
2017-05-01
Full Text Available This study aims to explore the cross-cultural adaptation of Indonesian students in Busan, South Korea. It uses a qualitative approach based on the U-curve (a four-stage model of cross-cultural adjustment consisting of the phases of honeymoon, crisis, recovery and adjustment. It involves in-depth interviews with 10 Indonesian students in Busan. The study found that the U-Curve model of cross-cultural adaptation is still useful. In the context of the informants’ experiences, it is characterized by the main barriers that include differences in language and values of friendship, cross-cultural stereotypes and prejudices that led to discrimination. The study also identified culture shock faced by some of the informants as well as their coping strategies.
Indonesian Students’ Cross-Cultural Adaptation in Busan, Korea
Directory of Open Access Journals (Sweden)
Deddy Mulyana
2017-01-01
Full Text Available This study aims to explore the cross-cultural adaptation of Indonesian students in Busan, South Korea. It uses a qualitative approach based on the U-curve (a four-stage model of cross-cultural adjustment consisting of the phases of honeymoon, crisis, recovery and adjustment. It involves in-depth interviews with 10 Indonesian students in Busan. The study found that the U-Curve model of cross-cultural adaptation is still useful. In the context of the informants’ experiences, it is characterized by the main barriers that include differences in language and values of friendship, cross-cultural stereotypes and prejudices that led to discrimination. The study also identified culture shock faced by some of the informants as well as their coping strategies.
Triandis, Harry C.; Brislin, Richard W.
Cross-Cultural psychology refers to the collective efforts of researchers who work among people who live in different societies, with different languages and different forms of government. There are a number of benefits to the study of human behavior which can be accrued by carrying out research in various cultures, largely concerned with better…
Hardon cross sections at ultra high energies
International Nuclear Information System (INIS)
Yodh, G.B.
1987-01-01
A review of results on total hadronic cross sections at ultra high energies obtained from a study of longitudinal development of cosmic ray air showers is given. The experimental observations show that proton-air inelastic cross section increases from 275 mb to over 500 mb as the collision energy in the center of mass increases from 20 GeV to 20 TeV. The proton-air inelastic cross section, obtained from cosmic ray data at √s = 30 TeV, is compared with calculations using various different models for the energy variation of the parameters of the elementary proton-proton interaction. Three conclusions are derived
A theory of cross-validation error
Turney, Peter D.
1994-01-01
This paper presents a theory of error in cross-validation testing of algorithms for predicting real-valued attributes. The theory justifies the claim that predicting real-valued attributes requires balancing the conflicting demands of simplicity and accuracy. Furthermore, the theory indicates precisely how these conflicting demands must be balanced, in order to minimize cross-validation error. A general theory is presented, then it is developed in detail for linear regression and instance-bas...
Analysis of vehicle dynamics under sadden cross wind
Walczak, S.
2016-09-01
In this paper, the way of calculating aerodynamic forces acting on a vehicle passing in the region of sadden cross wind was presented. The CarDyn, a vehicle dynamics simulation program, developed by the author was used. The effects of the cross wind were studied with a fixed steering wheel simulation. On the base of computer simulations the car cross wind sensitivity were determined, and vehicle responses such as lateral offset, side acceleration and yaw angular velocity are presented.
26 CFR 1.807-2 - Cross-reference.
2010-04-01
... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Cross-reference. 1.807-2 Section 1.807-2 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Investment Income § 1.807-2 Cross-reference. For special rules regarding the treatment of...
Total cross section results for deuterium electrodisintegration
International Nuclear Information System (INIS)
Skopik, D.M.; Murphy, J.J. II; Shin, Y.M.
1976-01-01
Theoretical total cross sections for deuterium electrodisintegration are presented as a function of incident electron energy. The cross section has been calculated using virtual photon theory with Partovi's photodisintegration calculation for E/subx/ > 10 MeV and effective range theory for E/subx/ 2 H(e, n) reaction in Tokamak reactors
Agricultural sprays in cross-flow and drift
DEFF Research Database (Denmark)
Farooq, M.; Balachandar, R.; Wulfsohn, Dvoralai
2001-01-01
The droplet size and velocity characteristics of an agricultural spray were studied in a wind tunnel in the presence of a non-uniform cross-flow. The spray was generated at three nozzle-operating pressures. The droplet size and velocity was measured in both the cross-flow direction and the vertical...
Cross-Border Banking in Europe : What's Next?
Allen, F.; Beck, T.H.L.; Carletti, E.; Lane, P.; Schoenmaker, D.; Wagner, W.B.
2011-01-01
Understanding the role of banks in cross-border finance has become an urgent priority. Cross-border banks have played a central role in the dynamics of the global crisis of 2007-2009. First, European banks had a surprisingly large exposure to the US securitised asset markets, which arose to a
Hydrogels Prepared from Cross-Linked Nanofibrillated Cellulose
Sandeep S. Nair; J.Y. Zhu; Yulin Deng; Arthur J. Ragauskas
2014-01-01
Nanocomposite hydrogels were developed by cross-linking nanofibrillated cellulose with poly(methyl vinyl ether-co-maleic acid) and polyethylene glycol. The cross-linked hydrogels showed enhanced water absorption and gel content with the addition of nanocellulose. In addition, the thermal stability, mechanical strength, and modulus increased with an increase in the...
Measuring cross-border travel times for freight : Otay Mesa international border crossing.
2010-09-01
Cross border movement of people and goods is a vital part of the North American economy. Accurate real-time data on travel times along the US-Mexico border can help generate a range of tangible benefits covering improved operations and security, lowe...
Analysis of Pedestrian Gap Acceptance and Crossing Decision in Kuala Lumpur
Directory of Open Access Journals (Sweden)
Mohamad Nor Siti Naquiyah
2017-01-01
Full Text Available Pedestrians are most vulnerable of all road users. This research aims to investigate and model pedestrian road crossing behaviour at crossing facilities. In particular, they have two aspects of pedestrians crossing behaviour are examined, namely the size of traffic gaps acceptance by pedestrians and the decision of pedestrians either to cross the road or not. A fields survey was carried out at six crossing facilities which from a zebra crossing at midblock. In this survey, the data were recorded in real traffic condition using video recorder. Determine the associations between characteristics of pedestrians, crossing facilities and vehicular traffic through on-site observations of pedestrian behaviour. This data will analysis using statistical analysis which is multiple regression and binary logit regression method. It is hope that through this research, the model of pedestrian gap acceptance and pedestrian crossing decision can be reached and what are the indicators that pedestrians look for when accepting gaps to cross the road.
Manufacture of polyethylene foam by electron beam cross-linking
International Nuclear Information System (INIS)
Tamai, Isamu
1976-01-01
The manufacturing process of polyethylene foam, comparison between electron beam cross-linking process and chemical cross-linking process, the electron beam irradiation technique for continuous sheets, the characteristics and uses of polyethylene foam are reviewed. The pore diameter can be controlled by selecting the dose rate, because there is strong relationship between the pore diameter and the dose rate. As the dose if higher, the foam becomes finer. The electron accelerators having large capacity show the lowest cost as the radiation source, and are applicable industrially. If the production capacity exceeds about 200 tons per month, the costs of electron beam irradiation process may be more advantageous than that of chemical process according to the circumstances. It is difficult to obtain the uniform distribution of absorption dose in the direction of thickness. General characteristics of cross-linked polyethylene foam are listed. The special feature of electron beam process is that the degree of cross-linking can be controlled arbitrarily before foaming. The products obtained by the electron beam cross-linking process have finer foams and smoother surfaces than those obtained by the chemical process, because the separation of the decomposition of foaming agents from that of cross-linking agents in the chemical cross-linking is difficult. (Iwakiri, K.)
Composition of cross-linked 125I-follitropin-receptor complexes
Energy Technology Data Exchange (ETDEWEB)
Shin, J.; Ji, T.H.
1985-10-15
Both of the alpha and beta subunits of intact human follitropin (FSH) were radioiodinated with SVI-sodium iodide and chloramine-T and could be resolved on sodium dodecyl sulfate-polyacrylamide gels. Radioiodinated FSH was affinity-cross-linked with a cleavable (nondisulfide) homobifunctional reagent to its membrane receptor on the porcine granulosa cell surface as well as to a Triton X-100-solubilized form of the receptor. Cross-linked samples revealed three additional bands of slower electrophoretic mobility, corresponding to 65, 83, and 117 kDa, in addition to the hormone bands. The hormone alpha beta dimer band corresponded to 43 kDa. Formation of the three bands requires the SVI-hormone to bind specifically to the receptor with subsequent cross-linking. Binding was prevented by an excess of the native hormone but not by other hormones. A monofunctional analog of the cross-linking reagent failed to produce the three bands. Reagent concentration-dependent cross-linking revealed that their formation was sequential; smaller complexes formed first and then larger ones. When gels of cross-linked complexes were treated to cleave covalent cross-links and then electrophoresed in a second dimension, 18-, 22-, and 34-kDa components were released, in addition to the alpha and beta subunits of the hormone.
Revising and Updating the Inventory of Cross-Cultural Sensitivity
Mahon, Jennifer A.; Cushner, Kenneth
2014-01-01
The following article outlines research conducted to examine cross-cultural sensitivity in a sample of 949 incoming university students in the USA. The study was conducted during the process of updating an existing measure of cross-cultural sensitivity known as the Inventory of Cross-Cultural Sensitivity (ICCS), and to examine the various levels…
76 FR 5120 - Highway-Rail Grade Crossing; Safe Clearance
2011-01-28
... suggested that FMCSA should provide pavement markings and signage at or near grade crossings to indicate the... eligible for funding under 23 U.S.C. 130; (2) improvement of highway signage and pavement markings; and (3... crossings might get pavement markings and signage and that not all grade-crossing improvements are likely to...
Conditions that Influence Drivers' Yielding Behavior for Uncontrolled Crossings
Bourquin, Eugene; Emerson, Robert Wall; Sauerburger, Dona
2011-01-01
Pedestrians with visual impairments need to cross streets where traffic signals and traffic signage are not present. This study examined the influences of several interventions, including a pedestrian's use of a mobility cane, on the behavior of drivers when they were expected to yield to a pedestrian crossing at an uncontrolled crossing.…
Crossing Behaviour of Pedestrians Along Urban Streets in Malaysia
Directory of Open Access Journals (Sweden)
Al Bargi Walid A.
2017-01-01
Full Text Available Road crossings are considered as an unavoidable part of walking in which the desirable route of pedestrians interacts with vehicles. These interactions may expose the pedestrians to risks or delays. In Malaysia, road accident statistics show that pedestrian casualties are fairly high. Inappropriate gap acceptance when pedestrians cross roads is a main contributing element to this situation. In this context, the purpose of this study was to develop realistic models for pedestrian road crossing behaviour using the regression technique for mid-block street crossing. A choice model was produced to capture the decision making process of pedestrians whereas rejected or accepted vehicular gaps was based on the discrete choice theory. Gap acceptance data under real mix traffic conditions was collected using video camera on a typical unsignalised two lane one way urban street section in the city center of Kuala Lumpur, Malaysia. The lognormal regression model developed for the crossing behaviour model shows that traffic speed, pedestrian waiting time, gender, crossing distance, age group, frequency of attempts and pedestrian number are the significant factors which are able to predict 77.0% of variance or changes in accepted gap size at 0.05 significance level. Higher traffic speed, lower waiting time, being a male, wider crossing distance, older age group, lower frequency of attempts and higher number of pedestrian were found to influence pedestrians to accept a bigger gap size. The binary logistic regression developed for the crossing choice model was found to be influenced by traffic speed, driver yield, pedestrian number and age group. Furthermore, lower traffic speed, willingness of drivers to slow down, more pedestrian crossings at the same time and a younger age group lead to a higher chance or probability of crossing roads. The model was validated again using 100 isolated samples and an accuracy of 98% was obtained compared to the calibrated
Altered cross-bridge properties in skeletal muscle dystrophies
Directory of Open Access Journals (Sweden)
Aziz eGuellich
2014-10-01
Full Text Available Force and motion generated by skeletal muscle ultimately depends on the cyclical interaction of actin with myosin. This mechanical process is regulated by intracellular Ca2+ through the thin filament-associated regulatory proteins i.e.; troponins and tropomyosin. Muscular dystrophies are a group of heterogeneous genetic affections characterized by progressive degeneration and weakness of the skeletal muscle as a consequence of loss of muscle tissue which directly reduces the number of potential myosin cross-bridges involved in force production. Mutations in genes responsible for skeletal muscle dystrophies have been shown to modify the function of contractile proteins and cross-bridge interactions. Altered gene expression or RNA splicing or post-translational modifications of contractile proteins such as those related to oxidative stress, may affect cross-bridge function by modifying key proteins of the excitation-contraction coupling. Micro-architectural change in myofilament is another mechanism of altered cross-bridge performance. In this review, we provide an overview about changes in cross-bridge performance in skeletal muscle dystrophies and discuss their ultimate impacts on striated muscle function.
Parasitic crossing at an asymmetric B factory, APIARY
International Nuclear Information System (INIS)
Chin, Y.H.
1991-05-01
Effects of parasitic crossings (''near miss'' collisions of two counter-rotating beams at unwanted positions near the IP) are studied in terms of computer simulations for an asymmetric B Factory, APIARY- 6.3d. Beams are separated horizontally at the first parasitic crossing points by about 7.6 times the horizontal rms size of the low energy beam (the larger in size of the two beams), σ 0x,+ . Simulations, including both the beam collision at the IP and parasitic crossings, have been performed for different separation distances, d. It is found that the ratio d/σ 0x,+ is a good scaling parameter of beam blowup behavior. The results show that beam blowup due to the parasitic crossings is diminished for d ≥ 7σ 0x,+ , in agreement with the bunch separation experiment at CESR. Thus, the nominal separation 7.6 σ 0x,+ turns out to be acceptable, but with only a small margin. Some methods to mitigate the effects of the parasitic crossings are discussed. 3 refs. , 5 figs., 2 tabs
Electron-impact ionization cross section of rubidium
International Nuclear Information System (INIS)
Kim, Y.; Migdalek, J.; Siegel, W.; Bieron, J.
1998-01-01
A theoretical model for electron-impact ionization cross section has been applied to Rb and the theoretical cross section (from the threshold to 1 keV in incident energy) is in good agreement with the recent experimental data obtained using Rb atoms trapped in a magneto-optical trap. The theoretical model, called the binary-encounter endash dipole (BED) model, combines a modified Mott cross section with the high-energy behavior of Born cross sections. To obtain the continuum dipole oscillator strength df/dE of the 5s electron required in the BED model, we used Dirac-Fock continuum wave functions with a core polarization potential that reproduced the known position of the Cooper minimum in the photoionization cross section. For inner-shell ionization, we used a simpler version of df/dE, which retained the hydrogenic shape. The contributions of the 4p→4d, 5s, and 5p autoionizing excitations were estimated using the plane-wave Born approximation. As a by-product, we also present the dipole oscillator strengths for the 5s→np 1/2 and 5s→np 3/2 transitions for high principal quantum numbers n near the ionization threshold obtained from the Dirac-Fock wave functions with the same core polarization potential as that used for the continuum wave functions. copyright 1998 The American Physical Society
Dynamic analysis of cross shaft type universal joint with clearance
International Nuclear Information System (INIS)
Lu, Jian Wei; Wang, Gong Cheng; Chen, Hao; Vakakis, Alexander F.; Bergman, Lawrence A.
2013-01-01
Cross shaft type universal joint is widely used in ground vehicles to transfer torque between two intersecting axes, and its transmission feature can make a great contribution to NVH performance of the vehicle. We looked at the assembling clearance at cross shaft neck, and presented a dynamic model of cross shaft type universal joint with clearance at cross shaft neck. Two-state model is applied to describe the contact force between the cross shaft and driving joint fork based on Hertz theorem, and lumped mass method is applied to build up the dynamic model of the universal joint. Based on this model, numerical analysis is carried out to discuss the transmission feature of the universal joint with clearance at cross shaft neck, and the influence of clearance on the dynamic behavior of the system is evaluated with numerical results based on time history, power spectrum, and phase portrait. The method and conclusions presented are helpful to improvement of the transmission feature of cross shaft type universal joint.
Anomalous fermion number nonconservation: Paradoxes in the level crossing picture
International Nuclear Information System (INIS)
Burnier, Y.
2006-01-01
In theories with anomalous fermion number nonconservation, the level-crossing picture is considered a faithful representation of the fermionic quantum number variation. It represents each created fermion by an energy level that crosses the zero-energy line from below. If several fermions of various masses are created, the level-crossing picture contains several levels that cross the zero-energy line and cross each other. However, we know from quantum mechanics that the corresponding levels cannot cross if the different fermions are mixed via some interaction potential. The simultaneous application of these two requirements on the level behavior leads to paradoxes. For instance, a naive interpretation of the resulting level-crossing picture gives rise to charge nonconservation. In this paper, we resolve this paradox by a precise calculation of the transition probability, and discuss what are the implications for the electroweak theory. In particular, the nonperturbative transition probability is higher if top quarks are present in the initial state
Crossing safety barriers: influence of children's morphological and functional variables.
Cordovil, Rita; Vieira, Filomena; Barreiros, João
2012-05-01
Thirty-three children between 3 and 6 years of age were asked to climb four different types of safety barriers. Morphological and functional variables of the children, which were expected to influence climbing or passing through skills, were collected. The influence of those variables on children's success rate and time to cross was tested. No barrier offered a total restraining efficacy. The horizontal bars barrier was crossed by 97% of the children. In the group of children that succeeded in crossing the four barriers, mean time to cross the most difficult barrier was 15 s. Age was the best predictor for success in crossing most barriers but morphology and strength were important predictors of time to cross. The influence of anthropometric variables in time to cross was dependent upon the characteristics of the barrier. A good design of safety barriers should consider children's age, morphology and strength. Copyright © 2011 Elsevier Ltd and The Ergonomics Society. All rights reserved.
DEFF Research Database (Denmark)
Øhlenschlæger, Rasmus; Tønning, Charlotte; Andersen, Camilla Sloth
2018-01-01
In order to increase mobility and promote modal shift to walking, intersections in the city of Aarhus, Denmark, have been equipped with intelligent management of green light for pedestrians. This allows adjustment of green time based on radar detection of pedestrians in the crossing...... and prolongation of the green time for the pedestrians if required. The effect is examined in a before/after study of a two-stage pedestrian crossing with a centre refuge island in an intersection of four-lane roads. The data consists of responses from an on-site questionnaire including 72+53 individuals and 266...
Accuracy of multi-point boundary crossing time analysis
Directory of Open Access Journals (Sweden)
J. Vogt
2011-12-01
Full Text Available Recent multi-spacecraft studies of solar wind discontinuity crossings using the timing (boundary plane triangulation method gave boundary parameter estimates that are significantly different from those of the well-established single-spacecraft minimum variance analysis (MVA technique. A large survey of directional discontinuities in Cluster data turned out to be particularly inconsistent in the sense that multi-point timing analyses did not identify any rotational discontinuities (RDs whereas the MVA results of the individual spacecraft suggested that RDs form the majority of events. To make multi-spacecraft studies of discontinuity crossings more conclusive, the present report addresses the accuracy of the timing approach to boundary parameter estimation. Our error analysis is based on the reciprocal vector formalism and takes into account uncertainties both in crossing times and in the spacecraft positions. A rigorous error estimation scheme is presented for the general case of correlated crossing time errors and arbitrary spacecraft configurations. Crossing time error covariances are determined through cross correlation analyses of the residuals. The principal influence of the spacecraft array geometry on the accuracy of the timing method is illustrated using error formulas for the simplified case of mutually uncorrelated and identical errors at different spacecraft. The full error analysis procedure is demonstrated for a solar wind discontinuity as observed by the Cluster FGM instrument.
Calculation of the intermediate energy activation cross section
Energy Technology Data Exchange (ETDEWEB)
Furihata, Shiori; Yoshizawa, Nobuaki [Mitsubishi Research Inst., Inc., Tokyo (Japan)
1997-03-01
We discussed the activation cross section in order to predict accurately the activation of soil around an accelerator with high energy and strong intensity beam. For the assessment of the accuracy of activation cross sections estimated by a numerical model, we compared the calculated cross section with various experimental data, for Si(p,x){sup 22}Na, Al(p,x){sup 22}Na, Fe(p,x){sup 22}Na, Si(p,x){sup 7}Be, O(p,x){sup 3}H, Al(p,x){sup 3}H and Si(p,x){sup 3}H reactions. We used three computational codes, i.e., quantum molecular dynamics (QMD) plus statistical decay model (SDM), HETC-3STEP and the semiempirical method developed by Silberberg et.al. It is observed that the codes are accurate above 1GeV, except for {sup 7}Be production. We also discussed the difference between the activation cross sections of proton- and neutron-induced reaction. For the incident energy at 40MeV, it is found that {sup 3}H production cross sections of neutron-induced reaction are ten times as large as those of proton-induced reaction. It is also observed that the choice of the activation cross sections seriously affects to the estimate of saturated radioactivity, if the maximum energy of neutron flux is below 100MeV. (author)
Propolis, Colophony, and Fragrance Cross-Reactivity and Allergic Contact Dermatitis.
Shi, Yiwen; Nedorost, Susan; Scheman, Loren; Scheman, Andrew
2016-01-01
Colophony and propolis are among the complex plant resins used in a wide variety of medicinal and personal care products. A number of studies of colophony, propolis, and fragrance mixes suggest that contact with one of these allergens may increase the risk of delayed-type hypersensitivity reactions with additional compounds of significant cross-reactivity. The aims of this study were to determine rates of cross-reactivity between propolis, colophony, and different fragrance mixes and to determine significant cross-reactivity thresholds for which to counsel patient avoidance. Rates of cross-reactivity were calculated from the databases of 2 midwestern US patch testing centers. Rates were calculated both separately and collectively. For patients allergic to colophony, fragrance and propolis may be considered significant cross-reactors. For patients allergic to propolis, fragrance and colophony may be considered significant cross-reactors. Cross-reactions between colophony, propolis, and fragrance mixes are unidirectional so, for patients allergic to fragrance, cross-reaction to propolis or colophony is not significant. Colophony allergy is found in only a small number of fragrance-allergic patients and is not a good indicator for fragrance allergy.
The Study on In-City Capacity Affected by Pedestrian Crossing
Directory of Open Access Journals (Sweden)
Chang-jiang Zheng
2016-01-01
Full Text Available Currently, the urban road traffic congestion is serious and the traffic accident is happening at a high frequency; thus it has not satisfied the travel needs of security and affects the quality of urban trips. In order to effectively relieve the confliction of people and motor vehicle, to make sure of the safety of pedestrians crossing the road, and to improve the capacity of urban roads, this passage focuses on studying the influence of pedestrians crossing the roads on the capacity of urban roads in three pedestrian crossing approaches including freely crossing the street, uncontrolled crossing of the pedestrian crosswalk, and controlled crossing of the pedestrian crosswalk. Firstly, it confirms the general formula of the road capacity when pedestrians are crossing the road based on three preassumptions, combined with the survey data, and then constructs the empirical mathematical model of pedestrian crossing on the capacity impact. Lastly, it takes the step of case calculation and simulation evaluation and calculates errors between them, finding that the error between the model calculation and software simulation is small. The efficiency of the model is validated and improved.
Modeling pedestrian gap crossing index under mixed traffic condition.
Naser, Mohamed M; Zulkiple, Adnan; Al Bargi, Walid A; Khalifa, Nasradeen A; Daniel, Basil David
2017-12-01
There are a variety of challenges faced by pedestrians when they walk along and attempt to cross a road, as the most recorded accidents occur during this time. Pedestrians of all types, including both sexes with numerous aging groups, are always subjected to risk and are characterized as the most exposed road users. The increased demand for better traffic management strategies to reduce the risks at intersections, improve quality traffic management, traffic volume, and longer cycle time has further increased concerns over the past decade. This paper aims to develop a sustainable pedestrian gap crossing index model based on traffic flow density. It focusses on the gaps accepted by pedestrians and their decision for street crossing, where (Log-Gap) logarithm of accepted gaps was used to optimize the result of a model for gap crossing behavior. Through a review of extant literature, 15 influential variables were extracted for further empirical analysis. Subsequently, data from the observation at an uncontrolled mid-block in Jalan Ampang in Kuala Lumpur, Malaysia was gathered and Multiple Linear Regression (MLR) and Binary Logit Model (BLM) techniques were employed to analyze the results. From the results, different pedestrian behavioral characteristics were considered for a minimum gap size model, out of which only a few (four) variables could explain the pedestrian road crossing behavior while the remaining variables have an insignificant effect. Among the different variables, age, rolling gap, vehicle type, and crossing were the most influential variables. The study concludes that pedestrians' decision to cross the street depends on the pedestrian age, rolling gap, vehicle type, and size of traffic gap before crossing. The inferences from these models will be useful to increase pedestrian safety and performance evaluation of uncontrolled midblock road crossings in developing countries. Copyright © 2017 National Safety Council and Elsevier Ltd. All rights reserved.
Modelling and Analysis of Biochemical Signalling Pathway Cross-talk
Directory of Open Access Journals (Sweden)
Robin Donaldson
2010-02-01
Full Text Available Signalling pathways are abstractions that help life scientists structure the coordination of cellular activity. Cross-talk between pathways accounts for many of the complex behaviours exhibited by signalling pathways and is often critical in producing the correct signal-response relationship. Formal models of signalling pathways and cross-talk in particular can aid understanding and drive experimentation. We define an approach to modelling based on the concept that a pathway is the (synchronising parallel composition of instances of generic modules (with internal and external labels. Pathways are then composed by (synchronising parallel composition and renaming; different types of cross-talk result from different combinations of synchronisation and renaming. We define a number of generic modules in PRISM and five types of cross-talk: signal flow, substrate availability, receptor function, gene expression and intracellular communication. We show that Continuous Stochastic Logic properties can both detect and distinguish the types of cross-talk. The approach is illustrated with small examples and an analysis of the cross-talk between the TGF-b/BMP, WNT and MAPK pathways.
View-CXS neutron and photon cross-sections viewer
International Nuclear Information System (INIS)
Subbaiah, K.V.; Sunil Sunny, C.
2004-01-01
A graphical user-friendly interface is developed in Visual Basic (VB)-6 to view the variation of neutron and photon interaction cross-sections of different isotopes as a function of energy. VB subroutines developed read the binary data files of cross-sections created in MCNP-ACE (Briesmeister, J.F., 1993. MCNP - a general purpose Monte Carlo N-Particle Transport code. Version 4A. LANL, USA), ANISN-DLC (Engle W.W. Jr., 1967, A User's Manual for ANISN, K-1693; ORNL, 1974. 100 group neutron cross section data based on ENDF/B-III. Oak Ridge National Laboratory, USA) and KENO-AMPX (Petrie, L.M., Landers, N.F., 1984 KENO-Va- An Improved Monte Carlo Criticality Program with Super Grouping. RSICC-CCC-548, USA) formats using LAHEY-77 Fortran Compiler. The information on isotopes present in each library will be displayed with the help of database files prepared using Micro-Soft ACESS. The cross-section data can be viewed in different presentation styles namely, line graphs, bar graphs, histograms etc., with different color and symbol options. The cross-section plots generated can be saved as Bit-Map file to embed in any other text files. This software enables inter comparison of cross-sections from different type of libraries for isotopes as well as mixtures. Provision is made to view the cross-sections for nuclear reactions such as (n,γ), (n,f), (n,α), etc. The software can be obtained from Radiation Safety Information and Computational Centre (RSICC), ORNL, USA with the code package identification number PSR-514. The software package needs a hard disk space of about 80 MB when installed and works in WINDOWS-95/98/2000 operating systems
Internal Medicine Residents' Perceptions of Cross-Cultural Training
Park, Elyse R; Betancourt, Joseph R; Miller, Elizabeth; Nathan, Michael; MacDonald, Ellie; Ananeh-Firempong, Owusu; Stone, Valerie E
2006-01-01
BACKGROUND Physicians increasingly face the challenge of managing clinical encounters with patients from a range of cultural backgrounds. Despite widespread interest in cross-cultural care, little is known about resident physicians' perceptions of what will best enable them to provide quality care to diverse patient populations. OBJECTIVES To assess medicine residents' (1) perceptions of cross-cultural care, (2) barriers to care, and (3) training experiences and recommendations. DESIGN, SETTING, AND PATIENTS Qualitative individual interviews were conducted with 26 third-year medicine residents at Massachusetts General Hospital in Boston (response rate = 87%). Interviews were recorded, transcribed, and analyzed. RESULTS Despite significant interest in cross-cultural care, almost all of the residents reported very little training during residency. Most had gained cross-cultural skills through informal learning. A few were skeptical about formal training, and some expressed concern that it is impossible to understand every culture. Challenges to the delivery of cross-cultural care included managing patients with limited English proficiency, who involve family in critical decision making, and who have beliefs about disease that vary from the biomedical model. Residents cited many implications to these barriers, ranging from negatively impacting the patient-physician relationship to compromised care. Training recommendations included making changes to the educational climate and informal and formal training mechanisms. CONCLUSIONS If cross-cultural education is to be successful, it must take into account residents' perspectives and be focused on overcoming residents' cited barriers. It is important to convey that cross-cultural education is a set of skills that can be taught and applied, in a time-efficient manner, rather than requiring an insurmountable knowledge base. PMID:16704391
CrossNeck 1.0 XSLT-SVG cross-section analysis tool for analyzing necking state of a sphere bed
Pouchon, M A
2002-01-01
A tool for analyzing ceramographic cuts of sphere beds was programmed. The parameter of interest was the neck ratio being formed during sintering. A neck investigation based on such a cross section was programmed in a way, that the cross section discs could be entered graphically, and that the necking data was extracted from this information. In a resulting graphic the neck information on the surface was overlaid and could be crosschecked with the actual visible necking data. This allowed a quality control of the extracted data but was also necessary to exclude some false solution being introduced by the principle how the data was extracted. Some test on cross sections of a Cer-Med Sphere-Bed showed good results.
The effects of road crossings on prairie stream habitat and function
Bouska, Wesley W.; Keane, Timothy; Paukert, Craig P.
2010-01-01
Improperly designed stream crossing structures may alter the form and function of stream ecosystems and habitat and prohibit the movement of aquatic organisms. Stream sections adjoining five concrete box culverts, five low-water crossings (concrete slabs vented by one or multiple culverts), and two large, single corrugated culvert vehicle crossings in eastern Kansas streams were compared to reference reaches using a geomorphologic survey and stream classification. Stream reaches were also compared upstream and downstream of crossings, and crossing measurements were used to determine which crossing design best mimicked the natural dimensions of the adjoining stream. Four of five low-water crossings, three of five box culverts, and one of two large, single corrugated pipe culverts changed classification from upstream to downstream of the crossings. Mean riffle spacing upstream at low-water crossings (8.6 bankfull widths) was double that of downstream reaches (mean 4.4 bankfull widths) but was similar upstream and downstream of box and corrugated pipe culverts. There also appeared to be greater deposition of fine sediments directly upstream of these designs. Box and corrugated culverts were more similar to natural streams than low-water crossings at transporting water, sediments, and debris during bankfull flows.
Compact fitting formulas for electron-impact cross sections
International Nuclear Information System (INIS)
Kim, Y.K.
1992-01-01
Compact fitting formulas, which contain four fitting constants, are presented for electron-impact excitation and ionization cross sections of atoms and ions. These formulas can fit experimental and theoretical cross sections remarkably well, when resonant structures are smoothed out, from threshold to high incident electron energies (<10 keV), beyond which relativistic formulas are more appropriate. Examples of fitted cross sections for some atoms and ions are presented. The basic form of the formula is valid for both atoms and molecules
Tibiopedal Access for Crossing of Infrainguinal Artery Occlusions
Walker, Craig M.; Mustapha, Jihad; Zeller, Thomas; Schmidt, Andrej; Montero-Baker, Miguel; Nanjundappa, Aravinda; Manzi, Marco; Palena, Luis Mariano; Bernardo, Nelson; Khatib, Yazan; Beasley, Robert; Leon, Luis; Saab, Fadi A.; Shields, Adam R.; Adams, George L.
2016-01-01
Purpose: To report a prospective, multicenter, observational study (ClinicalTrials.gov identifier NCT01609621) of the safety and effectiveness of tibiopedal access and retrograde crossing in the treatment of infrainguinal chronic total occlusions (CTOs). Methods: Twelve sites around the world prospectively enrolled 197 patients (mean age 71±11 years, range 41-93; 129 men) from May 2012 to July 2013 who met the inclusion criterion of at least one CTO for which a retrograde crossing procedure was planned or became necessary. The population consisted of 64 (32.5%) claudicants (Rutherford categories 2/3) and 133 (67.5%) patients with critical limb ischemia (Rutherford category ≥4). A primary antegrade attempt to cross had been made prior to the tibiopedal attempt in 132 (67.0%) cases. Techniques used for access, retrograde lesion crossing, and treatment were at the operator’s discretion. Follow-up data were obtained 30 days after the procedure. Results: Technical tibiopedal access success was achieved in 184 (93.4%) of 197 patients and technical occlusion crossing success in 157 (85.3%) of the 184 successful tibial accesses. Failed access attempts were more common in women (9 of 13 failures). The rate of successful crossing was roughly equivalent between sexes [84.7% (50/59) women compared to 85.6% (107/125) men]. Technical success did not differ significantly based on a prior failed antegrade attempt: the access success rate was 92.4% (122/132) after a failed antegrade access vs 95.4% (62/65) in those with a primary tibiopedal attempt (p=0.55). Similarly, crossing success was achieved in 82.8% (101/122) after a failed antegrade access vs 90.3% (56/62) for patients with no prior antegrade attempt (p=0.19). Minor complications related to the access site occurred in 11 (5.6%) cases; no patient had access vessel thrombosis, compartment syndrome, or surgical revascularization. Conclusion: Tibiopedal access appears to be safe and can be used effectively for the
Durkalec-Michalski, Krzysztof; Zawieja, Emilia E; Podgórski, Tomasz; Łoniewski, Igor; Zawieja, Bogna E; Warzybok, Marta; Jeszka, Jan
2018-01-01
Sodium bicarbonate (SB) has been proposed as an ergogenic aid, as it improves high-intensity and resistance exercise performance. However, no studies have yet investigated SB application in CrossFit. This study examined the effects of chronic, progressive-dose SB ingestion on CrossFit-like performance and aerobic capacity. In a randomized, double-blind, cross-over trial, 21 CrossFit-trained participants were randomly allocated to 2 groups and underwent 2 trials separated by a 14-day washout period. Participants ingested either up to 150 mg∙kg-1 of SB in a progressive-dose regimen or placebo for 10 days. Before and after each trial, Fight Gone Bad (FGB) and incremental cycling (ICT) tests were performed. In order to examine biochemical responses, blood samples were obtained prior to and 3 min after completing each exercise test. No gastrointestinal (GI) side effects were reported during the entire protocol. The overall FGB performance improved under SB by ~6.1% (pCrossFit-like performance, as well as delayed ventilatory threshold occurrence.
International Nuclear Information System (INIS)
Pashchenko, A.B.; Wienke, H.
1998-01-01
This document presents the description of a physical tape containing the basic evaluated nuclear data library of neutron-nucleus interaction cross sections, photon production cross sections and photon-atom interaction cross sections for fusion applications. It is part of the evaluated nuclear data library for fusion applications FENDL-2. The data are available cost-free from the Nuclear Data Section upon request. The data can also be retrieved by the user via online access through international computer networks. (author)
Single-level resonance parameters fit nuclear cross-sections
Drawbaugh, D. W.; Gibson, G.; Miller, M.; Page, S. L.
1970-01-01
Least squares analyses of experimental differential cross-section data for the U-235 nucleus have yielded single level Breit-Wigner resonance parameters that fit, simultaneously, three nuclear cross sections of capture, fission, and total.
Injury Incidence and Patterns Among Dutch CrossFit Athletes.
Mehrab, Mirwais; de Vos, Robert-Jan; Kraan, Gerald A; Mathijssen, Nina M C
2017-12-01
CrossFit is a strength and conditioning program that has gained widespread recognition, with 11,000 affiliated gyms worldwide. The incidence of injuries during CrossFit training is poorly analyzed. To investigate the incidence of injuries for persons participating in CrossFit. Risk factors for injury and injury mechanisms were also explored through athlete demographics and characteristics. Descriptive epidemiology study. A questionnaire that focused on injury incidence in CrossFit in the past year and included data on athlete demographics and characteristics was distributed to all 130 CrossFit gyms in the Netherlands and was also available online in active Facebook groups. Data were collected from July 2015 to January 2016. Inclusion criteria consisted of age ≥18 years and training at a registered CrossFit gym in the Netherlands. A total of 553 participants completed the survey. Univariable and multivariable generalized linear mixed models were used to identify potential risk factors for injury. A total of 449 participants met the inclusion criteria. Of all respondents, 252 athletes (56.1%) sustained an injury in the preceding 12 months. The most injured body parts were the shoulder (n = 87, 28.7%), lower back (n = 48, 15.8%), and knee (n = 25, 8.3%). The duration of participation in CrossFit significantly affected the injury incidence rates (CrossFit was 56.1%. The most frequent injury locations were the shoulder, lower back, and knee. A short duration of participation (<6 months) was significantly associated with an increased risk for injury.
Investigation of fullerene ions in crossed-beams experiments
International Nuclear Information System (INIS)
Hathiramani, D.; Scheier, P.; Braeuning, H.; Trassl, R.; Salzborn, E.; Presnyakov, L.P.; Narits, A.A.; Uskov, D.B.
2003-01-01
Employing the crossed-beams technique, we have studied the interaction of fullerene ions both with electrons and He 2+ -ions. Electron-impact ionization cross sections for C 60 q+ (q=1,2,3) have been measured at electron energies up to 1000 eV. Unusual features in shape and charge state dependence have been found, which are not observed for atomic ions. The evaporative loss of neutral C 2 fragments in collisions with electrons indicates the presence of two different mechanisms. In a first-ever ion-ion crossed-beams experiment involving fullerene ions a cross section of (1.05 ± 0.06) x 10 -15 cm 2 for charge transfer in the collision C 60 + + He 2+ at 117.2 keV center-of-mass energy has been obtained
Acute Exercise and Oxidative Stress: CrossFit(™) vs. Treadmill Bout.
Kliszczewicz, Brian; Quindry, C John; Blessing, L Daniel; Oliver, D Gretchen; Esco, R Michael; Taylor, J Kyle
2015-09-29
CrossFit(™), a popular high-intensity training modality, has been the subject of scrutiny, with concerns of elevated risk of injury and health. Despite these concerns empirical evidence regarding physiologic stresses including acute oxidative stress is lacking. Therefore, the purpose of this investigation was to examine the acute redox response to a CrossFit(™) bout. Furthermore, these findings were compared to a high-intensity treadmill bout as a point of reference. Ten males 26.4 ± 2.7 yrs having three or more months of CrossFit(™) experience participated in the present study. Blood plasma was collected at four time points: Pre-exercise (PRE), immediately-post-exercise (IPE), 1 hr-post (1-HP) and 2 hr-post (2-HP), to examine oxidative damage and antioxidant capacity. Regarding plasma oxidative damage, CrossFit(™) and Treadmill elicited a time-dependent increase of lipid peroxides 1-HP (CrossFit(™)=+143%, Treadmill=+115%) and 2-HP (CrossFit(™)=+256%, Treadmill+167%). Protein Carbonyls were increased IPE in CF only (+5%), while a time-dependent decrease occurred 1-HP (CrossFit(™)=-16%, Treadmill=-8%) and 2-HP (CF=-16%, TM=-1%) compared to IPE. Regarding antioxidant capacity, Ferric Reducing Antioxidant Power also demonstrated a time-dependent increase within CrossFit(™) and Treadmill: IPE (CrossFit(™)=+25%, Treadmill=+17%), 1-HP (CrossFit(™)=+26%, Treadmill=+4.8%), 2-HP (CrossFit(™)=+20%, Treadmill=+12%). Total Enzymatic Antioxidant Capacity showed a time-dependent decrease in IPE (CrossFit(™)=-10%, Treadmill=-12%), 1-HP (CrossFit(™)=-12%, Treadmill=-6%), 2-HP (CrossFit(™)=-7%, Treadmill=-11%). No trial-dependent differences were observed in any biomarker of oxidative stress. The CrossFit(™) bout elicited an acute blood oxidative stress response comparable to a traditional bout of high-intensity treadmill running. Results also confirm that exercise intensity and the time course of exercise recovery influence oxidative responses.
Resident cross-cultural training, satisfaction, and preparedness.
Frintner, Mary Pat; Mendoza, Fernando S; Dreyer, Benard P; Cull, William L; Laraque, Danielle
2013-01-01
To describe the diversity of pediatric residents and examine relationships of cross-cultural training experiences with training satisfaction, perceived preparedness for providing culturally effective care, and attitudes surrounding care for underserved populations. A cross-sectional survey was conducted of a national random sample of graduating pediatric residents and an additional sample of minority residents. Using weighted analysis, we used multivariate regression to test for differences in satisfaction, preparedness, and attitudes between residents with more and less cross-cultural experiences during residency, controlling for residents' characteristics and experiences before training. The survey response rate was 57%. Eleven percent were Hispanic, 61% white, 21% Asian, 9% African American, 9% other racial/ethnic groups; 34% grew up in a bi- or multilingual family. Ninety-three percent of residents were satisfied with their residency training, 81% with the instruction they received on health and health care disparities, and 54% on global health issues. Ninety-six percent of residents felt they were prepared to care for patients from diverse backgrounds, but fewer felt prepared to care for families with beliefs at odds with Western medicine (49%) and families who receive alternative or complementary care (37%). Residents with more cross-cultural experiences during residency reported being better prepared than those with less experience to care for families with limited English proficiency (adjusted odds ratio [aOR] 2.11; 95% confidence interval [CI] 1.40-3.17), new immigrants (aOR 1.91; 95% CI 1.32-2.75), and with religious beliefs that might affect clinical care (aOR 1.62; 95% CI 1.13-2.32). Pediatric residents begin their training with diverse cross-cultural backgrounds and experiences. Residency experiences in cross-cultural care contribute to feelings of preparedness to care for diverse US children. Copyright © 2013 Academic Pediatric Association. Published
Wave emission by resonance crossing
International Nuclear Information System (INIS)
Tracy, E.R.; Kaufman, A.N.; Liang, Y.
1995-01-01
The emission of collective waves by a moving charged particle in a nonuniform medium is discussed. Emission occurs in a nonuniform medium when the local dispersion relation of the collective wave is satisfied. This is a form of resonance crossing. Using the Weyl symbol calculus, a local expansion of the collective wave equation driven by the particle source is derived in the neighborhood of the crossing. The collective wave dispersion manifold and the gyroballistic wave dispersion manifold can be used as a pair of local coordinates in the neighborhood of the resonance crossing, which greatly simplifies the analysis. This change of representation is carried out using a metaplectic transform (a generalization of the fourier transform). The Wigner function of the emitted wave field is then computed in the new coordinates. The Wigner function is a phase space scalar, hence the numerical value is invariant under linear canonical transformations. This invariance is invoked to finally arrive at the Wigner function in the original (physical) coordinates. The wave-action and -energy emission rates are then computed from the Wigner function. copyright 1995 American Institute of Physics
Measurement cross sections for radioisotopes production
International Nuclear Information System (INIS)
Garrido, E.
2011-01-01
New radioactive isotopes for nuclear medicine can be produced using particle accelerators. This is one goal of Arronax, a high energy - 70 MeV - high intensity - 2*350 μA - cyclotron set up in Nantes. A priority list was established containing β - - 47 Sc, 67 Cu - β + - 44 Sc, 64 Cu, 82 Sr/ 82 Rb, 68 Ge/ 68 Ga - and α emitters - 211 At. Among these radioisotopes, the Scandium 47 and the Copper 67 have a strong interest in targeted therapy. The optimization of their productions required a good knowledge of their cross-sections but also of all the contaminants created during irradiation. We launched on Arronax a program to measure these production cross-sections using the Stacked-Foils' technique. It consists in irradiating several groups of foils - target, monitor and degrader foils - and in measuring the produced isotopes by γ-spectrometry. The monitor - nat Cu or nat Ni - is used to correct beam loss whereas degrader foils are used to lower beam energy. We chose to study the nat Ti(p,X) 47 Sc and 68 Zn(p,2p) 67 Cu reactions. Targets are respectively natural Titanium foil - bought from Goodfellow - and enriched Zinc 68 deposited on Silver. In the latter case, Zn targets were prepared in-house - electroplating of 68 Zn - and a chemical separation between Copper and Gallium isotopes has to be made before γ counting. Cross-section values for more than 40 different reactions cross-sections have been obtained from 18 MeV to 68 MeV. A comparison with the Talys code is systematically done. Several parameters of theoretical models have been studied and we found that is not possible to reproduce faithfully all the cross-sections with a given set of parameters. (author)
Prototype Rail Crossing Violation Warning Application Project Report.
2017-09-05
This report is the Project Report for the Rail Crossing Violation Warning (RCVW) safety application developed for the project on Rail Crossing Violation Warning Application and Infrastructure Connection, providing a means for equipped connected vehic...
Validation of evaluated neutron standard cross sections
International Nuclear Information System (INIS)
Badikov, S.; Golashvili, T.
2008-01-01
Some steps of the validation and verification of the new version of the evaluated neutron standard cross sections were carried out. In particular: -) the evaluated covariance data was checked for physical consistency, -) energy-dependent evaluated cross-sections were tested in most important neutron benchmark field - 252 Cf spontaneous fission neutron field, -) a procedure of folding differential standard neutron data in group representation for preparation of specialized libraries of the neutron standards was verified. The results of the validation and verification of the neutron standards can be summarized as follows: a) the covariance data of the evaluated neutron standards is physically consistent since all the covariance matrices of the evaluated cross sections are positive definite, b) the 252 Cf spectrum averaged standard cross-sections are in agreement with the evaluated integral data (except for 197 Au(n,γ) reaction), c) a procedure of folding differential standard neutron data in group representation was tested, as a result a specialized library of neutron standards in the ABBN 28-group structure was prepared for use in reactor applications. (authors)
UV laser-induced cross-linking in peptides
Leo, Gabriella; Altucci, Carlo; Bourgoin-Voillard, Sandrine; Gravagnuolo, Alfredo M.; Esposito, Rosario; Marino, Gennaro; Costello, Catherine E.; Velotta, Raffaele; Birolo, Leila
2013-01-01
RATIONALE The aim of this study was to demonstrate, and to characterize by high resolution mass spectrometry, that it is possible to preferentially induce covalent cross-links in peptides by using high energy femtosecond UV laser pulses. The cross-link is readily formed only when aromatic amino acids are present in the peptide sequence. METHODS Three peptides, xenopsin, angiotensin I, interleukin, individually or in combination, were exposed to high energy femtosecond UV laser pulses, either alone or in the presence of spin trapping molecules, the reaction products being characterized by high resolution mass spectrometry. RESULTS High resolution mass spectrometry and spin trapping strategies showed that cross-linking occurs readily, proceeds via a radical mechanism, and is the highly dominant reaction, proceeding without causing significant photo-damage in the investigated range of experimental parameters. CONCLUSIONS High energy femtosecond UV laser pulses can be used to induce covalent cross-links between aromatic amino acids in peptides, overcoming photo-oxidation processes, that predominate as the mean laser pulse intensity approaches illumination conditions achievable with conventional UV light sources. PMID:23754800
Neutron cross section measurements for the Fast Breeder Program
International Nuclear Information System (INIS)
Block, R.C.
1979-06-01
This research was concerned with the measurement of neutron cross sections of importance to the Fast Breeder Reactor. The capture and total cross sections of fission products ( 101 102 104 Ru, 143 145 Nd, 149 Sm, 95 97 Mo, Cs, Pr, Pd, 107 Pd, 99 Tc) and tag gases (Kr, 78 80 Kr) were measured up to 100 keV. Filtered neutron beams were used to measure the capture cross section of 238 U (with an Fe filter) and the total cross section of Na (with a Na filter). A radioactive neutron capture detector was developed. A list of publications is included
International Nuclear Information System (INIS)
Zeng Chunhua; Zhou Xiaofeng; Tao Shufen
2009-01-01
The transient properties of a tumor cell growth model with immune surveillance driven by cross-correlated multiplicative and additive noises are investigated. The explicit expression of extinction rate from the state of a stable tumor to the state of extinction is obtained. Based on the numerical computations, we find the following: (i) the intensity of multiplicative noise D and the intensity of additive noise α enhance the extinction rate for the case of λ ≤ 0 (i.e. λ denotes cross-correlation intensity between two noises), but for the case of λ > 0, a critical noise intensity D or α exists at which the extinction rate is the smallest; D and α at first weaken the extinction rate and then enhance it. (ii) The immune rate β and the cross-correlation intensity λ play opposite roles on the extinction rate, i.e. β enhances the extinction rate of the tumor cell, while λ weakens the extinction rate of the tumor cell. Namely, the immune rate can enhance the extinction of the tumor cell and the cross-correlation between two noises can enhance stability of the cancer state.
Cross cultural usability testing
DEFF Research Database (Denmark)
Clemmensen, Torkil; Goyal, Shivam
2005-01-01
In this paper, we present the results of a pilot study in Denmark of cross cultural effects on Think Aloud usability testing. We provide an overview of previous research on cross cultural usability evaluation with a special focus on the relationship between the evaluator and the test user....... This relation was studied in an experiment with usability testing of a localized clipart application in which eight participants from Denmark and India formed pairs of evaluator-test user. The test users were asked to think aloud and the evaluators' role were to facilitate the test users thinking aloud...... and hereby identify usability problems with the clipart application. Data on the evaluators' and test users' behaviour were recorded and analyzed by coding and summarizing statistics on these behavioural events. The results show that Think Aloud Usability Test of a localized application is most effectively...
General protein-protein cross-linking.
Alegria-Schaffer, Alice
2014-01-01
This protocol describes a general protein-to-protein cross-linking procedure using the water-soluble amine-reactive homobifunctional BS(3) (bis[sulfosuccinimidyl] suberate); however, the protocol can be easily adapted using other cross-linkers of similar properties. BS(3) is composed of two sulfo-NHS ester groups and an 11.4 Å linker. Sulfo-NHS ester groups react with primary amines in slightly alkaline conditions (pH 7.2-8.5) and yield stable amide bonds. The reaction releases N-hydroxysuccinimide (see an application of NHS esters on Labeling a protein with fluorophores using NHS ester derivitization). © 2014 Elsevier Inc. All rights reserved.
Hue, B. M.; Isataev, T.; Erdemchimeg, B.; Artukh, A. G.; Aznabaev, D.; Davaa, S.; Klygin, S. A.; Kononenko, G. A.; Khuukhenkhuu, G.; Kuterbekov, K.; Lukyanov, S. M.; Mikhailova, T. I.; Maslov, V. A.; Mendibaev, K.; Sereda, Yu M.; Penionzhkevich, Yu E.; Vorontsov, A. N.
2017-12-01
Preliminary results of measurements of the total reaction cross sections σR and neutron removal cross section σ-xn for weakly bound 6He, 8Li, 9Be and 10Be nuclei at energy range (20-35) A MeV with 28Si target is presented. The secondary beams of light nuclei were produced by bombardment of the 22Ne (35 A MeV) primary beam on Be target and separated by COMBAS fragment-separator. In dispersive focal plane a horizontal slit defined the momentum acceptance as 1% and a wedge degrader of 200 μm Al was installed. The Bρ of the second section of the fragment-separator was adjusted for measurements in energy range (20-35) A MeV. Two-neutron removal cross sections for 6He and 10Be and one -neutron removal cross sections 8Li and 9Be were measured.
ExoCross: Spectra from molecular line lists
Yurchenko, Sergei N.; Al-Refaie, Ahmed; Tennyson, Jonathan
2018-03-01
ExoCross generates spectra and thermodynamic properties from molecular line lists in ExoMol, HITRAN, or several other formats. The code is parallelized and also shows a high degree of vectorization; it works with line profiles such as Doppler, Lorentzian and Voigt and supports several broadening schemes. ExoCross is also capable of working with the recently proposed method of super-lines. It supports calculations of lifetimes, cooling functions, specific heats and other properties. ExoCross converts between different formats, such as HITRAN, ExoMol and Phoenix, and simulates non-LTE spectra using a simple two-temperature approach. Different electronic, vibronic or vibrational bands can be simulated separately using an efficient filtering scheme based on the quantum numbers.
Proton-air and proton-proton cross sections
Directory of Open Access Journals (Sweden)
Ulrich Ralf
2013-06-01
Full Text Available Different attempts to measure hadronic cross sections with cosmic ray data are reviewed. The major results are compared to each other and the differences in the corresponding analyses are discussed. Besides some important differences, it is crucial to see that all analyses are based on the same fundamental relation of longitudinal air shower development to the observed fluctuation of experimental observables. Furthermore, the relation of the measured proton-air to the more fundamental proton-proton cross section is discussed. The current global picture combines hadronic proton-proton cross section data from accelerator and cosmic ray measurements and indicates a good consistency with predictions of models up to the highest energies.
Fission-neutron displacement cross sections in metals
International Nuclear Information System (INIS)
Takamura, Saburo; Aruga, Takeo; Nakata, Kiyotomo
1985-01-01
The sensitivity damage rates for 22 metals were measured after fission-spectrum neutron irradiation at low temperature and the experimental damage rates were compared with the theoretical calculation. The relation between the theoretical displacement cross section and the atomic weight of metals can be written by two curves; one is for fcc and hcp metals, and another is for bcc metals. On the other hand, the experimental displacement cross section versus atomic weight is shown approximately by a curve for both fcc and bcc metals, and the cross section for hcp metals deviates from the curve. The defect production efficiency is 0.3-0.4 for fcc metals and 0.6-0.8 for bcc metals. (orig.)
Applications of the BEam Cross section Analysis Software (BECAS)
DEFF Research Database (Denmark)
Blasques, José Pedro Albergaria Amaral; Bitsche, Robert; Fedorov, Vladimir
2013-01-01
A newly developed framework is presented for structural design and analysis of long slender beam-like structures, e.g., wind turbine blades. The framework is based on the BEam Cross section Analysis Software – BECAS – a finite element based cross section analysis tool. BECAS is used for the gener......A newly developed framework is presented for structural design and analysis of long slender beam-like structures, e.g., wind turbine blades. The framework is based on the BEam Cross section Analysis Software – BECAS – a finite element based cross section analysis tool. BECAS is used...... for the generation of beam finite element models which correctly account for effects stemming from material anisotropy and inhomogeneity in cross sections of arbitrary geometry. These type of modelling approach allows for an accurate yet computationally inexpensive representation of a general class of three...
Significant Attributes and Challenges Related to Cross-Functional Team Communications
Ali, Majid
2016-01-01
Purpose The purpose of the research work is to investigate the importance of the communication in the cross-functional teams and in what which communicational tools provide better convenience of communication in cross-functional team members. Methodology An empirical study including the data collection from the interviews conducted from the participants working in cross-functional teams. Qualitative approach has been adopted to understand the communicational attributes in the cross-functional...
Mid-IR Absorption Cross-Section Measurements of Hydrocarbons
Alrefae, Majed Abdullah
2013-01-01
-known at combustion-relevant conditions. Absorption cross-section is an important spectroscopic quantity and has direct relation to the species concentration. In this work, the absorption cross-sections of basic hydrocarbons are measured using Fourier Transform
A Theoretical Rationale for Cross-Cultural Family Counseling.
Arciniega, Miguel; Newlon, Betty J.
1981-01-01
Proposes seven Adlerian axioms of behavior for the cross-cultural pluralistic counselor working with minority families. Defines cross-cultural family counseling and urges counselors to understand minority cultures and the acculturation process. Discusses counseling techniques. (JAC)