WorldWideScience

Sample records for organochlorine insecticide endrin

  1. Biochemical changes in male rat serumin response to treatment with the organochlorine insecticide endrin

    International Nuclear Information System (INIS)

    Fayez, V.

    2003-01-01

    Administrations to rats of oral single doses of endrin at levels 1.1, 3.3 and 5.5 mg/kg representing 10, 30 and 50% of the LD 5 0 has been attempted to determine it;s effect on serum levels of alanine and aspartate aminotransferases, creatinine, blood urea, protein, albumin, total cholesterol, HDL-cholesterol, triglycerides and cancer embryonic antigen. Endrin induced significant elevation of serum aminotransferases at the mid-and high-doses. Blood urea was altered significantly at the three dose levels. serum creatinine was not appreciably altered. Serum albumin was lowered significantly on day 4 at the level of 1.1 mg/kg. Total cholesterol was substantially elevated on day 1, while HDL-cholesterol was lowered significantly on day 6 at the level of 5.5 mg/kg.Triglycerides and LDL-cholesterol were sporadically elevated throughout the experimental period. Cancer embryonic antigen was elevated insignificantly on day 6 and 8 at the level of 3.3 mg/kg and on day 1 and 4 at the level of 5.5 mg/kg, approaching normal values thereafter. Comparing the toxic effect of the three dose levels evidence of a strict dose-response relationship was apparent

  2. Organochlorine insecticide poisoning in Golden Langurs Trachypithecus geei

    Directory of Open Access Journals (Sweden)

    D.C. Pathak

    2011-07-01

    Full Text Available Organochlorine insecticide poisoning was recorded in three Golden Langurs (Trachypithecus geei in Chakrashila Wildlife Sanctuary (CWS in Kokrajhar district of Assam during the month of December, 2008. The poisoning was due to prolonged ingestion of rubber plant leaves sprayed with the insecticide in a rubber plantation adjacent to the sanctuary. Though no specific gross lesions were observed, histopathologically, centilobular hepatic necrosis, mild renal degeneration, necrotic enteritis, pulmonary congestion and neuronal degeneration were recorded in all three animals.

  3. Organochlorine insecticide poisoning in Golden Langurs Trachypithecus geei

    OpenAIRE

    D.C. Pathak

    2011-01-01

    Organochlorine insecticide poisoning was recorded in three Golden Langurs (Trachypithecus geei) in Chakrashila Wildlife Sanctuary (CWS) in Kokrajhar district of Assam during the month of December, 2008. The poisoning was due to prolonged ingestion of rubber plant leaves sprayed with the insecticide in a rubber plantation adjacent to the sanctuary. Though no specific gross lesions were observed, histopathologically, centilobular hepatic necrosis, mild renal degeneration, necrotic enteritis, pu...

  4. Identification and level of organochlorine insecticide contamination in groundwater and iridology analysis for people in Upper Citarum cascade

    Science.gov (United States)

    Oginawati, K.; Pratama, M. A.

    2016-03-01

    Organochlorines are the main pollutants in the class of persistent organic pollutants which are types of pollutants that are being questioned worldwide due to chronic persistence, toxicity and bioaccumulation. Human around the Citarum River are still using groundwater as a drinking source. It is very risky for people health that consume groundwater because in 2009 the application of organochlorine still found in the Upper Citarum watershed rice field and had potential to contaminate groundwater. Groundwater was analyzed with nine species belonging to the organochlorine pollutants Organic Peristent types. 7 types of organochlorinesAldrin was detected with an average concentration of 0.09 ppb, dieldrin with an average concentration of 24 ppb, heptaklor with an average concentration of 0.51 ppb, with concentrations of endosulfan on average 0.73 ppb, DDT with average concentration of 0.13 ppb, Lindan with an average concentration of 1.2 ppb, endrin with an average concentration of 0.03 ppb. Types with the highest concentration of organochlorine a lindan and endosulfan. Residues of aldrin, dieldrin and heptaklor in groundwater already exceeds the quality standards for drinking water Permenkes 492/2010. Based on the iridology analysis obtained several systems are expected to nervous, immune and reproductive system disorders and toxin deposits under the skin.

  5. Identification and level of organochlorine insecticide contamination in groundwater and iridology analysis for people in Upper Citarum cascade

    International Nuclear Information System (INIS)

    Oginawati, K; Pratama, M A

    2016-01-01

    Organochlorines are the main pollutants in the class of persistent organic pollutants which are types of pollutants that are being questioned worldwide due to chronic persistence, toxicity and bioaccumulation. Human around the Citarum River are still using groundwater as a drinking source. It is very risky for people health that consume groundwater because in 2009 the application of organochlorine still found in the Upper Citarum watershed rice field and had potential to contaminate groundwater. Groundwater was analyzed with nine species belonging to the organochlorine pollutants Organic Peristent types. 7 types of organochlorinesAldrin was detected with an average concentration of 0.09 ppb, dieldrin with an average concentration of 24 ppb, heptaklor with an average concentration of 0.51 ppb, with concentrations of endosulfan on average 0.73 ppb, DDT with average concentration of 0.13 ppb, Lindan with an average concentration of 1.2 ppb, endrin with an average concentration of 0.03 ppb. Types with the highest concentration of organochlorine a lindan and endosulfan. Residues of aldrin, dieldrin and heptaklor in groundwater already exceeds the quality standards for drinking water Permenkes 492/2010. Based on the iridology analysis obtained several systems are expected to nervous, immune and reproductive system disorders and toxin deposits under the skin. (paper)

  6. Organochlorine insecticides DDT and chlordane in relation to survival following breast cancer.

    Science.gov (United States)

    Parada, Humberto; Wolff, Mary S; Engel, Lawrence S; White, Alexandra J; Eng, Sybil M; Cleveland, Rebecca J; Khankari, Nikhil K; Teitelbaum, Susan L; Neugut, Alfred I; Gammon, Marilie D

    2016-02-01

    Organochlorine insecticides have been studied extensively in relation to breast cancer incidence, and results from two meta-analyses have been null for late-life residues, possibly due to measurement error. Whether these compounds influence survival remains to be fully explored. We examined associations between organochlorine insecticides [p,p'-DDT (dichlorodiphenyltrichloroethane), its primary metabolite, p,p'-DDE, and chlordane] assessed shortly after diagnosis and survival among women with breast cancer. A population-based sample of women diagnosed with a first primary invasive or in situ breast cancer in 1996-1997 and with available organochlorine blood measures (n = 633) were followed for vital status through 2011. After follow-up of 5 and 15 years, we identified 55 and 189 deaths, of which 36 and 74, respectively, were breast cancer-related. Using Cox regression models, we estimated the multivariable-adjusted hazard ratios (HRs) and 95% confidence intervals (CIs) for lipid-adjusted organochlorine concentrations with all-cause and breast cancer-specific mortality. At 5 years after diagnosis, the highest tertile of DDT concentration was associated with all-cause (HR = 2.19; 95% CI: 1.02, 4.67) and breast cancer-specific (HR = 2.72; 95% CI: 1.04, 7.13) mortality. At 15 years, middle tertile concentrations of DDT (HR = 1.42; 95% CI 0.99, 2.06) and chlordane (HR = 1.42; 95% CI: 0.94, 2.12) were modestly associated with all-cause and breast cancer-specific mortality. Third tertile DDE concentrations were inversely associated with 15-year all-cause mortality (HR = 0.66; 95% CI: 0.44, 0.99). This is the first population-based study in the United States to show that DDT may adversely impact survival following breast cancer diagnosis. Further studies are warranted given the high breast cancer burden and the ubiquity of these chemicals. © 2015 UICC.

  7. Influence of organic acids and organochlorinated insecticides on metabolism of Saccharomyces cerevisiae

    Directory of Open Access Journals (Sweden)

    Pejin Dušanka J.

    2005-01-01

    Full Text Available Saccharomyces cerevisiae is exposed to different stress factors during the production: osmotic, temperature, oxidative. The response to these stresses is the adaptive mechanism of cells. The raw materials Saccharomyces cerevisiae is produced from, contain metabolism products of present microorganisms and protective agents used during the growth of sugar beet for example the influence of acetic and butyric acid and organochlorinated insecticides, lindan and heptachlor, on the metabolism of Saccharomyces cerevisiae was investigated and presented in this work. The mentioned compounds affect negatively the specific growth rate, yield, content of proteins, phosphorus, total ribonucleic acids. These compounds influence the increase of trechalose and glycogen content in the Saccharomyces cerevisiae cells.

  8. Organochlorine insecticides (DDT and heptachlor in dry fish: Traditional washing and cooking effect on dietary intake

    Directory of Open Access Journals (Sweden)

    Matiur Rahim

    2009-06-01

    Full Text Available The concentrations of organochlorine insecticides (DDT and heptachlor were investigated to estimate the effect of various washing and boiling/cooking to elucidate the concentration level we intake actually. For this study five most popular dry fish samples namely bombay duck (loittya, ribbon fish (chhuri, shrimp (chingri, chinese pomfret (rupchanda and Indian salmon (lakhua were analyzed. The highest concentrations of DDT and heptachlor were found 737.238 ppb (Indian salmon, normal and 44.806 ppb (shrimp, normal respectively; after boiling treatment a big amount was washed out and remained only 135.516 ppb and 16.868 ppb respectively. Boiling treatment was found more effective than the others.

  9. Organochlorine insecticides (DDT and heptachlor in dry fish: traditional washing and cooking effect on dietary intake

    Directory of Open Access Journals (Sweden)

    MD. Nurul Huda Bhuiyan

    2009-03-01

    Full Text Available The concentrations of organochlorine insecticides (DDT and heptachlor were investigated to estimate the effect of various washing and boiling/cooking to elucidate the concentration level we intake actually. For this study five most popular dry fish samples namely bombay duck (loittya, ribbon fish (chhuri, shrimp (chingri, chinese pomfret (rupchanda and Indian salmon (lakhua were analyzed. The highest concentrations of DDT and heptachlor were found 737.238 ppb (Indian salmon, normal and 44.806 ppb (shrimp, normal respectively; after boiling treatment a big amount was washed out and remained only 135.516 ppb and 16.868 ppb respectively. Boiling treatment was found more effective than the others.

  10. Screening of organochlorine insecticides (DDT and heptachlor in dry fish available in Bangladesh

    Directory of Open Access Journals (Sweden)

    Md. Nurul Huda Bhuiyan

    2008-06-01

    Full Text Available The concentrations of organochlorine insecticides DDT and heptachlor were investigated to estimate the current status of insecticides used in dry fish. The most popular dry fish– ribbon fish (Chhuri, shrimp (Chingri and bombay duck (Loittya were selected for this study and these dry fishes were collected from different markets of Dhaka and Chittagong. The range of DDT used in all the samples was 3.038 ppb to 874.966 ppb. The range of DDT in ribbon fish 131.611 ppb to 149.430 ppb, in shrimp 3.038 ppb to 318.206 ppb and in bombay duck 61.918 ppb to 874.966 ppb was found. The range of heptachlor used in all the samples was 0.682 ppb to 5.464 ppb. The range of heptachlor in ribbon fish 1.710 ppb to 2.306 ppb, in shrimp 0.682 ppb to 3.806 ppb and in bombay duck 1.762 ppb to 5.464 ppb was found. The heptachlor was not found in ribbon fish (CTG-2, shrimp (DHK-2 and CTG-1 and bombay duck (DHK-1. The concentration of heptachlor in dry fish compare to DDT was found too much less.

  11. Determinação de resíduos de organoclorados em águas fluviais do município de Viçosa - MG Determination of organochlorinated present in river from the region of Viçosa, MG

    Directory of Open Access Journals (Sweden)

    Cíntia Maria Chagas

    1999-07-01

    Full Text Available In this work the contamination, by organochlorinated, of a drinking water source located in the region of Viçosa, MG, was evaluated. The identification and quantification of the analytes was carried out using a gas-chromatograph equipped with an electron capture detector after liquid-liquid extraction and concentration. Four insecticides, Aldrin, Epoxy heptachloride, Endrin and op'- DDT were detected in concentrations that are higher than the safety limits established in the Brazilian legislation.

  12. Determination of the organochlorine insecticide residues in Lonicera japonica Thunb. By gas chromatography%气相色谱法测定金银花中有机氯杀虫剂残留量

    Institute of Scientific and Technical Information of China (English)

    向增旭; 赵维佳; 高山林

    2005-01-01

    Using gas chromatography (GC), the organochlorine insecticide residues were determined in Lonicera japonica Thunb. flowers. The results showed that the amount of organochlorine insecticide in L. japonica flowers collected from Fengqiu in He' nan Province, Pingyi in Shandong Province was less than 0.01 mg·kg-1. The average recoveries added in samples were 93.54% -98.85%, RSD≤6.8%. It shows that the amount of organochlorine insecticide in L. japonica flowers accords with the demands of traditional Chinese medicine production.

  13. Acute toxicity of organochlorine insecticide endosulfan to the giant freshwater prawn Macrobrochium rosenbergii

    Science.gov (United States)

    Dai, Xilin; Xiong, Zhaodi; Xie, Jian; Ding, Fujiang

    2014-01-01

    Endosulfan, an organochlorine pesticide, is highly toxic and effective at controlling pests in agriculture, horticulture, and public health programs. In this study, static bioassays were used to evaluate the toxicity of endosulfan to freshwater prawns ( Macrobrachium rosenbergii) of various lengths (1.5±0.03, 4±0.08, and 7±0.06 cm). Additionally, the activities of peroxidase (POD), acid phosphatase (ACP), alkaline phosphatase, acetylcholinesterase (AChE), and Na+/K+-ATPase were analyzed to reflect the effects of endosulfan exposure. The 96 h LC50 of endosulfan for prawns 1.5, 4, and 7 cm long were 1.86, 4.53, and 6.09 μg/L, respectively, improved tolerance to endosulfan with growth. The POD activities of test organisms exposed to low concentrations of endosulfan were inhibited, indicating the presence of oxygen damaged tissue. Moreover, a notable decrease in AChE activity was observed due to overstimulation of neurotransmission, which might result in abnormal behavior. The effect caused by endosulfan on phosphatase production in the hepatopancreas of prawns 1.5, 4, and 7 cm long was different because the ability of nonspecific immune regulation increased with growth. The 96 h LC50 values obtained in this study could be used in the formulation of water-quality criteria in China. Moreover, the changes in enzymes activities of M. rosenbergii under stress of endosulfan could be applied in the establishment of early warning indicators for bio-safety.

  14. Organochlorine insecticides in African agroecosystems. Report of a final research co-ordination meeting

    International Nuclear Information System (INIS)

    1997-03-01

    Adverse effects also appear within the agroecosystem itself. Intensive use of broad spectrum insecticides can reduce populations of insect parasites and predators; as a result, pest populations may be inadequately controlled. This, in turn, can lead to the need of more frequent use of pesticides and to the appearance of secondary pests. We are slowly beginning to understand how natural enemies and the other non-target fauna are affected by pesticide use in a few agroecosystems in the developed countries. The knowledge about these matters in developing countries is very rudimentary. The objectives of this programme were to increase the knowledge of how pesticides affect the agroecosystem especially pest-natural enemy interactions and the non-target fauna within and outside African agroecosystem. Chlorinated hydrocarbon pesticides were used as representing the compounds most likely to produce undesirable consequences. This TECDOC reports the accomplishments of the programme which was financed by the Swedish International Development Authority (SIDA). Refs, figs, tabs

  15. 40 CFR 129.102 - Endrin.

    Science.gov (United States)

    2010-07-01

    ...—Environmental Protection Agency method specified in 40 CFR part 136, except that a 1-liter sample size is... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS TOXIC POLLUTANT EFFLUENT... production, preparation or processing of another synthetic organic substance. (2) Endrin Formulator means a...

  16. Plasma Cholinesterase Activity in Female Green Turtles Chelonia mydas Nesting in Laguna de Terminos, Mexico Related to Organochlorine Pesticides in Their Eggs.

    Science.gov (United States)

    Rivas-Hernández, Gerardo; May-Uc, Yaneli; Noreña-Barroso, Elsa; Cobos-Gasca, Víctor; Rodríguez-Fuentes, Gabriela

    2018-01-01

    The inhibition of cholinesterase (ChE) activity has been used as a biomarker of exposure to organophosphate and carbamate insecticides. ChE of nesting female green turtles (Chelonia mydas) were biochemically characterized using two substrates, acetylthiocholine iodide and butyrylthiocholine iodide, and three ChE inhibitors (eserine sulfate, BW284C51 and iso-OMPA). The results indicated that BChE is the predominant plasma ChE in female C. mydas, but with atypical properties that differ from those found in human BChE. Eggs from green turtles nesting at two sites in Laguna de Terminos contained µg g -1 (wet weight) quantities of organochlorine (OC) pesticides. Drins (aldrin, dieldrin, endrin, endrin ketone, endrin aldehyde) were found at the highest concentrations with no significant differences in the concentrations in eggs collected at the two sampling sites. A negative relationship was found between levels of OC pesticides in eggs and BChE activity in the plasma of female turtles laying the eggs. Since OC pesticides are not cholinesterase inhibitors, we hypothesized that this inverse relationship may be related to an antagonistic effect between OCs and organophosphate pesticides and mobilization of OCs from the fatty tissues of the female turtles into their eggs. However, further study is required to verify the hypothesis. It is also possible that other contaminants, such as petroleum hydrocarbons are responsible for the modulation of cholinesterase activity in female turtles.

  17. Levels of organochlorine pesticide residue in grasscutter (Thryonomys swinderianus) tissues

    International Nuclear Information System (INIS)

    Blankson-Arthur, S.

    2009-06-01

    Organochlorine pesticide residues have been determined in the muscle, liver and kidney tissues from a total of 45 grasscutter (Thryonomys swinderianus) meat samples obtained from the Gomoa district, a vegetable farming area in the Central Region of Ghana. All samples were analyzed for their residue content of the following organochlorine pesticides; DDT, DDE, hexachlorocyclohexane isomers, lindane (γ-HCH) and δ-HCH, dieldrin, aldrin, endrin, endrin aldehyde, endrin ketone, alpha endosulfan, endosulfan sulfate, chlordane, heptachlor and methoxychlor. The results indicated that all the analyzed samples were contaminated with the studied organochlorine pesticides. Aldrin and heptachlor were the principal contaminants in all the samples. The muscle had the highest pollutant load. All organochlorine pesticides investigated were detected in the muscle tissues of the grasscutter at the following mean concentrations; aldrin 1.833μg /kg, heptachlor 0.695μg /kg, γ-HCH 0.283μg /kg, δ-HCH 0.108μg /kg, dieldrin 0.040 μg /kg, p,p'-DDT 0.019μg /kg. p,p'-DDE 0.014μg /kg, endrin 0.018μg /kg, endrin aldehyde 0.090μg /kg, endrin ketone 0.340μg /kg, α-endosulfan 0.162μg /kg, endosulfan sulfate 0.183μg /kg, gamma-chlordane 0.174μg /kg and methoxychlor 0.101μg /kg wet weight. The organochlorine pesticide residues were detected in the liver tissues at the following mean concentrations; aldrin 1.315μg /kg, heptachlor 0.530μg /kg, dieldrin 0.050μg /kg, γ-HCH 0.233μg /kg, δ-HCH 0.070μg /kg, p,p'-DDT 0.123μg /kg. p,p'-DDE 0.043μg /kg endrin aldehyde 0.110μg /kg, endrin ketone 0.115μg /kg, gamma-chlordane 0.093μg /kg and methoxychlor 0.128μg /kg wet weight. No endrin was however detected in the liver. The highest concentrations of γ-HCH, δ-HCH, endrin ketone and endrin aldehyde were measured in the kidney. The mean concentrations of γ-HCH and δ-HCH in the kidney were 0.435μg /kg and 0.107μg /kg respectively. Endrin aldehyde was detected at 0.135μg /kg in

  18. Endrin in birds: Lethal residues and secondary poisoning

    Science.gov (United States)

    Stickel, W.H.; Reichel, W.L.; Hughes, D.L.

    1979-01-01

    Endrin residues in brains that are diagnostic of death were determined for several species of birds. Residues of 0.8 ppm or more of endrin in brain meant death; 0.6 ppm or less meant survival; between was a zone of overlap. These criteria indicate that some wild birds of the U.S., particularly white pelicans in the Northwest and two bald eagles, have been killed by endrin. Signs of endrin poisoning in experimental birds are described. The important and highly toxic metabolite in rodents, 12-ketoendrin, was sought but not found.

  19. Analysis the organochlorine insecticide residual quantity in traditional Chinese herbs and soil around Nanjing%南京周边地区中药材及土壤有机氯杀虫剂残留分析

    Institute of Scientific and Technical Information of China (English)

    张良; 王韶阳

    2004-01-01

    Using gas chromatography, the organochlorine insecticide residual quantity was determined in some traditional Chinese medicinal herbs and soil samples gathered from three plantations in Qixia, Jiangning and Jurong around Nanjing City of Jiangsu Province. The results show that the amount of organochlorine insecticide in all soil samples is less than 0.5mg·kg-1, and that in crude drugs of Scrophularia ningpoensis Hemsl., Isatis indigotica Fort. and Platycodon grandiflorus (Jacq.) A. DC. is less than 0.1mg·kg-1. The soil condition reached the second standard of GB 15618—1995. It suggests that Yuanxiang town in Jurong is more suitable for planting traditional Chinese medicinal herbs.

  20. ORGANOCHLORINES IN CHRYSICHTHYS NIGRODIGITATUS ...

    African Journals Online (AJOL)

    B. S. Chandravanshi

    2Department of Chemistry, University of Lagos, Lagos, Nigeria. (Received ... epoxide (B), aldrin, dieldrin, endrin, endrin aldehyde, endrin ketone, ... persistent organic pollutants provides information on the fate processes that the contaminants.

  1. Residuos de insecticidas organoclorados presentes en leche cruda comercializada en el departamento de Córdoba, Colombia Organochlorine insecticide residues present in raw milk sold in the Department Córdoba, Colombia

    Directory of Open Access Journals (Sweden)

    2012-01-01

    Full Text Available En el estudio se determinaron residuos de plaguicidas organoclorados en leche cruda proveniente de hatos lecheros del departamento de Córdoba, Colombia. Durante el procedimiento de extracción se utilizó una columna de tierra de diatomeas y como sistema eluyente una mezcla de n-hexano-acetonaacetato de etilo (4:2:1, seguida de metanol al 5% en hexano. Para la determinación se usó un cromatógrafo de gases Perkin Elmer, Autosystem XL con detector captura de electrones, en modo de inyección ‘splitless', una columna capilar Rtx-5 30 m, 0.25 mm di y 0.25 µm de espesor de película. El porcentaje de recuperación para los plaguicidas determinados se encontró entre 88.5 y 96%, los límites de detección se definieron entre 0.01 y 0.04 ng/g con desviaciones estándar In this investigation organochlorine pesticide residues in raw milk from Dairy herds in the Cordoba department were determined. During the extraction procedure using a column of diatomaceous earth as eluting system a mixture of n-hexane-acetone-ethyl acetate (4:2:1, followed by 5% methanol in hexane. For the determination we used a gas Chromatograph Perkin Elmer, Autosystem XL with electron capture detector, split less injection mode, a capillary column Rtx-5 30m, 0.25 mm id and 0.25 um film thickness. The recovery rate for certain pesticides were between 88.5 and 96%, the detection limits were defined between 0.01 and 0.04 ng/g, relative standard deviations less than 6%. In the 63 samples tested p, p'-DDT, a-HCH, d-HCH, aldrin, dieldrin, endrin, heptachlor, heptachlor epoxide and g-chlordane were determined, establishing concentrations between 27.1 and 469.6 ng/g. The frequencies of occurrence ranged between 1.6 and 65.1% for heptachlor and p, p'-DDT, respectively. The older population that lives in the sub-regions: Middle Sinú, San Jorge and Savannas were exposed to high health risk associated with the concentration a-HCH, aldrin and dieldrin in raw milk.

  2. Exposure of women to organochlorine pesticides in Southern Spain

    International Nuclear Information System (INIS)

    Botella, B.; Crespo, Jorge; Rivas, Ana; Cerrillo, Isabel; Olea-Serrano, M.F.; Olea, N.

    2004-01-01

    Organochlorine pesticides are lipophilic compounds that persist in the environment. Because of their lipid solubility and resistance to metabolism, some of these chemicals accumulate in human tissues. The largest area of intensive greenhouse agriculture in Europe is near the Mediterranean coast of Southern Spain, where this type of farming has greatly expanded since the 1960s. We determined and compared the levels of 15 organochlorine pesticides in the adipose tissue and blood of 200 women living in Southern Spain. Aldrin, dieldrin, endrin, lindane, methoxychlor, endosulfans, and DDT and its metabolites were identified. Detectable concentrations of p,p'-DDE were found in 100% of adipose tissue and serum samples. Among the remaining DDTs, p,p'-DDT was the most common, being detected in 39% of adipose tissue and 76.5% of serum samples, followed by endosulfans I and II, which also were found in both adipose tissue and serum samples but at lower concentrations. Endosulfans were followed in frequency by lindane, aldrin, and dieldrin. Endrin and methoxychlor were present at a much lower frequency compared to those of the other organochlorines. Serum concentrations of p,p'-DDE o,p'-DDD, and endosulfan -I, -sulfate, -lactone, and -diol were significantly correlated with their adipose tissue concentrations. No significant relationships were found between the serum and adipose tissue concentrations of the remaining nine compounds determined, raising doubts about the equivalent use of fat/serum samples for the exposure assessment of some pesticides in epidemiological studies. The results suggested that women of reproductive age in Southern Spain have been and are currently exposed to organochlorine pesticides. Because many of these chemicals can mobilize during pregnancy and lactation, further research is warranted to interpret the health consequences for the children of such exposure

  3. Studies on organochlorine pesticide residues in human breast milk of primparae mothers from selected areas in the Greater Accra Region

    International Nuclear Information System (INIS)

    Osei Tutu, A.

    2009-06-01

    A study was conducted to determine the types and levels of organochlorine pesticide residuals in the human milk samples of 42 nursing mothers from Ada and Accra. The milk samples were analyzed for 14 different organochlorine pesticides residue (Aldrin, Dieldrin, p,p'-DDT, p,p'-DDE, Endrin, Endrin Aldehyde, Endrin Ketone, Endosulphan sulfate,' Alpha Endosulphan, Gamma-HCH, Delta-HCH, Gamma Chlordane, Heptachlor and Methoxychlor) using Gas chromatography with electron capture detector. The mean concentrations for the organochlorine pesticide residues detected in the human milk samples from Accra are; Gamma-HCH (4.207µg/kg fat), Delta-HCH (13.855µg/kg fat), Heptachlor (11.791µg/kg fat), Aldrin (2.962µg/kg fat), Gamma- Chlordane (1.839µg/kg fat), Alpha-Endosulfan (4.740µg/kg fat), p,p'-DDE (23.367µg/kg fat), Dieldrin (2.407µg/kg fat), p,p'-DDT (3.085µg/kg fat), Endrin (7.669µg/kg fat), Endrin Aldehyde (7.769µg/kg fat), Endosulfan-Sulphate (99.052µg/kg fat), Endrin Ketone (63.846µg/kg fat), and Methoxychlor (20.116µg/kg fat). The mean concentrations of the various organochlorine pesticide residues detected in the human milk samples from Ada are; Gamma-HCH (5.438µg/kg fat), DeIta-HCH (6.728µg/kg fat), Heptachlor (0.682µg/kg fat), Aldrin (2.38µg/kg fat), Gamma- Chlordane (1.304µg/kg fat), Alpha-Endosulfan (2.588µg/kg fat), p,p'-DDE (24.165µg/kg fat), Dieldrin (2.222µg/kg fat), p,p'-DDT (3.468µg/kg fat), Endrin (6.339 µg/kg fat), Endosulfan-Sulphate (63.803)µg/kg fat), Endrin Ketone (11.167)µg/kg fat), and Methoxychlor (0.703µg/kg fat). The mean concentration of Endosulfan Sulfate was (99.052Iµ g/kg fat) was highest for the milk samples from Accra. Gamma chlordane recorded the least mean concentration (1.839 µg/kg fat) in the milk samples from Accra. The mean concentration of Endosulfan sulfate (63.803 µg/kg fat) was still the highest as compared to the other organochlorines analyzed for in the milk samples from Ada. Endrin Aldehyde was not

  4. The Preliminary Study of Organochlorine Pesticide Residues on Sediments of Bivalvia Fishing Ground at Eastern Part of Coastal Semarang

    Science.gov (United States)

    Adhi Suryono, Chrisna; Subagyo; Setyati, Wilis Ari; Sri Susilo, Endang; Rochaddi, Baskoro; Triaji Mahendrajaya, Robertus

    2018-02-01

    This paper presents the occurrence level of organochlorine contamination in marine sediments of Semarang coastal areas as a fishing ground of Bivalvia. Five compounds (Heptachlor, Aldrin, Endosulfan, Endrin and pp-DDT) of contaminant have been determined in the sediments surface of Semarang coastal waters. The samples were then analyzed by using gas chromatography and followed by using the method of Standard Method Examination. The result showed that the average concentration of organochlorine pesticides Heptachlor, Aldrin, Endosulfan, Endrin and pp-DDT were 25.5, bellow detected, 7.1, 37.2, 28.6 μ g/L, respectively. The high concentration of pesticide showed on Endrin (65,84 ppb), pp-DDT (29,53 μ g/L), and heptachlor (25,45 μ g/L). The low concentrations were detected on aldrin (bellow detected) and endosulfan (0,92 μ g/L). The concentration of organochlorine pesticides in these areas might contribute on four rivers which deposited the sediment in these coastal waters

  5. Residues levels of organochlorine pesticide in cow's milk from industrial farms in Hidalgo, Mexico.

    Science.gov (United States)

    Gutierrez, Rey; Ortiz, Rutilio; Vega, Salvador; Schettino, Beatriz; Ramirez, Maria L; Perez, Jose J

    2013-01-01

    A survey was carried out from 2008 to 2010 to determine the concentrations of 16 organochlorine pesticide residues (OPRs) from Tizayuca, Hidalgo, Mexico. Organochlorine residue determinations were made from milk fat, using chromatographic cleanup and analysis by gas chromatography with an electron capture detector. The OPR concentrations found were from below the detection limit (DL) to 0.91 ng g(-1) in 2008, DL to 0.38 ng g(-1) in 2009 and DL to 0.59 ng g(-1) in 2010. In general concentrations of organochlorine pesticides were higher in the wet season (3.37 ng g(-1) and 4.79 ng g(-1)) than the dry season (1.92 ng g(-1) and 2.71 ng g(-1)) for 2009 and 2010, due to control of pests in the pasture and sheds. According to Codex Alimentarius regulations, individual pesticides did not exceed the permissible limits, which for example were 10 μg kg(-)1 for alpha hexachlorocyclohexane (HCH) and endosulfan I, 20 μg kg(-1) for p,p'-DDT, and 6 μg kg(-1) for dieldrin, endrin and heptachlor. A reduction of organochlorine pesticide concentrations in cow's milk was noted, indicating that the Mexican government has achieved reduction or elimination of some organochlorine pesticides in response to global agreements on persistent organic pollutants.

  6. Uptake and excretion of organochlorine pesticides by Nereis virens under normoxic and hypoxic conditions

    International Nuclear Information System (INIS)

    Haya, K.; Burridge, L.E.

    1988-01-01

    The marine polychaete worm, Nereis virens, is resistant to organochlorine pesticides. When exposed to each of five pesticides (endosulfan, chlordane, endrin, dieldrin, and DDT) in concentrations ranging from 0.03 mg/L (DDT) to 22.0 mg/L (chlordane), only endosulfan and chlordane killed Nereis. In comparison, the same compounds were much more toxic to another marine invertebrate, Crangon septemspinosa. The authors wondered if the resistance of N. virens to organochlorines was related to their response to hypoxia. N. virens is a sediment dweller often found in intertidal regions and consequently may experience periods of severe oxygen deprivation; varying degrees of hypoxia can initiate a switch to anaerobic energy metabolism. When N. virens encounter hypoxic conditions, they can also exhibit a compensatory ventilation response. In the present study, the authors measured the bioaccumulation of endosulfan, dieldrin, and DDT by N. virens under normoxic and hypoxic conditions

  7. Short-tailed shrews: Toxicity and residue relationships of DDT, dieldrin, and endrin

    Science.gov (United States)

    Blus, L.J.

    1978-01-01

    Experiments involving dietary toxicity and residue relationships of DDT, dieldrin, and endrin were conducted with short-tailed shrews. Dietary concentrations of DDT dissolved in vegetable oils were usually more toxic than diets containing comparable amounts of powdered DDT. Younger shrews, particularly females, were more tolerant of powdered DDT than older animals; yet, there were no conspicuous age differences in toxicity of DDT dissolved in oils. In comparison to other mammals, short-tailed shrews are not unusually sensitive to DDT, dieldrin, or endrin on the basis of two-week feeding tests. The influence of age and sex on toxicity of DDT, endrin, and dieldrin was sometimes more important than body weight. Of those shrews of the same age and sex that were fed the same dietary dosage, heavier shrews were more tolerant than lighter individuals; and, heavier shrews tended to lose a greater percentage of body weight before death. There was a range of 15 to 105 DDT equivalents in brains of shrews dying on dietary dosages of DDT. Six shrews fed a high level of DDT seemed to have unusual metabolite capabilities and died with apparent lethal levels of DDD in their brains. Levels of dieldrin in brains of shrews that died on a dietary dosage of dieldrin ranged from 3.7 to 12.6 ppm. In the rates of gain and loss experiments where shrews were given diets containing 400 ppm DDT or 50 ppm dieldrin up to 17 days, high residues were noted in tissues of shrews after two weeks on a contaminated diet and a few died at that time. After shrews were placed on clean food, it was determined that >50% of the dieldrin residues in carcass and brain were lost in 50% of residues of DDT and metabolites in brains after 2 weeks on clean food; males lost nearly 50% of residues in carcasses after two weeks on clean food compared with a loss of only 11% in females.

  8. Pollution Of Insecticide Residues In PPTN Pasar Jumat Area

    International Nuclear Information System (INIS)

    Syahrir, Ulfa T.; Chairul, Sofnie M.

    2000-01-01

    Measurement of insecticide residue pollution from some organochlorin and organo-phosphat in soil and water samples were carried out 1999-2000 periode. The aim of the measurement was to get information about impact of laboratorium activity on insecticide contents in PPTN PASAR JUMAT. Gas chromatograph with electron capture and flame ionization detector were used to measure the pesticide content. Result of the measurement in PPTN area showed that organo-chlorin were alpha BHC, endosulfan band DDT and organo-phosphat were klorphyriphos and malation and were lower than tolerance level

  9. DETERMINATION OF ORGANOCHLORINE PESTICIDES IN DRINKING WATERS SAMPLED FROM CLUJ AND HUNEDOARA COUNTIES

    Directory of Open Access Journals (Sweden)

    MARIA-ELISABETA LOVÁSZ

    2011-03-01

    Full Text Available Determination of organochlorine pesticides in drinking waterssampled from Cluj and Hunedoara counties. Pesticides are found scattered indifferent environmental factors (water, air, soil wherefrom they are drawn off byvegetal and animal organisms. Water pollution by pesticides results from the plantprotection products industry and also from massive application of these resourcesin agriculture and other branches of economy. Pesticides can reach surface wateralong with dripping waters and by infiltration may reach the groundwater layers,organochlorine pesticides are most often found in the water sources (dieldrin,endrin, DDT, aldrin, lindane, heptachlor, etc. due to their increased persistence inthe external environment. This study followed up the determination oforganochlorine pesticides in 14 drinking water samples collected from the outputof water treatment plants in Cluj and Hunedoara counties that process surfacewater and deep-water sources. For identification of organochlorine pesticides, thegas chromatographic method after liquid-liquid extraction was used, by a gascromatograph Shimadzu GC 2010 with detector ECD (Electron CaptureDetection. There were not detected higher values than the method detection limit(0.01 μg/l in the drinking water samples collected and analyzed for both totalorganochlorine pesticides and components, which were well below the maximumconcentration admitted by Law 452/2002 regarding drinking water quality. Resultsare correlated with the sanitary protection areas for water sources and with the useof agricultural lands in the area. The solution to reduce risk of pesticides use isecological agriculture , which gains increasingly more ground in Romania too.

  10. Risk Assessment of Organochlorines in Mollusk from the Mediterranean and Red Sea Coasts of Egypt.

    Science.gov (United States)

    El Nemr, Ahmed; El-Said, Ghada F; Khaled, Azza

    2016-04-01

    Organochlorine pesticides (OCPs) and polychlorinated biphenyls (PCBs) residues were studied in different mollusk species from the Egyptian Mediterranean and Red Sea coasts. The average levels of OCPs in mollusks comprised chlordanes, dieldrins, total endrin, endosulfan compounds, and methoxychlor (DECEM), dichlorodiphenyltrichloroethanes (DDTs), and, hexachlorocyclohexanes (HCHs). The averages of HCHs, DDTs, and polychlorinated biphenyls (PCBs) in mollusks from the Mediterranean Sea were 1.13±1.21, 1.30±1.27, and 1.40±0.93 ng/g, respectively; from the Red Sea, they were 0.62±0.90, 1.77±1.82, and 6.44±5.05 ng/g, respectively. The analysis of HCHs, DDTs, and PCBs in mollusks indicates a new usage of lindane, PCB congeners, and the input of technical HCH and aged DDT. The data showed that the Red Sea Coast was more affected by PCBs congeners than the Mediterranean Sea Coast, which may be attributed to the different activities along the two coastal areas. Mollusks in the Mediterranean Sea had higher dieldrins, total endrin, endosulfan compounds, and methoxychlor contents than those in the Red Sea. Interestingly, HCHs, DDTs, and PCBs levels were lower than those recommended for Swedish Food Regulation and U.S. Food and Drug Administration, which means that mollusks from these two coastal areas are safe as food.

  11. Organochlorine Pesticides (OCPs) in raft mussels coming from Galician rías.

    Science.gov (United States)

    Carro, Nieves; García, Isabel; Ignacio, María; Mouteira, Ana

    2017-09-01

    This survey gives an overview of the range of organochlorine pesticides (OCPs) α and γ-HCH (lindane), HCB, pp´-DDE, pp´-DDD, op´-DDT, pp´-DDT, aldrin, dieldrin, endrin, isodrin and trans-nonachlor in raft mussels cultivated in several polygons of the Galician Rías (Ares-Betanzos, Muros-Noia, Arousa, Pontevedra and Vigo) during the period 1998-2014. A significant number of OCPs were detected, but the levels found were generally low, mainly in the recent samplings (2010-2014). The levels of ∑DDs (sum of DDTs and its metabolites, pp´-DDE and pp´-DDD) ranged between 0.22 ng/g dry weight (dw) in samples from the Ría of Pontevedra and 46.4 ng/g dw in mussels from the Ría of Arousa. Both aldrin and endrin were not detected or were below the analytical limits of detection. With regard to other pesticides, dieldrin is the major compound, followed by γ-HCH, isodrin, α-HCH and transnonachlor. Significant ANOVA regressions indicated variations in levels of some OCPs with the biological parameters (lipid, condition index and shell length). Univariate and multivariate analysis of OCP levels revealed no significant differences between Rías. Temporal trends showed an important decline of OCPs in the studied samples during the period 1998-2014.

  12. Persistent organochlorine pesticides in blood serum and whole blood

    Energy Technology Data Exchange (ETDEWEB)

    Waliszewski, S.M. (Univ. of Veracruz, (Mexico)); Szymczynski, G.A. (Medical Academy, Bydgoszcz (Poland))

    1991-06-01

    Since organochlorine pesticides were introduced for plant protection and sanitation, they have been of great benefit in the control of pest populations and in combating the spread of infectious diseases. Unfortunately, they accumulate in the environment and this has resulted in a ban on their use. Nevertheless, they are still widely used in tropical countries as the insecticides of choice. An analytical procedure was elaborated to find out the extent of contamination of the human body by persistent residues of organochlorine pesticides and to determine the gradient between adipose tissue and biological fluids, which correlates with bioaccumulation and dissipation processes. The method has two important advantages: it is a simple, low-cost semi-micro, and it makes it possible to determine free and bound pesticides.

  13. Brief communication: Organochlorine pesticides in an archived firn core from Law Dome, East Antarctica

    Directory of Open Access Journals (Sweden)

    M. Bigot

    2016-10-01

    Full Text Available Organochlorine pesticides (OCPs were, for the first time, quantified in archived firn cores from East Antarctica representative of 1945–1957 and 1958–1967 (current era, C.E.. The core sections were melted under high-purity nitrogen atmosphere, and the meltwater was analysed. Methods allowed quantification of hexachlorocyclohexanes, heptachlor, trans-chlordane, dieldrin and endrin. While the core presented evidence of nominal contamination by modern-use chemicals, indicating handling and/or storage contamination, legacy OCP concentrations and deposition rates reported are orders of magnitude lower than those from Arctic regions, lending support for their validity. The study further provides a description of equipment used and suggests methods to overcome logistical challenges associated with trace organic contaminant detection in polar regions.

  14. Residues of organochlorine pesticides in soils from the southern Sonora, Mexico.

    Science.gov (United States)

    Cantu-Soto, E U; Meza-Montenegro, Maria Mercedes; Valenzuela-Quintanar, A I; Félix-Fuentes, A; Grajeda-Cota, P; Balderas-Cortes, J J; Osorio-Rosas, C L; Acuña-García, G; Aguilar-Apodaca, M G

    2011-11-01

    Although, the Yaqui and Mayo valleys are the most important agricultural areas in Sonora, there is only limited data of the pesticides residue in soils in these valleys. This study measured the organochlorine pesticides (OCPs) in 234 soil samples (residential and agricultural) from 24 communities. The global results (mean, range) indicated that benzene hexachloride (19.2, ND-938.5 μg g(-1)), endrin (6.6, ND-377.3 μg g(-1)) and DDTs (36.45, ND-679.7 μg g(-1)) were the dominant contaminants. Soil is one of the most important routes of exposure to OCPs in the population of southern Sonora and this study can be used to establish background levels of OCPs.

  15. Is Apis mellifera more sensitive to insecticides than other insects?

    Science.gov (United States)

    Hardstone, Melissa C; Scott, Jeffrey G

    2010-11-01

    Honey bees (Apis mellifera L.) are among the most important pollinators in natural and agricultural settings. They commonly encounter insecticides, and the effects of insecticides on honey bees have been frequently noted. It has been suggested that honey bees may be (as a species) uniquely sensitive to insecticides, although no comparative toxicology study has been undertaken to examine this claim. An extensive literature review was conducted, using data in which adult insects were topically treated with insecticides. The goal of this review was to summarize insecticide toxicity data between A. mellifera and other insects to determine the relative sensitivity of honey bees to insecticides. It was found that, in general, honey bees were no more sensitive than other insect species across the 62 insecticides examined. In addition, honey bees were not more sensitive to any of the six classes of insecticides (carbamates, nicotinoids, organochlorines, organophosphates, pyrethroids and miscellaneous) examined. While honey bees can be sensitive to individual insecticides, they are not a highly sensitive species to insecticides overall, or even to specific classes of insecticides. However, all pesticides should be used in a way that minimizes honey bee exposure, so as to minimize possible declines in the number of bees and/or honey contamination. Copyright © 2010 Society of Chemical Industry.

  16. Relationship between organochlorine pesticides and stress indicators in hawksbill sea turtle (Eretmochelys imbricata) nesting at Punta Xen (Campeche), Southern Gulf of Mexico.

    Science.gov (United States)

    Tremblay, Nelly; Ortíz Arana, Alejandro; González Jáuregui, Mauricio; Rendón-von Osten, Jaime

    2017-03-01

    Data on the impact of environmental pollution on the homeostasis of sea turtles remains scarce, particularly in the Southern Gulf of Mexico. As many municipalities along the coastline of the Yucatan Peninsula do not rely on a waste treatment plant, these organisms could be particularly vulnerable. We searched for relationships between the presence of organochlorine pesticides (OCP) and the level of several oxidative and pollutant stress indicators of the hawksbill sea turtle (Eretmochelys imbricata) during the 2010 nesting season at Punta Xen (Campeche, Mexico). Of the 30 sampled sea turtles, endosulfans, aldrin related (aldrin, endrin, dieldrin, endrin ketone, endrin aldehyde) and dichlorodiphenyldichloroethylene (DDT) families were detected in 17, 21 and 26, respectively. Significant correlation existed between the size of sea turtles with the concentration of methoxychlor, cholinesterase activity in plasma and heptachlors family, and catalase activity and hexachlorohexane family. Cholinesterase activity in washed erythrocytes and lipid peroxidation were positively correlated with glutathione reductase activity. Antioxidant enzyme actions seem adequate as no lipids damages were correlated with any OCPs. Future studies are necessary to evaluate the effect of OCPs on males of the area due to the significant detection of methoxychlor, which target endocrine functioning and increases its concentration with sea turtles size.

  17. Tracking residual organochlorine pesticides (OCPs) in green, herbal, and black tea leaves and infusions of commercially available tea products marketed in Poland.

    Science.gov (United States)

    Witczak, Agata; Abdel-Gawad, Hassan; Zalesak, Michal; Pohoryło, Anna

    2018-03-01

    The content of residual organochlorine pesticides (OCPs) was examined in green, herbal, and black tea leaves as well as in their infusions prepared from tea products marketed in the main supermarkets in Poland. It was found that the detected mean levels of organochlorine residues in tea leaves ranged from tea occurred in the highest concentrations. Among dichlorodiphenyltrichloroethane (DDT) metabolites the highest level of p,p'DDT (1.96 ng g -1 dw) was in green tea samples. The transfer of OCPs from tea leaves to brew was investigated. The present study revealed that during the infusion process, a significant percentage of the residues, particularly pesticides with high water solubility, were transferred to the infusions. The obtained results show that the percentage transfer of each pesticides from tea to the tea infusions ranged from 6.74% (heptachlor) to 86.6% (endrin). The detected residues were below current MRLs for these pesticides.

  18. Residues of organochlorine pesticides in surface soil and raw foods from rural areas of the Republic of Tajikistan

    Science.gov (United States)

    The central Asian Republic of Tajikistan has been an area of extensive historical agricultural pesticide use as well as large scale burials of obsolete banned chlorinated insecticides. The current investigation was a four year study of legacy organochlorine pesticides in surface ...

  19. Organochlorine pesticides in fish, water and sediments in the middle Volta Basin: a case study of Kpando Torkor lake, Volta Region of Ghana

    International Nuclear Information System (INIS)

    Gbeddy, G.K.

    2011-01-01

    The levels of contamination with selected organochlorine pesticides (OCPs) in water, sediment, and two commonly harvested fish species namely Tilapia zilli and Chrysichthys nigrodigitatus from Kpando Torkor Lake were determined. This was to give the general picture of the extent of contamination of these matrices with OCPs and also assess the suitability of the water and fish catch for human consumption. Organochlorine pesticides residues in water samples were extracted using liquid-liquid extraction whilst Soxhlet was used in the case of fish and sediment samples. All extracts were cleaned-up using packed columns and then analyzed using Gas chromatography equipped with 63 Ni electron-capture detector (ECD). Fifteen organochlorine pesticide residues namely β-HCH, γ-HCH, δ-HCH, p,p'-DDT, p,p'-DDD, p,p'-DDE, Heptachlor, Aldrin, Dieldrin, Endrin, γ-Chlordane, α-Endosulfan, β-Endosulfan, Endosulfan sulphate and Methoxychlor were investigated in this study. Thirteen of them excluding γ-HCH and Endrin were detected in sediment and fish samples at concentrations ranging from below the level of quantification (LOQ) to 37.75ng/g wet weight, and occurrence frequencies ranging from 14 to 100%. Twelve of them excluding p,p'-DDT, -HCH and Endrin were however, measured in water samples with concentrations ranging from below LOQ to 0.669μg/L and occurrence frequencies ranging from 14 to 29%. γ-HCH and p,p'-DDD were the most frequently detected residues in all samples analyzed with an average percentage frequency of 85.8, followed by Endosulfan sulphate (83.0%) and β-HCH (80.0%) among others. In consonance with their properties, organochlorine pesticide residues measured in fish samples were higher than those of sediment samples. Even though, the fat content of catfish muscle (10.24%) was higher than tilapia muscle (2.80%), the levels of organochlorine pesticide residues in tilapia tissues were however, higher than that of catfish. For instance, the levels of β-HCH in

  20. Sorption and desorption of insecticides in Brazilian soils

    International Nuclear Information System (INIS)

    Luchini, L.C.; Lord, K.A.; Ruegg, E.F.

    1980-01-01

    The sorption from aqueous solution of ten Brazilian soil types of four organochlorine, two organophosphorus and one carbamate insecticide was determined in the laboratory using gas chromatographic and radiometric techniques. Measurements showed that soils richest in organic matter, sorbed all substances except aldrin more strongly than the other soils. DDT was the most and aldrin the least sorbed organochlorine pesticide, being dieldrin sorbed two to four times more strongly than aldrin. Sorption of lindane varied in different soils. The organophosphate insecticides malathion and parathion were strongly sorbed in the soils richest in organic matter and weakly sorbed in the poorest soils heing moderately sorbed by the other soils. Sorption of carbaryl by all soils is small. Lindane was desorbed from the soil richest in organic matter and the extent of desorption was dependent on the sorption time. (Author) [pt

  1. Measuring exposure to organochlorinated pesticides

    Directory of Open Access Journals (Sweden)

    Gulnar Azevedo e Silva Mendonça

    1998-01-01

    Full Text Available Environmental epidemiological investigations in cancer remain, with rare exceptions, inconclusive. The difficulties of establishing patterns of measurements of exposure in the human body is one of the limitations of these studies. The findings of six recent epidemiological studies that analyzed the association between organochlorinated compounds and breast cancer are reviewed in considering the problems of measuring environmental exposure through biological markers. The epidemiological evidence based on these studies do not indicate a risk of breast cancer related to organochlorines. Some aspects that may partially explain this absence of risk are discussed regarding the investigation of environmental carcinogenic agents in populations with low but homogeneously sprayed levels of exposure.

  2. Organochlorine Pesticide Residues in the Major Rivers of Southern Thailand

    Directory of Open Access Journals (Sweden)

    Abd Naser Haji Samoh

    2009-01-01

    Full Text Available Environmental contaminations by organochlorine pesticides (OCPs of inland water have been a global issue, since most of these compounds are very persistent, bioaccumulative and toxic compounds. Due to the widespread use of DDT for malaria vector eradication programs in the past and no comprehensive works have been conducted to assess trace organic pollutants in river waters, this work is the first effort to assess the contamination levels of OCPs in the major rivers of Southern Thailand. The objectives of this study were to determine the concentration levels of OCPs and oil and grease in the 3 major rivers and to compare the present results with surrounding regions for further assessment of OCPs contamination status in inland waters of Southern Thailand. The water samples were collected along the 3 major rivers (Saiburi, Patani and Tiba River during June 2007-February 2008. Water samples were solid phase extracted with Supelco C-18 cartridge (1g/6 mL and quantified by gas chromatograph (GC-ECD. The concentration of oil and grease was determined by gravimetric method and reported as hexane extractable material (HEM and silica gel treated hexane extractable material (SGT-HEM. Several parameters of waters such as total suspended solid, pH, turbidity, and conductivity were measured. The commonly found OCP residues in these rivers were β-HCH, γ-HCH, heptachlor epoxide, endosulfan 1, p,p’- DDE and endrin aldehyde. The overall results showed that Saiburi River was more polluted with OCPs than Patani and Tiba River, especially p, p’-DDE which was detected in the wide range concentration of 9.6 to 203.1 ng/mL. For oil and grease contamination, Tiba River waters were found to be more polluted than either Patani or Saiburi River. The experimental procedures and analytical results together with the possible sources of OCPs and its environmental impacts are presented.

  3. Determination of levels of organochlorine pesticides in plastic resin pellets on selected beaches in the Greater Accra region of Ghana

    International Nuclear Information System (INIS)

    Amoatey, A. E.

    2012-07-01

    The levels of organochlorine pesticides (OCPs) in beached plastic resin pellets were determined with the objective of assessing the status of OCP pollution in the marine ecosystem in selected beaches in Ghana. Samples of plastic resin pellets were collected at seven beaches in Accra (namely Art centre, Sakumono, Osu castle, Labadi, Korle-Gonno, Independence Square and Tema Mighty beaches) and analyzed for organochlorine pesticides, total chlorine and extractable chlorine. The plastic pellets were subjected to Soxhlet extraction and the extracts analyzed using Gas chromatograph coupled with electron capture detector. The detected compounds were alpha-HCH, beta-HCH, gamma-HCH, delta-HCH, hexachlorobenzene, o, p' -DDE, p, p'-DDE, o,p'-DDD, o, p'-DDT, heptachlor, trans-heptachlor epoxy, trans-chlordane, trans-nanochlor, aldrin, dieldrin, endrin, alpha-endosulphan, beta-endosulphan, endosulphan sulphate and methoxychlor. Analysis of the virgin pellets recorded no organochlorine pesticides present. However, plastics pellets collected from all seven beaches were found to contain OCPs with the highest recorded on the Art Centre beach with a total concentration of 106.26 ng/g. Plastic pellets collected on the Labadi beach recorded the lowest OCPs with a concentration of 20.2 ng/g. Total chlorine and extractable organochlorine (EOCI) were also determined in the plastic resin pellets by using the Instrumental Neutron Activation Analysis (INAA). The concentrations of total chlorine analyzed by INAA were between 2.82 and 50.25 mg/kg whereas the EOCR concentrations ranged from 1.67 to 30.90 mg/kg. EOCR accounted for 48.05% of the total chlorine in plastic pellets, suggesting that chlorine in the beached pellet relatively existed as organic and are extractable. The relative proportion of known or identified organochlorines (such as HCHs, DDT s, chlordane compounds, endosulphans, HCB and methoxychlor) to the total extractable organochlorine(EOCI) was averagely 7.4% which suggested

  4. Organochlorine residues in bat guano from nine Mexican caves, 1991

    Science.gov (United States)

    Clark, D.R.; Moreno-Valdez, A.; Mora, M.A.

    1995-01-01

    Samples of bat guano, primarily from Mexican free-tailed bats (Tadarida brasiliensis), were collected at nine bat roosts in caves in northern and eastern Mexico and analysed for organochlorine residues. DDE, the most abundant residue found in each cave, was highest (0.99 p.p.m. dry weight) at Ojuela Cave, Durango. Other studies of DDE in bat guano indicate that this concentration is too low to reflect harmful concentrations in the bats themselves. The DDE at Ojuela may represent either lingering residues from use of DDT years ago in the Ojuela area of perhaps depuration loss from migrant bats with summer maternity roost(s) in a DDE-contaminated area such as Carlsbad Cavern, New Mexico. Presence of o,p-DDT at Tio Bartolo Cave, Nuevo Leon, indicates recent use of DDT, but the concentration of this contaminant was low. Possible impacts on bat colonies of the organophosphorus and carbamate insecticides now in extensive use are unknown.

  5. Monitoring of organochlorine and organophosphorus pesticide residues in water during different seasons of Tighra reservoir Gwalior, Madhya Pradesh, India.

    Science.gov (United States)

    Mamta; Rao, R J; Wani, Khursheed Ahmad

    2015-11-01

    Analysis of pesticides during different seasons for pesticidal contamination in water samples of Tighra reservoir was carried out on gas chromatograph-electron capture detector with capillary columns following multiresidual analytical technique. Organochlorine pesticides, viz., hexachlorobenzene (HCB), alpha-benzene hexachloride (BHC), beta-BHC, γ-BHC, heptachlor, aldrin, alpha-endosulfan, beta-endosulfan, p,p-DDE, dieldrin, o,p-dichlorodiphenyldichloroethane (DDD), p,p-DDD, p,p-dichlorodiphenyltrichloroethane (DDT), and endrin, and organophosphorus pesticides, viz., choloropyrifos, methyl parathion, diazion, dicholorovos, ethion, malathion, and parathion, were detected in water samples during different seasons. However, the pesticide concentration varied during different seasons at different sites. The prominent reason of contamination is the use of pesticides (both organochlorine and organophosphorus) in the agricultural fields near Tighra reservoir. On the basis of our observations, more extensive monitoring studies need to be carried out, covering all wetlands of Madhya Pradesh to enforce the policies for the restricted application of pesticides in agricultural fields adjacent to wetlands.

  6. Preliminary studies on the effect of organochlorine pesticides on birds in Tanzania

    International Nuclear Information System (INIS)

    Ijani, A.S.M.; Katondo, J.M.; Malulu, J.M.

    1997-01-01

    Preliminary studies to investigate the effects of organochlorine pesticides on birds was conducted in Lower Moshi, NAFCO West Kilimanjaro, Arusha seed farm, Tropical Pesticides Research Institute (TPRI) farms, Manyara ranch and areas around Lake Victoria as well as in the TPRI laboratory in Tanzania. Large quantities of the pesticides particularly DDT, endosulfan, dieldrin, lindane and toxaphene are still being applied against pests of cotton, coffee, maize, beans and other crops as well as disease vectors in the country. Several groups of birds including waterbirds, African Fish Eagles, Marabou storks, Oxpecker, ducks, etc. were found feeding, roosting and swimming in the water and exposed to other substances that were contaminated with organochlorine pesticides and were presumably at risk. Analytical results from the tissues of the African Fish Eagles collected from Lake Victoria areas showed that the kidneys were contaminated with p,p' DDE and o,p' DDE at levels of 0.4 ng g -1 and 1.45 ng g -1 respectively. These organochlorine insecticides as well as β-HCH were also present in the brain and liver tissues. The levels of the organochlorine residues were well below the lethal and sublethal levels for bird raptors reported in the literature. (author). 7 refs, 2 tabs

  7. Assessment of organochlorine pesticides and atrazine residues in Maize Produced in Ghana using GC-ECD/ GC-MS

    International Nuclear Information System (INIS)

    Miensah, E.D.

    2015-07-01

    Maize is consumed by over 95% of the Ghanaian populace and the practice of using atrazine, lindane and other organochlorine pesticides in its production has raised concerns about potential adverse effects on human health and the environment. A field survey was conducted in this study to assess farmers’ knowledge of safe handling and use of these chemicals as well as toxicity awareness and symptoms among farmers and traders. Residues of the pesticides in maize samples as well as the potential health risk associated with exposure to them were also evaluated. Data obtained from the field survey indicate that a large proportion of farmers are at risk of pesticide poisoning through occupational exposure. Over 80 % of applicators do not apply safety precautions during pesticide mixing and application; resulting in considerable prevalence of pesticide related illnesses in the study area. Residues of lindane and atrazine were below detection limits of 0.005 mg/kg and 0.010 mg/kg respectively of the GC-ECD/MS used for the analysis; except in the Ashanti region where atrazine was 0.05 mg/kg which is within the EU-MRL of 0.1 mg/kg. However, minute concentrations of other organochlorines (endrin- 0.007 mg/kg; heptachlor- 0.023 mg/kg; alpha-endosulfan- 0.013 mg/kg) were found in maize samples from Brong Ahafo, Eastern, Central and Upper west regions. Though endrin and alpha-endosulfan were below the EU-MRL of 0.01 mg/kg and 0.10 mg/kg respectively, heptachlor was slightly above the EU-MRL of 0.01 mg/kg. The estimated doses for all these other organochlorines pesticides do not pose direct hazard to human health because their estimated dose values were lower than toxic thresholds and reference doses. However, due to the unsafe application practices by applicators, there exists a potential risk for systemic and carcinogenic health effects by these chemicals in the study area. (au)

  8. Incidence of organochlorine pesticides and the health condition of nestling ospreys (Pandion haliaetus) at Laguna San Ignacio, a pristine area of Baja California Sur, Mexico.

    Science.gov (United States)

    Rivera-Rodríguez, Laura B; Rodríguez-Estrella, Ricardo

    2011-01-01

    We identified and quantified organochlorine (OC) pesticide residues in the plasma of 28 osprey (Pandion haliaetus) nestlings from a dense population in Laguna San Ignacio, a pristine area of Baja California Sur, Mexico, during the 2001 breeding season. Sixteen OC pesticides were identified and quantified. α-, β-, δ- and γ-hexachlorocyclohexane, heptaclor, heptachlor epoxide, endosulfan I and II, endosulfan-sulfate, p,p'-DDE, p,p'-DDD, aldrin, dieldrin, endrin, endrin aldehyde, and endrin ketone were the OCs found in the plasma of nestlings, ranging from 0.002 to 6.856 pg/μl (parts per billion). No differences were found in the concentration of pesticides between genders (P > 0.05). In our work, the concentrations detected in the plasma were lower than those reported to be a threat for the species and that affect the survival and reproduction of birds. The presence of OC pesticides in the remote Laguna San Ignacio osprey population is an indication of the ubiquitous nature of these contaminants. OCs are apparently able to travel long distances from their source to the study area. A significant relationship between hemoglobin and mean corpuscular hemoglobin concentrations and OC concentrations were found suggesting that a potential effect on the health of chicks may exist in this osprey population caused by the OC, e.g. anemia. The total proteins were positively correlated with α-BHC, endosulfan I, and p,p'-DDD. It has been suggested that OC also affects competitive interactions and population status over the long term in vertebrate species, and our results could be used as reference information for comparison with other more exposed osprey populations.

  9. Insecticide Usage and Chemical Contamination Assessment in Asiatic Pennywort

    Science.gov (United States)

    Bumroongsook, S.

    2017-07-01

    The insecticide usage in commercially grown asiatic pennywort plantations in Nakhonpatum and Nonthaburi province, Thailand was surveyed during January-June, 2016. The results showed that asiatic pennywort cuttworms was leaf destructive and caused the most damge to the production. The growers used organophosphate insecticides to control the caterpillars the most, followed by pyrethoid, abamectin, carbamate and organochlorine, respectively. The chemical contaminants of pennywort from 9 fresh markets in Bangkok was monitored, the result indicated that lead was not detected in the samples. The amount of arsenic was less than 0.075 mg / kg. The insecticide residue measurement of dicofol, chlorpyrifos and methidathion was 0.98, 2.84 and 0.46 mg / kg, respectively.

  10. Organochlorine Pesticides in the Environment

    Science.gov (United States)

    Stickel, L.F.

    1968-01-01

    Each year for nearly 20 years, thousands of pounds of persistent organochlorine pesticides have been applied to outdoor areas in many countries. These compounds may last for a very long time in the environment, and be carried by wind, water, and animals to places far distant from where they are used. As a result, most living organisms now contain organochlorine residues. This paper constitutes a selective review of the literature concerning the occurrence, distribution, and effects of organochlorines in the environment. Highest concentrations generally occur in carnivorous species. Thus predatory and fish-eating birds ordinarily have higher residues than do herbivores; quantities are similar in birds of similar habits in different countries. Any segment of the ecosystem - marshland, pond, forest, or field - receives various amounts and kinds of pesticides at irregular intervals. The different animals absorb, detoxify, store, and excrete pesticides at different rates. Different degrees of magnification of pesticide residues by living organisms in an environment are the practical result of many interactions that are far more complex than implied by the statement of magnification up the food chain. These magnifications may be millions of times from water to mud or only a few times from food to first consumer. Direct mortality of wild animals as an aftermath of recommended pesticide treatments has been recorded in the literature of numerous countries. However, accidents and carelessness also accompany pesticide use on a percentage basis and are a part of the problem. More subtle effects on the size and species composition of populations are more difficult to perceive in time to effect remedies. The possibility of ecological effects being mediated through changes in physiology and behavior has received some attention and has resulted in some disquieting findings. These include discovery of the activity of organochlorines in stimulating the breakdown of hormones or in

  11. Quantification of low levels of organochlorine pesticides using small volumes (≤100 μl) of plasma of wild birds through gas chromatography negative chemical ionization mass spectrometry

    International Nuclear Information System (INIS)

    Rivera-Rodriguez, Laura B.; Rodriguez-Estrella, Ricardo; Ellington, James Jackson; Evans, John J.

    2007-01-01

    A solid phase extraction and gas chromatography with negative chemical ionization mass spectrometry in scan mode (GC-NCI-MS) method was developed to identify and quantify for the first time low levels of organochlorine pesticides (OCs) in plasma samples of less than 100 μl from wild birds. The method detection limits ranged from 0.012 to 0.102 pg/μl and the method reporting limit from 0.036 to 0.307 pg/μl for α, γ, β and δ-hexachlorocyclohexane (HCH), heptachlor, aldrin, heptachlor epoxide, endosulfan I, 1,1-dichloro-2,2-bis(p-chlorophenyl)ethylene (p,p'-DDE), dieldrin, endrin, endosulfan-II, endrin-aldehyde and endosulfan-sulfate. Pesticide levels in small serum samples from individual Falco sparverius, Sturnella neglecta, Mimus polyglottos and Columbina passerina were quantified. Concentrations ranged from not detected (n/d) to 204.9 pg/μl for some OC pesticides. All levels in the food web in and around cultivated areas showed the presence of pesticides notwithstanding the small areas for agriculture existing in the desert of Baja California peninsula. - This technique allows small birds to be used as indicators of chemical contamination in habitats because pesticides can be quantified in very small volumes of plasma

  12. Quantification of low levels of organochlorine pesticides using small volumes ({<=}100 {mu}l) of plasma of wild birds through gas chromatography negative chemical ionization mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Rivera-Rodriguez, Laura B. [Centro de Investigaciones Biologicas del Noroeste, S.C., Environmental Planning and Conservation Program, Mar Bermejo No. 195, Col. Playa Palo de Santa Rita, Ado. Postal 128, La Paz, BCS. 23090 (Mexico)]. E-mail: lrivera04@cibnor.mx; Rodriguez-Estrella, Ricardo [Centro de Investigaciones Biologicas del Noroeste, S.C., Environmental Planning and Conservation Program, Mar Bermejo No. 195, Col. Playa Palo de Santa Rita, Ado. Postal 128, La Paz, BCS. 23090 (Mexico); Ellington, James Jackson [National Exposure Research Laboratory, US Environmental Protection Agency, 960 College Station Road, Athens, GA 30605 (United States); Evans, John J. [National Exposure Research Laboratory, US Environmental Protection Agency, 960 College Station Road, Athens, GA 30605 (United States); Senior Service America Inc. (United States)

    2007-07-15

    A solid phase extraction and gas chromatography with negative chemical ionization mass spectrometry in scan mode (GC-NCI-MS) method was developed to identify and quantify for the first time low levels of organochlorine pesticides (OCs) in plasma samples of less than 100 {mu}l from wild birds. The method detection limits ranged from 0.012 to 0.102 pg/{mu}l and the method reporting limit from 0.036 to 0.307 pg/{mu}l for {alpha}, {gamma}, {beta} and {delta}-hexachlorocyclohexane (HCH), heptachlor, aldrin, heptachlor epoxide, endosulfan I, 1,1-dichloro-2,2-bis(p-chlorophenyl)ethylene (p,p'-DDE), dieldrin, endrin, endosulfan-II, endrin-aldehyde and endosulfan-sulfate. Pesticide levels in small serum samples from individual Falco sparverius, Sturnella neglecta, Mimus polyglottos and Columbina passerina were quantified. Concentrations ranged from not detected (n/d) to 204.9 pg/{mu}l for some OC pesticides. All levels in the food web in and around cultivated areas showed the presence of pesticides notwithstanding the small areas for agriculture existing in the desert of Baja California peninsula. - This technique allows small birds to be used as indicators of chemical contamination in habitats because pesticides can be quantified in very small volumes of plasma.

  13. Atmospheric Concentrations of Organochlorine Pesticides in the ...

    African Journals Online (AJOL)

    Organochlorine pesticides may still be in use in the Eastern African region for agricultural purposes and for the control of mosquitoes. Atmospheric concentrations of organochlorine pesticides are expected to be higher in the tropics compared to temperate regions due to prevailing high temperatures. However, no study has ...

  14. Efficiency of modified chemical remediation techniques for soil contaminated by organochlorine pesticides

    Science.gov (United States)

    Correa-Torres, S. N.; Kopytko, M.; Avila, S.

    2016-07-01

    This study reports the optimization of innovation chemical techniques in order to improve the remediation of soils contaminated with organochloride pesticides. The techniques used for remediation were dehalogenation and chemical oxidation in soil contaminated by pesticides. These techniques were applied sequentially and combined to evaluate the design optimize the concentration and contact time variables. The soil of this study was collect in cotton crop zone in Agustin Codazzi municipality, Colombia, and its physical properties was measure. The modified dehalogenation technique of EPA was applied on the contaminated soil by adding Sodium Bicarbonate solution at different concentrations and rates during 4, 7 and 14 days, subsequently oxidation technique was implemented by applying a solution of KMnO4 at different concentration and reaction times. Organochlorine were detected by Gas Chromatography analysis coupled Mass Spectrometry and its removals were between 85.4- 90.0% of compounds such as 4, 4’-DDT, 4,4’-DDD, 4,4-DDE, trans-Clordane y Endrin. These results demonstrate that the technique of dehalogenation with oxidation chemistry can be used for remediation soils contaminated by organochloride pesticides.

  15. Microwave-assisted extraction and mild saponification for determination of organochlorine pesticides in oyster samples.

    Science.gov (United States)

    Carro, N; García, I; Ignacio, M-C; Llompart, M; Yebra, M-C; Mouteira, A

    2002-10-01

    A sample-preparation procedure (extraction and saponification) using microwave energy is proposed for determination of organochlorine pesticides in oyster samples. A Plackett-Burman factorial design has been used to optimize the microwave-assisted extraction and mild saponification on a freeze dried sample spiked with a mixture of aldrin, endrin, dieldrin, heptachlor, heptachorepoxide, isodrin, transnonachlor, p, p'-DDE, and p, p'-DDD. Six variables: solvent volume, extraction time, extraction temperature, amount of acetone (%) in the extractant solvent, amount of sample, and volume of NaOH solution were considered in the optimization process. The results show that the amount of sample is statistically significant for dieldrin, aldrin, p, p'-DDE, heptachlor, and transnonachlor and solvent volume for dieldrin, aldrin, and p, p'-DDE. The volume of NaOH solution is statistically significant for aldrin and p, p'-DDE only. Extraction temperature and extraction time seem to be the main factors determining the efficiency of extraction process for isodrin and p, p'-DDE, respectively. The optimized procedure was compared with conventional Soxhlet extraction.

  16. Persistent Organochlorine Pesticide Residues in Some Selected Cocoa Beverages in Nigeria

    Directory of Open Access Journals (Sweden)

    Olayinka A. Ibigbami

    2017-12-01

    Full Text Available This study evaluates the quality of the cocoa beverages produced in Nigeria with respect to the occurrence and levels of organochlorine pesticides OCPs residues in order to ascertain the potential health risks to the general public. Seven cocoa-based beverages were analysed for 17 OCP residues using gas chromatography coupled with an Electron Captured Detector (GC-ECD after extraction and silica-gel clean-up. The study reveals the presence of ten OCP residues in the cocoa beverages, with a concentration range from not detected ND—0.256 mg/kg, while α-BHC, β-BHC, methoxychlor, p,p′-DDE, dieldrin, endrin aldehyde, and endosulfan sulphate were not detected in any of the analysed samples. The contamination pattern of OCPs in the beverages was in the following order: Ovaltine > Milo > Cadbury-choco > Bournvita > Cowbell-coffee > Richoco > Oluji, with p,p′-DDT being the most frequently found pesticide. Heptachlor and endosulfan II showeda residual level above the European Union (EU Maximum Residual Limits (MRLs in only one sample.

  17. Current Perspectives on Plague Vector Control in Madagascar: Susceptibility Status of Xenopsylla cheopis to 12 Insecticides.

    Science.gov (United States)

    Miarinjara, Adélaïde; Boyer, Sébastien

    2016-02-01

    Plague is a rodent disease transmissible to humans by infected flea bites, and Madagascar is one of the countries with the highest plague incidence in the world. This study reports the susceptibility of the main plague vector Xenopsylla cheopis to 12 different insecticides belonging to 4 insecticide families (carbamates, organophosphates, pyrethroids and organochlorines). Eight populations from different geographical regions of Madagascar previously resistant to deltamethrin were tested with a World Health Organization standard bioassay. Insecticide susceptibility varied amongst populations, but all of them were resistant to six insecticides belonging to pyrethroid and carbamate insecticides (alphacypermethrin, lambdacyhalothrin, etofenprox, deltamethrin, bendiocarb and propoxur). Only one insecticide (dieldrin) was an efficient pulicide for all flea populations. Cross resistances were suspected. This study proposes at least three alternative insecticides (malathion, fenitrothion and cyfluthrin) to replace deltamethrin during plague epidemic responses, but the most efficient insecticide may be different for each population studied. We highlight the importance of continuous insecticide susceptibility surveillance in the areas of high plague risk in Madagascar.

  18. Evaluating organochlorine pesticide residues in the aquatic environment of the Lake Naivasha River basin using passive sampling techniques.

    Science.gov (United States)

    Abbasi, Yasser; Mannaerts, Chris M

    2018-05-18

    Passive sampling techniques can improve the discovery of low concentrations by continuous collecting the contaminants, which usually go undetected with classic and once-off time-point grab sampling. The aim of this study was to evaluate organochlorine pesticide (OCP) residues in the aquatic environment of the Lake Naivasha river basin (Kenya) using passive sampling techniques. Silicone rubber sheet and Speedisk samplers were used to detect residues of α-HCH, β-HCH, γ-HCH, δ-HCH, heptachlor, aldrin, heptachlor epoxide, pp-DDE, endrin, dieldrin, α-endosulfan, β-endosulfan, pp-DDD, endrin aldehyde, pp-DDT, endosulfan sulfate, and methoxychlor in the Malewa River and Lake Naivasha. After solvent extraction from the sampling media, the residues were analyzed using gas chromatography electron capture detection (GC-ECD) for the OCPs and gas chromatography-mass spectrometry (GC-MS) for the PCB reference compounds. Measuring the OCP residues using the silicone rubber samplers revealed the highest concentration of residues (∑OCPs of 81 (± 18.9 SD) μg/L) to be at the Lake site, being the ultimate accumulation environment for surficial hydrological, chemical, and sediment transport through the river basin. The total OCP residue sums changed to 71.5 (± 11.3 SD) μg/L for the Middle Malewa and 59 (± 12.5 SD) μg/L for the Upper Malewa River sampling sites. The concentration sums of OCPs detected using the Speedisk samplers at the Upper Malewa, Middle Malewa, and the Lake Naivasha sites were 28.2 (± 4.2 SD), 31.3 (± 1.8 SD), and 34.2 (± 6.4 SD) μg/L, respectively. An evaluation of the different pesticide compound variations identified at the three sites revealed that endosulfan sulfate, α-HCH, methoxychlor, and endrin aldehyde residues were still found at all sampling sites. However, the statistical analysis of one-way ANOVA for testing the differences of ∑OCPs between the sampling sites for both the silicone rubber sheet and Speedisk samplers

  19. Persistent organochlorine pesticide residues in freshwater systems ...

    African Journals Online (AJOL)

    DRINIE

    determined in water and sediment samples of freshwater systems in the Eastern Cape Province of South Africa that ... The organochlorine pesticides (OCPs) in water and sediments ...... Test Methods For Evaluating Solid Waste (3rd edn.) ...

  20. Insecticide solvents: interference with insecticidal action.

    Science.gov (United States)

    Brattsten, L B; Wilkinson, C F

    1977-06-10

    Several commercial solvent mixtures commonly used as insecticide carriers in spray formulations increase by more than threefold the microsomal N-demethylation of p-chloro N-methylaniline in midgut preparations of southern army-worm (Spodoptera eridania) larvae exposed orally to the test solvents. Under laboratory conditions, the same solvent mixtures exhibit a protective action against the in vivo toxicity of the insecticide carbaryl to the larvae. The data are discussed with respect to possible solvent-insecticide interactions occurring under field conditions and, more broadly, to potential toxicological hazards of these solvents to humans.

  1. Organochlorine Pesticides in Honey and Pollen Samples from Managed Colonies of the Honey Bee Apis mellifera Linnaeus and the Stingless Bee Scaptotrigona mexicana Guérin from Southern, Mexico.

    Science.gov (United States)

    Ruiz-Toledo, Jovani; Vandame, Rémy; Castro-Chan, Ricardo Alberto; Penilla-Navarro, Rosa Patricia; Gómez, Jaime; Sánchez, Daniel

    2018-05-10

    In this paper, we show the results of investigating the presence of organochlorine pesticides in honey and pollen samples from managed colonies of the honey bee, Apis mellifera L. and of the stingless bee Scaptotrigona mexicana Guérin. Three colonies of each species were moved into each of two sites. Three samples of pollen and three samples of honey were collected from each colony: the first collection occurred at the beginning of the study and the following ones at every six months during a year. Thus the total number of samples collected was 36 for honey (18 for A. mellifera and 18 for S. mexicana ) and 36 for pollen (18 for A. mellifera and 18 for S. mexicana ). We found that 88.44% and 93.33% of honey samples, and 22.22% and 100% of pollen samples of S. mexicana and A. mellifera , respectively, resulted positive to at least one organochlorine. The most abundant pesticides were Heptaclor (44% of the samples), γ-HCH (36%), DDT (19%), Endrin (18%) and DDE (11%). Despite the short foraging range of S. mexicana , the number of pesticides quantified in the honey samples was similar to that of A. mellifera . Paradoxically we found a small number of organochlorines in pollen samples of S. mexicana in comparison to A. mellifera , perhaps indicating a low abundance of pollen sources within the foraging range of this species.

  2. Organochlorine Pesticides in Honey and Pollen Samples from Managed Colonies of the Honey Bee Apis mellifera Linnaeus and the Stingless Bee Scaptotrigona mexicana Guérin from Southern, Mexico

    Directory of Open Access Journals (Sweden)

    Jovani Ruiz-Toledo

    2018-05-01

    Full Text Available In this paper, we show the results of investigating the presence of organochlorine pesticides in honey and pollen samples from managed colonies of the honey bee, Apis mellifera L. and of the stingless bee Scaptotrigona mexicana Guérin. Three colonies of each species were moved into each of two sites. Three samples of pollen and three samples of honey were collected from each colony: the first collection occurred at the beginning of the study and the following ones at every six months during a year. Thus the total number of samples collected was 36 for honey (18 for A. mellifera and 18 for S. mexicana and 36 for pollen (18 for A. mellifera and 18 for S. mexicana. We found that 88.44% and 93.33% of honey samples, and 22.22% and 100% of pollen samples of S. mexicana and A. mellifera, respectively, resulted positive to at least one organochlorine. The most abundant pesticides were Heptaclor (44% of the samples, γ-HCH (36%, DDT (19%, Endrin (18% and DDE (11%. Despite the short foraging range of S. mexicana, the number of pesticides quantified in the honey samples was similar to that of A. mellifera. Paradoxically we found a small number of organochlorines in pollen samples of S. mexicana in comparison to A. mellifera, perhaps indicating a low abundance of pollen sources within the foraging range of this species.

  3. Determination of soil content in chlordecone (organochlorine pesticide) using near infrared reflectance spectroscopy (NIRS)

    Energy Technology Data Exchange (ETDEWEB)

    Brunet, Didier, E-mail: didier.brunet@ird.f [IRD - Institut de Recherche pour le Developpement, UMR Eco and Sols (Ecologie Fonctionnelle et Biogeochimie des Sols), Montpellier SupAgro, Batiment 12, 2 place Viala, 34060 Montpellier Cedex 1 (France); Woignier, Thierry [IRD, UMR Eco and Sols, PRAM (Pole de Recherche Agronomique de la Martinique), BP 213, Petit Morne, 97232 Le Lamentin, Martinique (French West Indies) (France); CNRS - Centre National de la Recherche Scientifique, Universite Montpellier 2, place Eugene Bataillon, 34095 Montpellier Cedex 5 (France); Lesueur-Jannoyer, Magalie; Achard, Raphael [CIRAD (Centre de Cooperation Internationale en Recherche Agronomique pour le Developpement), PRAM, BP 213, Petit Morne, 97232 Le Lamentin, Martinique (French West Indies) (France); Rangon, Luc [IRD, UMR Eco and Sols, PRAM (Pole de Recherche Agronomique de la Martinique), BP 213, Petit Morne, 97232 Le Lamentin, Martinique (French West Indies) (France); Barthes, Bernard G. [IRD - Institut de Recherche pour le Developpement, UMR Eco and Sols (Ecologie Fonctionnelle et Biogeochimie des Sols), Montpellier SupAgro, Batiment 12, 2 place Viala, 34060 Montpellier Cedex 1 (France)

    2009-11-15

    Chlordecone is a toxic organochlorine insecticide that was used in banana plantations until 1993 in the French West Indies. This study aimed at assessing the potential of near infrared reflectance spectroscopy (NIRS) for determining chlordecone content in Andosols, Nitisols and Ferralsols from Martinique. Using partial least square regression, chlordecone content conventionally determined through gas chromatography-mass spectrometry could be correctly predicted by NIRS (Q{sup 2} = 0.75, R{sup 2} = 0.82 for the total set), especially for samples with chlordecone content <12 mg kg{sup -1} or when the sample set was rather homogeneous (Q{sup 2} = 0.91, R{sup 2} = 0.82 for the Andosols). Conventional measures and NIRS predictions were poorly correlated for chlordecone content >12 mg kg{sup -1}, nevertheless ca. 80% samples were correctly predicted when the set was divided into three or four classes of chlordecone content. Thus NIRS could be considered a time- and cost-effective method for characterising soil contamination by chlordecone. - Soil content in chlordecone, an organochlorine insecticide, can be determined time- and cost-effectively using near infrared reflectance spectroscopy (NIRS).

  4. Determination of soil content in chlordecone (organochlorine pesticide) using near infrared reflectance spectroscopy (NIRS)

    International Nuclear Information System (INIS)

    Brunet, Didier; Woignier, Thierry; Lesueur-Jannoyer, Magalie; Achard, Raphael; Rangon, Luc; Barthes, Bernard G.

    2009-01-01

    Chlordecone is a toxic organochlorine insecticide that was used in banana plantations until 1993 in the French West Indies. This study aimed at assessing the potential of near infrared reflectance spectroscopy (NIRS) for determining chlordecone content in Andosols, Nitisols and Ferralsols from Martinique. Using partial least square regression, chlordecone content conventionally determined through gas chromatography-mass spectrometry could be correctly predicted by NIRS (Q 2 = 0.75, R 2 = 0.82 for the total set), especially for samples with chlordecone content -1 or when the sample set was rather homogeneous (Q 2 = 0.91, R 2 = 0.82 for the Andosols). Conventional measures and NIRS predictions were poorly correlated for chlordecone content >12 mg kg -1 , nevertheless ca. 80% samples were correctly predicted when the set was divided into three or four classes of chlordecone content. Thus NIRS could be considered a time- and cost-effective method for characterising soil contamination by chlordecone. - Soil content in chlordecone, an organochlorine insecticide, can be determined time- and cost-effectively using near infrared reflectance spectroscopy (NIRS).

  5. Organochlorine residues and shell thicknesses in eggs of the clapper rail, common gallinule, purple gallinule, and limpkin (class Aves), eastern and southern United States, 1972-74.

    Science.gov (United States)

    Klaas, E E; Ohlendorf, H M; Cromartie, E

    1980-12-01

    Organochlorine residues and shell thicknesses were surveyed in eggs of the clapper rail (Rallus longirostris), purple gallinule (Porphyrula martinica), common gallinule (Gallinula chloropas), and limpkin (Aramus guarauna) from the eastern and southern United States. Clapper rail eggs were collected during 1972-73 in New Jersey, Virginia, and South Carolina. During 1973-74, gallinule eggs were collected in Florida, South Carolina, and Louisiana, and limpkin eggs were collected in Florida. Egg contents were analyzed for residues of organochlorine pesticides, including DDT, TDE, DDE, dieldrin, mirex, heptachlor epoxide, oxychlordane, cis-chlordane (and/or trans-nonachlor), cis-nonachlor, hexachlorobenzene (HCB), toxaphene, and endrin, and for polychlorinated biphenyls (PCBs). Shell thicknesses of recent eggs of these species were compared with archival eggs that had been collected before 1947. With the exception of the limpkin, the majority of eggs analyzed contained residues of p,p'-DDE and PCBs. Geometric means ranged from 0.10 ppm to 1.3 ppm. Small amounts (less than 1.0 ppm) of mirex, dieldrin, cis-chlordane (and/or trans-nonachlor), TDE, and DDT were detected in a few eggs. No evidence of eggshell thinning was found for any of the species studied. DDE residues in clapper rail eggs were higher in New Jersey and Virginia than in South Carolina.

  6. Organochlorine residues and shell thickness in eggs of the clapper rail, common gallinule, purple gallinule, and limpkin (Class Aves), eastern and southern United States, 1972-74

    Science.gov (United States)

    Klaas, E.E.; Ohlendorf, H.M.; Cromartie, E.

    1980-01-01

    Organochlorine residues and shell thicknesses were surveyed in eggs of the clapper rail (Rallus longirostris), purple gallinule (Porphyrula martinica), common gallinule (Gallinula chloropas), and limpkin (Aramus guarauna) from the eastern and southern United States. Clapper rail eggs were collected during 1972-73 in New Jersey, Virginia, and South Carolina. During 1973-74, gallinule eggs were collected in Florida, South Carolina, and Louisiana, and limpkin eggs were collected in Florida. Egg contents were analyzed for residues of organochlorine pesticides, including DDT, TDE, DDE, dieldrin, mirex, heptachlor epoxide, oxychlordane, cis-chlordane (and/or trans-nonachlor), cis-nonachlor, hexachlorobenzene (HCB), toxaphene, and endrin, and for polychlorinated biphenyls (PCBs). Shell thicknesses of recent eggs of these species were compared with archival eggs that had been collected before 1947. With the exception of the limpkin, the majority of eggs analyzed contained residues of p,p'-DDE and PCBs. Geometric means ranged from 0.10 ppm to 1.3 ppm. Small amounts (less than 1.0 ppm) of mirex, dieldrin, cis-chlordane (and/or trans-nonachlor), TDE, and DDT were detected in a few eggs. No evidence of eggshell thinning was found for any of the species studied. DDE residues in clapper rail eggs were higher in New Jersey and Virginia than in South Carolina.

  7. Biomonitoring of organochlorines in women with benign and malignant breast disease

    International Nuclear Information System (INIS)

    Siddiqui, M.K.J.; Anand, M.; Mehrotra, P.K.; Sarangi, R.; Mathur, N.

    2005-01-01

    Established risk factors for breast cancer explain breast cancer risk only partially. Organochlorines are considered to be a possible cause for hormone-dependent cancers. A hospital-based case-control study, the first from India, was conducted among 50 women undergoing surgery for breast disease to examine the association between organochlorine exposure and breast cancer risk. Blood, tumor, and surrounding adipose tissue of the breast were collected from the subjects with benign (control) and malignant breast (study) lesions and analyzed to determine organochlorine insecticides using a gas-liquid chromatograph equipped with an electron capture detector. The α, β, γ, and δ isomers of hexachlorocyclohexane (HCH), p,p'-dichlorodiphenyltrichloroethane (DDT), o,p'-DDT, p,p-dichlorodiphenyldichloroethylene, and p,p'-dichlorodiphenyldichloroethane were frequently detected in three specimens. Total HCH and total DDT levels were higher in the blood of the study group (25 cases) than in those of the controls (25 cases) with only γ-HCH being significantly different (P0.05). However, both total HCH and total DDT were higher in the tumor tissues of the controls than in those of the study group; γ-HCH was significantly different (P0.05). The level of total HCH (α-HCH was significantly different, P0.05) was higher in the breast adipose tissue of the study group, whereas total DDT was higher in the breast adipose tissue of the control group. The distribution of known confounders of breast cancer including age, body mass index, age at menarche and menopause, duration of breast feeding, and family history related to breast disease did not differ significantly between benign and malignant groups. This pilot study with limited statistical power does not support a positive association between exposure to organochlorines and risk of breast cancer but paves the way for a larger Indian study with greater statistical power encompassing different regions of the country to enable

  8. EFEKTIVITAS INSEKTISIDA ORGANOCHLORIN OMS-1558 DALAM PENGENDALIAN VEKTOR MALARIA ANOPHELES ACONITUS DONITZ YANG SUDAH KEBAL TERHADAP DDT

    Directory of Open Access Journals (Sweden)

    Barodji Barodji

    2012-09-01

    Full Text Available A village-scale trial of organochlorin compound OMS-1558 as an 70% water-dispersible powder (wdp and applied as an indoor residual spray at 2 gr/m2, was carried out against the DDT—resistant malaria vector Anopheles aconitus near Semarang, Central Java. Result of this trial, as evaluated by human-vector contact rates, resting densities and parous rate showed effectiveness against the vector populations for only about one week or less. In contact bioassay tests mortalities of 50% or greater for one week, while mortalities from air-borne bioassay tests were negligible. It was concluded that DDT—resistant malaria vector can not be controlled by this insecticide. The result of susceptibility tests showed there is cross resistance between DDT and new organochlorin OMS-1558.

  9. Organochlorine pesticide residues in dried cocoa beans obtained from cocoa stores at Ondo and Ile-Ife, Southwestern Nigeria

    Directory of Open Access Journals (Sweden)

    J.A.O. Oyekunle

    Full Text Available Levels of organochlorine pesticides (OCPs were determined in dried cocoa beans obtained from cocoa produce stores at Ondo and Ile-Ife, Southwestern Nigeria. Cocoa beans samples were sun dried to a constant weight, pulverized and soxhlet extracted with dichloromethane to obtain the OCPs. Qualitative identification and quantitative evaluation of the extracted OCPs after clean-up on silica gel were accomplished with the aid of a Gas Chromatography coupled with an Electron Capture Detector (GC-ECD. Levels of OCPs in cocoa beans from Ondo had a mean range of ND (p, p’-DDE to 82.17 ± 54.53 ng/g (p, p’-DDT were higher than the OCPs levels in cocoa beans from Ile-Ife with a mean range of 0.37 ± 0.63 ng/g (Endrin to 57.76 ± 81.48 ng/g (p, p’-DDT. The higher levels of OCPs detected in the cocoa beans from Ondo could be an indication of higher volume of OCPs application by cocoa farmers in Ondo and its environs since cocoa plantations were more concentrated than Ile-Ife environs. Levels of OCPs determined in the cocoa beans were within the Maximum Residue Limit (MRLs for OCPs set by the World Health Organization/Food and Agricultural Organization. The study established the presence of OCPs in an important crop of Nigeria. Hence, there is the need to keep monitoring ecotoxicological chemical substances in agricultural food products of Nigeria so as to take steps that ensure health safety of end users. Keywords: Pesticides, Organochlorine, Cocoa beans, Ondo, Ile-Ife, Nigeria

  10. Levels of organochlorine pesticides in blood plasma from residents of malaria-endemic communities in Chiapas, Mexico.

    Science.gov (United States)

    Ruiz-Suárez, Luz E; Castro-Chan, Ricardo A; Rivero-Pérez, Norma E; Trejo-Acevedo, Antonio; Guillén-Navarro, Griselda K; Geissen, Violette; Bello-Mendoza, Ricardo

    2014-10-10

    Organochlorine (OC) pesticides have been extensively used for pest control in agriculture and against malaria vectors in the region of Soconusco, Chiapas, in southern Mexico. Our study aimed to identify whether the inhabitants of four Soconusco communities at different locations (i.e., altitudes) and with different history of use of OC pesticides, have been similarly exposed to residues of these pesticides. In particular, we analyzed the potential relationship between levels of OC pesticides in plasma and the age, gender, and residence of the study population (n = 60). We detected seven pesticides in total (γ-HCH, β-HCH, heptachlor, p,p'-DDE, p,p'-DDT, β-endosulfan, endrin aldehyde). Of these, p,p'-DDE and β-endosulfan were the most frequently found (in 98% and 38% of the samples, respectively). The low-altitude (60 years) had the highest p,p'-DDE level (56.94 ± 57.81 µg/L) of all age groups, while men had higher p,p'-DDE (34.00 ± 46.76 µg/L) than women. Our results demonstrate that residents of the Soconusco region are exposed to p,p'-DDE because of high exposure to DDT in the past and current environmental exposure to this DDT-breakdown product.

  11. Metals and organochlorine pesticides in caudal scutes of crocodiles from Belize and Costa Rica

    Energy Technology Data Exchange (ETDEWEB)

    Rainwater, Thomas R. [Institute of Environmental and Human Health, Department of Environmental Toxicology, Texas Tech University, Lubbock, TX 79409 (United States)]. E-mail: thomas.rainwater@tiehh.ttu.edu; Wu, Ted H. [Institute of Environmental and Human Health, Department of Environmental Toxicology, Texas Tech University, Lubbock, TX 79409 (United States); Finger, Adam G. [Institute of Environmental and Human Health, Department of Environmental Toxicology, Texas Tech University, Lubbock, TX 79409 (United States); Canas, Jaclyn E. [Institute of Environmental and Human Health, Department of Environmental Toxicology, Texas Tech University, Lubbock, TX 79409 (United States); Yu Lu [Institute of Environmental and Human Health, Department of Environmental Toxicology, Texas Tech University, Lubbock, TX 79409 (United States); Reynolds, Kevin D. [Institute of Environmental and Human Health, Department of Environmental Toxicology, Texas Tech University, Lubbock, TX 79409 (United States); Coimbatore, Gopal [Institute of Environmental and Human Health, Department of Environmental Toxicology, Texas Tech University, Lubbock, TX 79409 (United States); Barr, Brady [National Geographic Channel, 1145 17th St. NW Washington, DC 20036 (United States); Platt, Steven G. [Department of Biology, Box C-64, Sul Ross State University, Alpine, TX 79832 (United States); Cobb, George P. [Institute of Environmental and Human Health, Department of Environmental Toxicology, Texas Tech University, Lubbock, TX 79409 (United States); Anderson, Todd A. [Institute of Environmental and Human Health, Department of Environmental Toxicology, Texas Tech University, Lubbock, TX 79409 (United States); McMurry, Scott T. [Institute of Environmental and Human Health, Department of Environmental Toxicology, Texas Tech University, Lubbock, TX 79409 (United States)

    2007-02-01

    Despite high animal diversity in the Neotropics and the largely unregulated use and disposal of pesticides and industrial chemicals in Central America, few data exist regarding accumulation of environmental contaminants in Central American wildlife. In this study we examined accumulation of metals and organochlorine (OC) pesticides in caudal scutes of crocodiles from Belize and Costa Rica. Scutes from Morelet's crocodiles (Crocodylus moreletii) from two sites in northern Belize were analyzed for metals, and scutes from American crocodiles (C. acutus) from one site in Costa Rica were analyzed for metals and OC pesticides. All scutes (n = 25; one scute from each of 25 individuals) contained multiple contaminants. Mercury was the predominant metal detected, occurring in all scutes examined from both species. Other metals detected include cadmium, copper, lead, and zinc. American crocodile scutes from Costa Rica contained multiple OC pesticides, including endrin, methoxychlor, p,p'-DDE, and p,p'-DDT, all of which occurred in 100% of scutes analyzed (n = 6). Mean metal and OC concentrations varied in relation to those previously reported in crocodilian scutes from other localities in North, Central, and South America. OC concentrations in American crocodile scutes were generally higher than those previously reported for other Costa Rican wildlife. Currently, caudal scutes may serve as general, non-lethal indicators of contaminant accumulation in crocodilians and their areas of occurrence. However, a better understanding of the relationships between pollutant concentrations in scutes, internal tissues, and environmental matrices at sample collection sites are needed to improve the utility of scutes in future ecotoxicological investigations.

  12. Metals and organochlorine pesticides in caudal scutes of crocodiles from Belize and Costa Rica

    International Nuclear Information System (INIS)

    Rainwater, Thomas R.; Wu, Ted H.; Finger, Adam G.; Canas, Jaclyn E.; Yu Lu; Reynolds, Kevin D.; Coimbatore, Gopal; Barr, Brady; Platt, Steven G.; Cobb, George P.; Anderson, Todd A.; McMurry, Scott T.

    2007-01-01

    Despite high animal diversity in the Neotropics and the largely unregulated use and disposal of pesticides and industrial chemicals in Central America, few data exist regarding accumulation of environmental contaminants in Central American wildlife. In this study we examined accumulation of metals and organochlorine (OC) pesticides in caudal scutes of crocodiles from Belize and Costa Rica. Scutes from Morelet's crocodiles (Crocodylus moreletii) from two sites in northern Belize were analyzed for metals, and scutes from American crocodiles (C. acutus) from one site in Costa Rica were analyzed for metals and OC pesticides. All scutes (n = 25; one scute from each of 25 individuals) contained multiple contaminants. Mercury was the predominant metal detected, occurring in all scutes examined from both species. Other metals detected include cadmium, copper, lead, and zinc. American crocodile scutes from Costa Rica contained multiple OC pesticides, including endrin, methoxychlor, p,p'-DDE, and p,p'-DDT, all of which occurred in 100% of scutes analyzed (n = 6). Mean metal and OC concentrations varied in relation to those previously reported in crocodilian scutes from other localities in North, Central, and South America. OC concentrations in American crocodile scutes were generally higher than those previously reported for other Costa Rican wildlife. Currently, caudal scutes may serve as general, non-lethal indicators of contaminant accumulation in crocodilians and their areas of occurrence. However, a better understanding of the relationships between pollutant concentrations in scutes, internal tissues, and environmental matrices at sample collection sites are needed to improve the utility of scutes in future ecotoxicological investigations

  13. Concentrations and potential health hazards of organochlorine pesticides in (shallow) groundwater of Taihu Lake region, China.

    Science.gov (United States)

    Wu, Chunfa; Luo, Yongming; Gui, Tong; Huang, Yujuan

    2014-02-01

    A total of 27 shallow groundwater samples were collected from the Taihu Lake region (TLR), to determine the concentrations of 14 organochlorine pesticide (OCP) species, identify their possible sources, and estimate health risk of drinking the shallow groundwater. All OCP species occurred in the shallow groundwater of TLR with high detection frequency except p, p'-dichlorodiphenyldichlorothane (p, p'-DDD) and p, p'-dichlorodiphenyltrichloroethane (p, p'-DDT). DDTs and hexachlorocyclohexanes (HCHs) were the dominant OCP contaminants in the shallow groundwater of TLR, and they account for 44.2% total OCPs. The low α-HCH/γ-HCH ratio, high β-HCH/(α+γ)-HCH ratio and β-HCH being the dominant HCH isomers for the majority of samples suggest that the HCHs were mainly from the historical use of lindane after a period of degradation. p, p'-DDE being the dominant DDT metabolite for all the samples indicated that the DDTs were mainly from the historical residues. Compositional analysis also suggested that there were fresh input sources of heptachlors, aldrins and endrins in addition to the historical residues. Correlation analysis indicated the hexachlorobenzene (HCB) impurity in the shallow groundwater of TLR was likely from the historical application of lindane and technical HCH (a mixture of HCH isomers that is produced by photochlorination of benzene). Carcinogenic risk values for α-HCH, heptachlor, heptachlor epoxide, aldrins and dieldrin in the shallow groundwater in majority area of TLR were found to be >10(-6), posing a potentially serious cancer risk to those dependant on shallow groundwater for drinking water. © 2013.

  14. Bioaccumulation and distribution of organochlorine residues across ...

    African Journals Online (AJOL)

    Eighteen organochlorine pesticide (OCP) residues were measured in the water, sediment, plankton, benthic invertebrates and fish in various sections of the Lagos Lagoon in 2014 to investigate their bioaccumulation and distribution in the food web. The analysis was done using gas chromatography with an electron capture ...

  15. Existence of Insecticides in Tap Drinking Surface and Ground Water in Dakahlyia Governorate, Egypt in 2011

    Directory of Open Access Journals (Sweden)

    RA Mandour

    2011-12-01

    Full Text Available Background: The environmental degradation products of pesticides may enter drinking water and result in serious health problems. Objective: To evaluate the occurrence of insecticides in drinking surface and ground water in Dakahlyia Governorate, northern Egypt in 2011. Methods: We studied blood samples collected from 36 consecutive patients diagnosed with pesticides poisoning and 36 tap drinking water (surface and ground. Blood and water samples were analyzed for pesticides using gas chromatography-electron captured detector (GC-ECD. In addition, blood samples were analyzed for plasma pseudo-cholinesterase level (PChE and red blood cells acetyl cholinesterase activity (AChE. Results: The results confirmed the presence of high concentrations of insecticides, including organonitrogenous and organochlorine in tap drinking surface and ground water. Conclusion: Drinking water contaminated with insecticides constitutes an important health concern in Dakahlyia governorate, Egypt.

  16. Insecticide Exposure in Parkinsonism

    National Research Council Canada - National Science Library

    Bloomquist, Jeffrey

    2002-01-01

    Behavioral, neurochemical, and immunocytochemical studies characterized the possible role of insecticide exposure in the etiology of Parkinson's disease as it may relate to Gulf War Syndrome. Chlorpyrifos (CP) and permethrin (PM...

  17. Insecticide Exposure in Parkinsonism

    National Research Council Canada - National Science Library

    Bloomquist, Jeffrey

    2001-01-01

    Behavioral, neurochemical, and immunocytochemical studies characterized the possible role of insecticide exposure in the etiology of Parkinson's disease as it may relate to Gulf War Syndrome. Chlorpyrifos (CP) and permethrin (PM...

  18. Insecticide Exposure in Parkinsonism

    National Research Council Canada - National Science Library

    Bloomquist, Jeffrey

    2003-01-01

    Behavioral, neurochemical, and immunocytochemical studies are characterizing the possible role of insecticide exposure in the etiology of Parkinson's disease as it may relate to Gulf War Syndrome. Chlorpyrifos (CP) and/or permethrin (PM...

  19. 3 Insecticide Use Practice

    African Journals Online (AJOL)

    Administrator

    500,000 metric tonnes in the 1964/1965 season. Problems ... insecticides on the open market. ... effective in the management of insect pests of cocoa. .... Effectiveness and profitability of pest ... Youth in Agriculture; Programme Policy, Strategy.

  20. Insecticides and Biological Control

    Science.gov (United States)

    Furness, G. O.

    1972-01-01

    Use of insecticides has been questioned due to their harmful effects on edible items. Biological control of insects along with other effective practices for checking spread of parasites on crops are discussed. (PS)

  1. Contemporary status of insecticide resistance in the major Aedes vectors of arboviruses infecting humans.

    Science.gov (United States)

    Moyes, Catherine L; Vontas, John; Martins, Ademir J; Ng, Lee Ching; Koou, Sin Ying; Dusfour, Isabelle; Raghavendra, Kamaraju; Pinto, João; Corbel, Vincent; David, Jean-Philippe; Weetman, David

    2017-07-01

    Both Aedes aegytpi and Ae. albopictus are major vectors of 5 important arboviruses (namely chikungunya virus, dengue virus, Rift Valley fever virus, yellow fever virus, and Zika virus), making these mosquitoes an important factor in the worldwide burden of infectious disease. Vector control using insecticides coupled with larval source reduction is critical to control the transmission of these viruses to humans but is threatened by the emergence of insecticide resistance. Here, we review the available evidence for the geographical distribution of insecticide resistance in these 2 major vectors worldwide and map the data collated for the 4 main classes of neurotoxic insecticide (carbamates, organochlorines, organophosphates, and pyrethroids). Emerging resistance to all 4 of these insecticide classes has been detected in the Americas, Africa, and Asia. Target-site mutations and increased insecticide detoxification have both been linked to resistance in Ae. aegypti and Ae. albopictus but more work is required to further elucidate metabolic mechanisms and develop robust diagnostic assays. Geographical distributions are provided for the mechanisms that have been shown to be important to date. Estimating insecticide resistance in unsampled locations is hampered by a lack of standardisation in the diagnostic tools used and by a lack of data in a number of regions for both resistance phenotypes and genotypes. The need for increased sampling using standard methods is critical to tackle the issue of emerging insecticide resistance threatening human health. Specifically, diagnostic doses and well-characterised susceptible strains are needed for the full range of insecticides used to control Ae. aegypti and Ae. albopictus to standardise measurement of the resistant phenotype, and calibrated diagnostic assays are needed for the major mechanisms of resistance.

  2. Contemporary status of insecticide resistance in the major Aedes vectors of arboviruses infecting humans

    Science.gov (United States)

    Vontas, John; Martins, Ademir J.; Ng, Lee Ching; Koou, Sin Ying; Dusfour, Isabelle; Raghavendra, Kamaraju; Pinto, João; Corbel, Vincent; David, Jean-Philippe; Weetman, David

    2017-01-01

    Both Aedes aegytpi and Ae. albopictus are major vectors of 5 important arboviruses (namely chikungunya virus, dengue virus, Rift Valley fever virus, yellow fever virus, and Zika virus), making these mosquitoes an important factor in the worldwide burden of infectious disease. Vector control using insecticides coupled with larval source reduction is critical to control the transmission of these viruses to humans but is threatened by the emergence of insecticide resistance. Here, we review the available evidence for the geographical distribution of insecticide resistance in these 2 major vectors worldwide and map the data collated for the 4 main classes of neurotoxic insecticide (carbamates, organochlorines, organophosphates, and pyrethroids). Emerging resistance to all 4 of these insecticide classes has been detected in the Americas, Africa, and Asia. Target-site mutations and increased insecticide detoxification have both been linked to resistance in Ae. aegypti and Ae. albopictus but more work is required to further elucidate metabolic mechanisms and develop robust diagnostic assays. Geographical distributions are provided for the mechanisms that have been shown to be important to date. Estimating insecticide resistance in unsampled locations is hampered by a lack of standardisation in the diagnostic tools used and by a lack of data in a number of regions for both resistance phenotypes and genotypes. The need for increased sampling using standard methods is critical to tackle the issue of emerging insecticide resistance threatening human health. Specifically, diagnostic doses and well-characterised susceptible strains are needed for the full range of insecticides used to control Ae. aegypti and Ae. albopictus to standardise measurement of the resistant phenotype, and calibrated diagnostic assays are needed for the major mechanisms of resistance. PMID:28727779

  3. Contemporary status of insecticide resistance in the major Aedes vectors of arboviruses infecting humans.

    Directory of Open Access Journals (Sweden)

    Catherine L Moyes

    2017-07-01

    Full Text Available Both Aedes aegytpi and Ae. albopictus are major vectors of 5 important arboviruses (namely chikungunya virus, dengue virus, Rift Valley fever virus, yellow fever virus, and Zika virus, making these mosquitoes an important factor in the worldwide burden of infectious disease. Vector control using insecticides coupled with larval source reduction is critical to control the transmission of these viruses to humans but is threatened by the emergence of insecticide resistance. Here, we review the available evidence for the geographical distribution of insecticide resistance in these 2 major vectors worldwide and map the data collated for the 4 main classes of neurotoxic insecticide (carbamates, organochlorines, organophosphates, and pyrethroids. Emerging resistance to all 4 of these insecticide classes has been detected in the Americas, Africa, and Asia. Target-site mutations and increased insecticide detoxification have both been linked to resistance in Ae. aegypti and Ae. albopictus but more work is required to further elucidate metabolic mechanisms and develop robust diagnostic assays. Geographical distributions are provided for the mechanisms that have been shown to be important to date. Estimating insecticide resistance in unsampled locations is hampered by a lack of standardisation in the diagnostic tools used and by a lack of data in a number of regions for both resistance phenotypes and genotypes. The need for increased sampling using standard methods is critical to tackle the issue of emerging insecticide resistance threatening human health. Specifically, diagnostic doses and well-characterised susceptible strains are needed for the full range of insecticides used to control Ae. aegypti and Ae. albopictus to standardise measurement of the resistant phenotype, and calibrated diagnostic assays are needed for the major mechanisms of resistance.

  4. Characterizing the insecticide resistance of Anopheles gambiae in Mali.

    Science.gov (United States)

    Cisse, Moussa B M; Keita, Chitan; Dicko, Abdourhamane; Dengela, Dereje; Coleman, Jane; Lucas, Bradford; Mihigo, Jules; Sadou, Aboubacar; Belemvire, Allison; George, Kristen; Fornadel, Christen; Beach, Raymond

    2015-08-22

    The impact of indoor residual spraying (IRS) and long-lasting insecticide nets (LLINs), key components of the national malaria control strategy of Mali, is threatened by vector insecticide resistance. The objective of this study was to assess the level of insecticide resistance in Anopheles gambiae sensu lato populations from Mali against four classes of insecticide recommended for IRS: organochlorines (OCs), pyrethroids (PYs), carbamates (CAs) and organophosphates (OPs). Characterization of resistance was done in 13 sites across southern Mali and assessed presence and distribution of physiological mechanisms that included target-site modifications: knockdown resistance (kdr) and altered acetycholinesterase (AChE), and/or metabolic mechanisms: elevated esterases, glutathione S-transferases (GSTs), and monooxygenases. The World Health Organization (WHO) tube test was used to determine phenotypic resistance of An. gambiae s.l. to: dichlorodiphenyltrichloroethane (DDT) (OC), deltamethrin (PY), lambda-cyhalothrin (PY), bendiocarb (CA), and fenitrothion (OP). Identification of sibling species and presence of the ace-1 (R) and Leu-Phe kdr, resistance-associated mutations, were determined using polymerase chain reaction (PCR) technology. Biochemical assays were conducted to detect increased activity of GSTs, oxidases and esterases. Populations tested showed high levels of resistance to DDT in all 13 sites, as well as increased resistance to deltamethrin and lambda-cyhalothrin in 12 out of 13 sites. Resistance to fenitrothion and bendiocarb was detected in 1 and 4 out of 13 sites, respectively. Anopheles coluzzii, An. gambiae sensu stricto and Anopheles arabiensis were identified with high allelic frequencies of kdr in all sites where each of the species were found (13, 12 and 10 sites, respectively). Relatively low allelic frequencies of ace-1 (R) were detected in four sites where this assessment was conducted. Evidence of elevated insecticide metabolism, based on oxidase

  5. Residues of Organochlorine Pesticides in Lake Mariut

    International Nuclear Information System (INIS)

    Saad, M.A.H.; Abu-Elamayem, M.M.; El-Sebae, A.B.; Sharaf, I.P.

    1981-01-01

    Lake Mariut, a brackish water lake adjoining the Mediterranean Coast of Egypt, has suffered much from intensive pollution in recent years due to the successive increase of human population and industry around it (Saad, 1980). The occurrence and distribution of organochlorine pesticides in the water of Lake Mariut during a period of one year were studied. This study represents an essential part of a pilot project on pollution of Lake Mariut supported by IAEA. The major organochlorine pesticides detected in the water of Lake Mariut were Lindane, p, p'-DDE, o,p'-DDT and p, p'-DDT. The mean concentrations of these pesticides were 2.091, 4.493, 0.009 and 0.134 ppb, respectively. The mean concentration of the calculated total DDT (Σ DDT) was 5.1 PPb

  6. Occurrence of organochlorine pesticides in indoor dust

    DEFF Research Database (Denmark)

    Bräuner, Elvira Vaclavik; Mayer, Philipp; Gunnarsen, Lars Bo

    2011-01-01

    Organochlorine pesticides are present in the environment and suspected of causing serious health effects. Diet has been the main exposure source, but indoor source release is gaining focus. Within a monitoring study of polychlorinated biphenyls of Danish buildings built during the 1960s and 1970s......, we coincidently determined extreme levels of dichlorodiphenyltrichloroethane (DDT) levels in two of ten random samples. This raises concern and further large scale investigations are warranted to confirm this....

  7. Botanical Insecticides in Plant Protection

    OpenAIRE

    Grdiša, Martina; Gršić, Kristina

    2013-01-01

    Botanical insecticides are natural compounds with insecticidal properties and their use in crop protection is as old as agricultural practice. Although they have been in use for over one hundred years, the advent of synthetic insecticides has unfortunately displaced their use today. Due to fast action, low cost, easy application and efficiency against a wide range of harmful species, synthetic insecticides have become an important part of pest management in modern agricultural systems....

  8. ORGANOCHLORINE CONTAMINANTS IN SEA TURTLES FROM THE EASTERN PACIFIC

    Science.gov (United States)

    We measured organochlorine residues in three species of sea turtles from the Baja California peninsula, Mexico. Seventeen of 21 organochlorine pesticides analyzed were detected, with heptachlor epoxide and y-hexachlorocyclohexane the most prevalent in 14 (40%) and 11 (31%) of th...

  9. Characterization of population exposure to organochlorines: A cluster analysis application

    NARCIS (Netherlands)

    R.M. Guimarães (Raphael Mendonça); S. Asmus (Sven); A. Burdorf (Alex)

    2013-01-01

    textabstractThis study aimed to show the results from a cluster analysis application in the characterization of population exposure to organochlorines through variables related to time and exposure dose. Characteristics of 354 subjects in a population exposed to organochlorine pesticides residues

  10. Distribution of 19 organochlorinated pesticides residues in ginseng ...

    African Journals Online (AJOL)

    The organochlorinated pesticides widely applied and still remains in soils, has become toxic to ginseng production in Jilin Province. In this study, 19 trace organochlorinated pesticide residues in five types of ginseng products and soil samples from four ginseng production areas were analyzed using a gas ...

  11. Reduced Insecticide Susceptibility in Aedes vexans (Diptera: Culicidae) Where Agricultural Pest Management Overlaps With Mosquito Abatement.

    Science.gov (United States)

    Dunbar, Mike W; Bachmann, Amanda; Varenhorst, Adam J

    2018-05-04

    Mosquito abatement programs in Midwestern communities frequently exist within landscapes dominated by agriculture. Although separately managed, both agricultural pests and mosquitoes are targeted by similar classes of insecticides. As a result, there is the potential for unintended insecticide exposure to mosquito populations from agricultural pest management. To determine the impact that agricultural management practices have on mosquito insecticide susceptibility we compared the mortality of Aedes vexans (Meigen; Diptera: Culicidae) between populations sampled from locations with and without mosquito abatement in South Dakota, a region dominated by agricultural production. Collection locations were either within towns with mosquito abatement programs (n = 2; Brookings and Sioux Falls, SD) or located > 16 km from towns with mosquito abatement programs (n = 2; areas near Harrold and Willow Lake, SD). WHO bioassays were used to test susceptibly of adults to differing insecticide classes relative to their respective controls; 1) an organochlorine (dieldrin 4%), 2) an organophosphate (malathion 5%), and 3) a pyrethroid (lambda-cyhalothrin 0.05%). Corrected mortality did not significantly differ between locations with or without abatement; however, when locations were analized by proportion of developed land within the surrounding landscape pyrethroid mortality was significantly lower where crop production dominated the surrounding landscape and mosquito abatement was present. These data suggest that agricultural pest management may incidentally contribute to reduced mosquito susceptibility where overlap between agricultural pest management and mosquito abatement exists. Decoupling insecticide classes used by both agricultural and public health pest management programs may be necessary to ensure continued efficacy of pest management tools.

  12. Control of Malaria Vector Mosquitoes by Insecticide-Treated Combinations of Window Screens and Eave Baffles.

    Science.gov (United States)

    Killeen, Gerry F; Masalu, John P; Chinula, Dingani; Fotakis, Emmanouil A; Kavishe, Deogratius R; Malone, David; Okumu, Fredros

    2017-05-01

    We assessed window screens and eave baffles (WSEBs), which enable mosquitoes to enter but not exit houses, as an alternative to indoor residual spraying (IRS) for malaria vector control. WSEBs treated with water, the pyrethroid lambda-cyhalothrin, or the organophosphate pirimiphos-methyl, with and without a binding agent for increasing insecticide persistence on netting, were compared with IRS in experimental huts. Compared with IRS containing the same insecticide, WSEBs killed similar proportions of Anopheles funestus mosquitoes that were resistant to pyrethroids, carbamates and organochlorines and greater proportions of pyrethroid-resistant, early exiting An. arabiensis mosquitoes. WSEBs with pirimiphos-methyl killed greater proportions of both vectors than lambda-cyhalothrin or lambda-cyhalothrin plus pirimiphos-methyl and were equally efficacious when combined with binding agent. WSEBs required far less insecticide than IRS, and binding agents might enhance durability. WSEBs might enable affordable deployment of insecticide combinations to mitigate against physiologic insecticide resistance and improve control of behaviorally resistant, early exiting vectors.

  13. Anticholinesterase insecticide retrospective.

    Science.gov (United States)

    Casida, John E; Durkin, Kathleen A

    2013-03-25

    The anticholinesterase (antiChE) organophosphorus (OP) and methylcarbamate (MC) insecticides have been used very effectively as contact and systemic plant protectants for seven decades. About 90 of these compounds are still in use - the largest number for any insecticide chemotype or mode of action. In both insects and mammals, AChE inhibition and acetylcholine accumulation leads to excitation and death. The cholinergic system of insects is located centrally (where it is protected from ionized OPs and MCs) but not at the neuromuscular junction. Structural differences between insect and mammalian AChE are also evident in their genomics, amino acid sequences and active site conformations. Species selectivity is determined in part by inhibitor and target site specificity. Pest population selection with OPs and MCs has resulted in a multitude of modified AChEs of altered inhibitor specificity some conferring insecticide resistance and others enhancing sensitivity. Much of the success of antiChE insecticides results from a suitable balance of bioactivation and detoxification by families of CYP450 oxidases, hydrolases, glutathione S-transferases and others. Known inhibitors for these enzymes block detoxification and enhance potency which is particularly important in resistant strains. The current market for OPs and MCs of 19% of worldwide insecticide sales is only half of that of 10 years ago for several reasons: there have been no major new compounds for 30 years; resistance has eroded their effectiveness; human toxicity problems are still encountered; the patents have expired reducing the incentive to update registration packages; alternative chemotypes or control methods have been developed. Despite this decline, they still play a major role in pest control and the increasing knowledge on their target sites and metabolism may make it possible to redesign the inhibitors for insensitive AChEs and to target new sites in the cholinergic system. The OPs and MCs are down

  14. The Development of an Automated Clean-up for Fat Extracts in the Routine Analysis of Organochlorine Compounds in Fish Meat

    Directory of Open Access Journals (Sweden)

    Ana Andreea CIOCA

    2017-05-01

    Full Text Available The present work describes the development of a new, automatic High Performance Liquid Chromatography (HPLC Clean-up step, in the methodology of sample preparation and multi-residue determination of organochlorine compounds (OCs in fish meat. 24 OCs were taken into study. In addition 7 Polychlorinated Biphenyls (PCBs, 7 chlorobenzene compounds and one 2,3,7,8-Tetrachlorodibenzo-p-dioxin (TCDD were investigated. The HPLC conditions were established in accordance with the validated traditional Clean-up step of the laboratory. The technique was applied on a dilution of analytes of interest in order to establish the period of time in which the compounds are eluted. Another set of experiments involved fish oil, in order to identify and separate the fat fraction from the analytes. To confirm the findings of the experiments mentioned above, extracts of fish samples obtained after Accelerated Solvent Extraction (ASE were examined. The samples were spiked with the analytes of interest before HPLC clean-up step and quantified through Gas Chromatography coupled with tandem Mass Spectrometry (GC-MS/MS. A HPLC clean-up technique lasting 38 minutes/sample was developed. The method is not suitable for OCs such as Endosulfansulfat and Endrine Ketone due to the very low recovery results.Â

  15. Levels of Organochlorine Pesticides in Blood Plasma from Residents of Malaria-Endemic Communities in Chiapas, Mexico

    Directory of Open Access Journals (Sweden)

    Luz E. Ruiz-Suárez

    2014-10-01

    Full Text Available Organochlorine (OC pesticides have been extensively used for pest control in agriculture and against malaria vectors in the region of Soconusco, Chiapas, in southern Mexico. Our study aimed to identify whether the inhabitants of four Soconusco communities at different locations (i.e., altitudes and with different history of use of OC pesticides, have been similarly exposed to residues of these pesticides. In particular, we analyzed the potential relationship between levels of OC pesticides in plasma and the age, gender, and residence of the study population (n = 60. We detected seven pesticides in total (γ-HCH, β-HCH, heptachlor, p,pʹ-DDE, p,p'-DDT, β-endosulfan, endrin aldehyde. Of these, p,pʹ-DDE and β-endosulfan were the most frequently found (in 98% and 38% of the samples, respectively. The low-altitude (<20 m above sea level; masl and mid-altitude (520 masl locations had the highest levels of p,pʹ-DDE, with geometric means of 50.6 µg/L and 44.46 µg/L, respectively. The oldest subjects (>60 years had the highest p,pʹ-DDE level (56.94 ± 57.81 µg/L of all age groups, while men had higher p,pʹ-DDE (34.00 ± 46.76 µg/L than women. Our results demonstrate that residents of the Soconusco region are exposed to p,pʹ-DDE because of high exposure to DDT in the past and current environmental exposure to this DDT-breakdown product.

  16. Exposure assessment of organochlorine pesticides, arsenic, and lead in children from the major agricultural areas in Sonora, Mexico.

    Science.gov (United States)

    Meza-Montenegro, Maria M; Valenzuela-Quintanar, Ana I; Balderas-Cortés, José J; Yañez-Estrada, Leticia; Gutiérrez-Coronado, Maria L; Cuevas-Robles, Alberto; Gandolfi, A Jay

    2013-04-01

    There is a lack of information of exposure to organochlorine pesticides (OCP) and some metals, such as lead (Pb) and arsenic (As), both of which were used as arsenicals pesticides, in children living in the major agricultural areas of Mexico. The objective of this study was to assess the exposure of children to different OCP, As, and Pb in the Yaqui and Mayo valleys of Sonora to generate population baseline levels of these toxins. A cross-sectional study was undertaken in 165 children (age 6-12 years old) from 10 communities from both valleys during 2009. Blood samples were analyzed for OCP and Pb and first morning void urine for inorganic As (InAs). All of the blood samples had detectable levels of dichlorodiphenyltrichloroethylene (p,p'-DDE) ranging from 0.25 to 10.3 μg/L. However lindane, dichlorodiphenyltrichloroethane (p,p'-DDT), aldrin, and endosulfan were detected in far less of the population (36.4, 23.6, 9.1, and 3 %, respectively). Methoxychlor and endrin were not found in any sample. The average value of Pb in this population was 3.2 μg Pb/dL (range 0.17-9.0) with 8.5 % of the samples having levels 50 μg/L were observed in 12.7 % of the samples. Our results show that is important to start a risk-reduction program to decrease exposure to these toxins in Mexican communities. In addition, the results can be used to establish the baseline levels of exposure to these toxins in this agricultural region and may be used as a reference point for regulatory agencies.

  17. Isotope tracer-aided studies on the date and significance of insecticides used for the control of rice pests under conditions of Indian agriculture. Coordinate programme on isotopic-tracer-aided studies on the origin and fate of foreign chemical residues in the agricultural environment

    International Nuclear Information System (INIS)

    Sethunathan, N.

    1976-01-01

    Radiotracer-aided studies were made of the fate of insecticides: parathion, benzenehexachloride (BHC) and endrin in rice soils under flooded conditions and the effect of a fungicide benomyl on heterotrophic nitrification. BHC, known for its stability in non-flooded soils and other aerobic environments, decomposed rapidly in microbially-active flooded soils, capable of obtaining Eh of -40 to -100 mV. Moreover the addition of rice straw (a common cultural practice) further accelerated the Eh drop due to enhanced microbial activity and, thereby, BHC degradation. Substantial loss of gamma-BHC also occurred by volatilization from the standing water of flooded soils. The fate of endrin was studied in 8 rice-flooded soils. Endrin decomposed rapidly in most soils, except in a sandy one. Endrin was converted to 6 metabolites in non-sterile samples of laterite, alluvial and pokkali soils as compared to 3 compounds in sterile samples indicating microbial participation. In sandy soils also only 3 compounds were detected and in kari soil 4. The degradation of parathion in flooded soils proceeds by nitrogroup reduction to amino-parathion and by hydrolysis of the P-O-C linkage to P-nitrophenol and diethylthiophosphoric acid. Microorganisms, Penicillium waksmani Zoleski, Pseudomonas sp. and Bacillus sp. are involved in both reactions. Organic sources inhibited the parathion hydrolysis but it is unlikely to cause any residue hazards since at the same time nitrogroup reduction is enhanced. Applications of benomyl to the simulated oxidized zone of flooded soils favoured heterotrophic nitrification due to stimulating the proliferation of heterotrophic nitrifying bacteria. This may pose an indirect environmental pollution hazard in addition to the direct toxicity of the fungicide

  18. A short history of insecticides

    Directory of Open Access Journals (Sweden)

    Oberemok Volodymyr Volodymyrovych

    2015-07-01

    Full Text Available This review contains a brief history of the use of insecticides. The peculiarities, main advantages, and disadvantages of some modern insecticides are described. The names of the discoverers of some of the most popular insecticide preparations on the world market, are listed. The tendencies to find new insecticides to control the quantity of phytophagous insects are discussed. Special attention is paid to the perspective of creating preparations based on nucleic acids, in particular DNA insecticides. The use of insect-specific, short single-stranded DNA fragments as DNA insecticides, is paving the way in the field of “intellectual” insecticides that “think” before they act. It is worth noting, though, that in the near future, the quantity of produced insecticides will increase due to the challenges associated with food production for a rapidly growing population. It is concluded, that an agreeable interaction of scientists and manufacturers of insecticides should lead to the selection of the most optimal solutions for insect pest control, which would be safe, affordable, and effective at the same time.

  19. Spatial gradients of polychlorinated biphenyls (PCBs) and organochlorine pesticides

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Spatial gradients of polychlorinated biphenyls (PCBs) and organochlorine pesticides were examined in the young-of-the-year (YOY) blueÂżsh collected in the vicinity...

  20. Bioaccumulation dynamics of polychlorinated biphenyls (PCBs) and organochlorine pesticides

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Bioaccumulation dynamics of polychlorinated biphenyls (PCBs) and organochlorine pesticides was examined in young-of-the-year bluefish from seven sub-estuaries of New...

  1. Organochlorine pesticide residues in the northern Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Shailaja, M.S.; Sarkar, A.

    periodic monitoring of the levels of the major pollutants. One on-going exercise has been to evaluate, qualitatively and quantitatively, the persistent organochlorine pesticide residues in the Northern Indian Ocean. The baseline levels of some...

  2. Distribution, regional sources and deposition fluxes of organochlorine pesticides in precipitation in Guangzhou, South China

    Science.gov (United States)

    Huang, De-Yin; Peng, Ping'an; Xu, Yi-Gang; Sun, Cui-Xiang; Deng, Hong-Mei; Deng, Yun-Yun

    2010-07-01

    We analyzed rainwater collected from multiple sites, Guangzhou, China, from March to August 2005, with the aim to characterize the distribution, regional sources and deposition fluxes of organochlorine pesticides (OCPs) in South China. Eight species of organochlorine pesticide were detected, including hexachlorocyclohexanes (HCHs), dichlorodiphenyltrichloroethanes (DDTs), and endosulfans. Volume-weighted mean monthly total concentrations varied from 3.65 ± 0.95 to 9.37 ± 2.63 ng L - 1 , and the estimated total wet deposition flux was about 11.43 ± 3.27 µg m - 2 during the monitoring period. Pesticides were mainly detected in the dissolved phase. Distribution coefficients between particulate and dissolved phases in March and April were generally higher than in other months. HCHs, p,p'-DDD and p,p'-DDT in precipitation were attributed to both the residues and present usage of insecticides in Pearl River Delta. The concentrations of p,p'-DDD + p,p'-DDT were relatively high from April to August, which were related to the usage of antifouling paints containing DDT for fishing ships in seaports of the South China Sea in summer. In contrast, endosulfans were relatively high in March, which was related to their seasonal atmospheric transport from cotton fields in eastern China by the Asian winter monsoon. The consistency of the variation of endosulfans, p,p'-DDD and p,p'-DDT concentrations with the alternation of summer and winter monsoon suggested that the Asian monsoon played an important role in the long-range transport of OCPs. In addition, the wet deposition of OCPs may influence not only Pearl River water but also the surface land distributions of pesticides in the Guangzhou area, especially for endosulfans, p,p'-DDD and p,p'-DDT.

  3. Monitoring and remediation technologies of organochlorine pesticides in drainage water

    OpenAIRE

    Ismail Ahmed; Derbalah Aly; Shaheen Sabry

    2015-01-01

    This study was carried out to monitor the presence of organochlorine in drainage water in Kafr-El-Sheikh Governorate, Egypt. Furthermore, to evaluate the efficiencies of different remediation techniques (advanced oxidation processes [AOPs] and bioremediation) for removing the most frequently detected compound (lindane) in drainage water. The results showed the presence of several organochlorine pesticides in all sampling sites. Lindane was detected with high frequency relative to other detect...

  4. Storage of organochlorine inseticides in hepatosplenic schistosomiasis

    Directory of Open Access Journals (Sweden)

    M. Wassermann

    1974-10-01

    Full Text Available This paper reports on the findings of a survey on OCI storage in people in Bahia, Brasil. In this survey 11 samples of adipose tissue were taken from people who underwent splenectomy for hepato splenic schistosomiasis. In these patients, total DDT averaged 10.66 ppm as compared to 4,83 ppm of total DDT found in presumably healthy people. The difference was statistically significant. It is considered that the increased DDT storage in patients with hepatosplenic schistosomiass may be the result of a reduced metabolzation of p,p'-DDT and reduced excretion of its metabolites. Another possíbility is the increased exposure to organochlorine nsectedes by hepatosplenc patients who frequently come from irrigation zones, where these compounds are more used in intensive cultivatíon.

  5. Organochlorine compounds: Progress and results to date

    International Nuclear Information System (INIS)

    Villeneuve, J.P.; Marchand, M.; Elder, D.; Fowler, S.W.; LaRosa, J.; Duursma, E.K.; Vas, D.; Parsi, P.

    1976-01-01

    Following preparation of reference materials 1 through 4 (1. Oyster homogenate (MA-M-1), 2. Sea Plant homogenate (SP-M-1), 3. Sediment (SD-M-1), 4. XAD-2 resin (AB-M-1)), homogeneity tests were conducted at the Monaco Laboratory by analyzing sample sizes that would yield sufficient amounts of organochlorine compounds for quantitation. In the case of the oyster sample, 10 samples weighing 10 grams each showed acceptable homogeneity for all compounds determined, i.e. a standard deviation of ≈ ± 20% from the mean value obtained. The highest standard deviation was observed for pp'DDE (23%) while the lowest standard deviation was recorded for pp'DDT (2.8%)

  6. A new threat to public health: organochlorines and food.

    Science.gov (United States)

    Hall, R H

    1992-01-01

    Ambient levels of persistent toxic chemicals, chemicals that persist for decades in the environment, have reached levels high enough to affect the health of children. The organochlorines (PCBs, DDT and the dioxin family) accumulate in human adipose tissue. Pregnant women pass the contamination to their fetuses. The developing nervous system is the most vulnerable. Neurobehavioral deficits, including short-term memory loss, are detected in children born to mothers at the high end of the distribution curve of organochlorines. Humans are not alone in their susceptibility to these subtle effects. Wildlife exposed to the same spectrum of organochlorines as humans suffer a variety of behavioral changes. Rats and Rhesus monkeys fed diets containing the organochlorines under laboratory conditions exhibit behavioral changes that persist into adulthood. For humans, food provides 80 percent of organochlorine contamination. Meat, fish, dairy and commercial fruit are the main sources. A vegetarian diet including unsprayed fruit minimizes contamination. The ultimate solution to this public health problem is elimination of the organochlorines from the environment.

  7. Multiple insecticide resistances in the disease vector Culex p. quinquefasciatus from Western Indian Ocean.

    Science.gov (United States)

    Pocquet, Nicolas; Milesi, Pascal; Makoundou, Patrick; Unal, Sandra; Zumbo, Betty; Atyame, Célestine; Darriet, Frédéric; Dehecq, Jean-Sébastien; Thiria, Julien; Bheecarry, Ambicadutt; Iyaloo, Diana P; Weill, Mylène; Chandre, Fabrice; Labbé, Pierrick

    2013-01-01

    Several mosquito-borne diseases affect the Western Indian Ocean islands. Culex pipiens quinquefasciatus is one of these vectors and transmits filariasis, Rift Valley and West Nile viruses and the Japanese encephalitis. To limit the impact of these diseases on public health, considerable vector control efforts have been implemented since the 50s, mainly through the use of neurotoxic insecticides belonging to Organochlorines (OC), Organophosphates (OP) and pyrethroids (PYR) families. However, mosquito control failures have been reported on site, and they were probably due to the selection of resistant individuals in response to insecticide exposure. In this study, we used different approaches to establish a first regional assessment of the levels and mechanisms of resistance to various insecticides. Bioassays were used to evaluate resistance to various insecticides, enzyme activity was measured to assess the presence of metabolic resistances through elevated detoxification, and molecular identification of known resistance alleles was investigated to determine the frequency of target-site mutations. These complementary approaches showed that resistance to the most used insecticides families (OC, OP and PYR) is widespread at a regional scale. However, the distribution of the different resistance genes is quite heterogeneous among the islands, some being found at high frequencies everywhere, others being frequent in some islands and absent in others. Moreover, two resistance alleles displayed clinal distributions in Mayotte and La Réunion, probably as a result of a heterogeneous selection due to local treatment practices. These widespread and diverse resistance mechanisms reduce the capacity of resistance management through classical strategies (e.g. insecticide rotation). In case of a disease outbreak, it could undermine the efforts of the vector control services, as only few compounds could be used. It thus becomes urgent to find alternatives to control populations

  8. Multiple insecticide resistances in the disease vector Culex p. quinquefasciatus from Western Indian Ocean.

    Directory of Open Access Journals (Sweden)

    Nicolas Pocquet

    Full Text Available Several mosquito-borne diseases affect the Western Indian Ocean islands. Culex pipiens quinquefasciatus is one of these vectors and transmits filariasis, Rift Valley and West Nile viruses and the Japanese encephalitis. To limit the impact of these diseases on public health, considerable vector control efforts have been implemented since the 50s, mainly through the use of neurotoxic insecticides belonging to Organochlorines (OC, Organophosphates (OP and pyrethroids (PYR families. However, mosquito control failures have been reported on site, and they were probably due to the selection of resistant individuals in response to insecticide exposure. In this study, we used different approaches to establish a first regional assessment of the levels and mechanisms of resistance to various insecticides. Bioassays were used to evaluate resistance to various insecticides, enzyme activity was measured to assess the presence of metabolic resistances through elevated detoxification, and molecular identification of known resistance alleles was investigated to determine the frequency of target-site mutations. These complementary approaches showed that resistance to the most used insecticides families (OC, OP and PYR is widespread at a regional scale. However, the distribution of the different resistance genes is quite heterogeneous among the islands, some being found at high frequencies everywhere, others being frequent in some islands and absent in others. Moreover, two resistance alleles displayed clinal distributions in Mayotte and La Réunion, probably as a result of a heterogeneous selection due to local treatment practices. These widespread and diverse resistance mechanisms reduce the capacity of resistance management through classical strategies (e.g. insecticide rotation. In case of a disease outbreak, it could undermine the efforts of the vector control services, as only few compounds could be used. It thus becomes urgent to find alternatives to

  9. Identification and validation of a gene causing cross-resistance between insecticide classes in Anopheles gambiae from Ghana.

    Science.gov (United States)

    Mitchell, Sara N; Stevenson, Bradley J; Müller, Pie; Wilding, Craig S; Egyir-Yawson, Alexander; Field, Stuart G; Hemingway, Janet; Paine, Mark J I; Ranson, Hilary; Donnelly, Martin James

    2012-04-17

    In the last decade there have been marked reductions in malaria incidence in sub-Saharan Africa. Sustaining these reductions will rely upon insecticides to control the mosquito malaria vectors. We report that in the primary African malaria vector, Anopheles gambiae sensu stricto, a single enzyme, CYP6M2, confers resistance to two classes of insecticide. This is unique evidence in a disease vector of cross-resistance associated with a single metabolic gene that simultaneously reduces the efficacy of two of the four classes of insecticide routinely used for malaria control. The gene-expression profile of a highly DDT-resistant population of A. gambiae s.s. from Ghana was characterized using a unique whole-genome microarray. A number of genes were significantly overexpressed compared with two susceptible West African colonies, including genes from metabolic families previously linked to insecticide resistance. One of the most significantly overexpressed probe groups (false-discovery rate-adjusted P P450 gene CYP6M2. This gene is associated with pyrethroid resistance in wild A. gambiae s.s. populations) and can metabolize both type I and type II pyrethroids in recombinant protein assays. Using in vitro assays we show that recombinant CYP6M2 is also capable of metabolizing the organochlorine insecticide DDT in the presence of solubilizing factor sodium cholate.

  10. Purification of waters and elimination of organochloric insecticides by means of active coal

    Directory of Open Access Journals (Sweden)

    DRAGAN MARINOVIĆ

    2010-04-01

    Full Text Available Pollution of water and the determination of the degree of its pollution with numerous physical, chemical and biological polluters have become general, ever increasing social and health related problems. Within this study, the concentrations of some most frequently used organochloric insecticides (OCI: a-hexachlorocyclohexane (a-HCH, γ-hexachlorocyclohexane (lindane, heptachlor, aldrin, dieldrin, endrin, dichlorodiphenyl trichlorethane (DDT were investigated. OCI are highly toxic substances for the human population and their effective elimination from the environment is of paramount interest. To determine the OCI concentration in water samples, the EPA–608 method and the liquid–liquid extraction principle were applied. A procedure for OCI elimination was realized by passing the water over four columns filled with various active coals: KRF, K-81/B, NORIT ROW-0.8 and AQUA SORB CS. These active coals are carbonized coconut shells activated by different procedures. The obtained results indicated that best purification of potable and waste water achieved using a column with Norit Row-0.8 filling. Research proved that small quantities of OCI can also be effectively removed using a Norit Row-0.8 active coal filled column, without altering the organoleptic properties of the water, which meets the requirements of water purification processes.

  11. Neurotoxicology of insecticides and pheromones

    National Research Council Canada - National Science Library

    Narahashi, Toshio

    1979-01-01

    The purpose of this symposium was to provide a forum where a variety of scientists who were interested in the interactions of insecticides and pheromones with the nervous system got together to exchange their views...

  12. A renaissance for botanical insecticides?

    Science.gov (United States)

    Isman, Murray B

    2015-12-01

    Botanical insecticides continue to be a subject of keen interest among the international research community, reflected in the steady growth in scientific publications devoted to the subject. Until very recently though, the translation of that theory to practice, i.e. the commercialisation and adoption of new botanical insecticides in the marketplace, has seriously lagged behind. Strict regulatory regimes, long the bane of small pesticide producers, are beginning to relax some of the data requirements for 'low-risk' pesticide products, facilitating movement of more botanicals into the commercial arena. In this paper I discuss some of the jurisdictions where botanicals are increasingly finding favour, some of the newer botanical insecticides in the plant and animal health arsenal and some of the specific sectors where botanicals are most likely to compete effectively with other types of insecticidal product. © 2015 Society of Chemical Industry.

  13. Organochlorine contaminants and reproductive success of double-crested cormorants from Green Bay, Wisconsin, USA

    Science.gov (United States)

    Custer, T.W.; Custer, Christine M.; Hines, R.K.; Gutreuter, S.; Stromborg, K.L.; Allen, P. David; Melancon, M.J.

    1999-01-01

    In 1994 and 1995, nesting success of double-crested cormorants (Phalacrocorax auritus) was measured at Cat Island, in southern Green Bay, Lake Michigan, Wisconsin, USA. Sample eggs at pipping and unhatched eggs were collected and analyzed for organochlorines (including total polychlorinated biphenyls [PCBs] and DDE), hepatic microsomal ethoxyresorufin-O-dealkylase (EROD) activity in embryos, and eggshell thickness. Of 1,570 eggs laid, 32% did not hatch and 0.4% had deformed embryos. Of 632 chicks monitored from hatching to 12 d of age, 9% were missing or found dead; no deformities were observed. The PCB concentrations in sample eggs from clutches with deformed embryos (mean = 10.2 μg/g wet weight) and dead embryos (11.4 μg/g) were not significantly higher than concentrations in sample eggs from nests where all eggs hatched (12.1 μg/g). A logistic regression of hatching success versus DDE, dieldrin, and PCB concentrations in sibling eggs identified DDE and not dieldrin or PCBs as a significant risk factor. A logistic regression of hatching success versus DDE and eggshell thickness implicated DDE and not eggshell thickness as a significant risk factor. Even though the insecticide DDT was banned in the early 1970s, we suggest that DDE concentrations in double-crested cormorant eggs in Green Bay are still having an effect on reproduction in this species.

  14. Monitoring and remediation technologies of organochlorine pesticides in drainage water

    Directory of Open Access Journals (Sweden)

    Ismail Ahmed

    2015-03-01

    Full Text Available This study was carried out to monitor the presence of organochlorine in drainage water in Kafr-El-Sheikh Governorate, Egypt. Furthermore, to evaluate the efficiencies of different remediation techniques (advanced oxidation processes [AOPs] and bioremediation for removing the most frequently detected compound (lindane in drainage water. The results showed the presence of several organochlorine pesticides in all sampling sites. Lindane was detected with high frequency relative to other detected organochlorine in drainage water. Nano photo-Fenton like reagent was the most effective treatment for lindane removal in drainage water. Bioremediation of lindane by effective microorganisms (EMs removed 100% of the lindane initial concentration. There is no remaining toxicity in lindane contaminated-water after remediation on treated rats relative to control with respect to histopathological changes in liver and kidney. Advanced oxidation processes especially with nanomaterials and bioremediation using effective microorganisms can be regarded as safe and effective remediation technologies of lindane in water.

  15. Susceptibility of Anopheles gambiae to insecticides used for malaria vector control in Rwanda.

    Science.gov (United States)

    Hakizimana, Emmanuel; Karema, Corine; Munyakanage, Dunia; Iranzi, Gad; Githure, John; Tongren, Jon Eric; Takken, Willem; Binagwaho, Agnes; Koenraadt, Constantianus J M

    2016-12-01

    -cyhalothrin, deltamethrin, permethrin) and organochlorines (DDT) and the large presence of target site insensitivity. The results demonstrate the need for Rwanda to expand monitoring for insecticide resistance including further metabolic resistance testing and implement an insecticide resistance management strategy to sustain the gains made in malaria control.

  16. Smoking as a Determinant of High Organochlorine Levels in Greenland

    DEFF Research Database (Denmark)

    Deutch, Bente; Pedersen, Henning Sloth; Bonefeld-Jørgensen, Eva Cecilie

    2003-01-01

    diet, and smoking or plasma cotinine in multiple linear-regression models (p smoking status. These findings confirm that the source of POPs among the Inuit in Greenland is diet, but smoking......The authors investigated the accumulation of organochlorines among smoking and nonsmoking Inuit hunters (n = 48) in Uummanaq, Greenland, a population with high dietary exposure to persistent organic pollutants (POPs). Human plasma organochlorine levels were positively correlated with age, marine...... is an important determinant of POP bioaccumulation. Smoking cessation may provide a means to lower the body burden of POPs....

  17. Organochlorine pesticides across the tributaries of River Ravi, Pakistan: Human health risk assessment through dermal exposure, ecological risks, source fingerprints and spatio-temporal distribution.

    Science.gov (United States)

    Baqar, Mujtaba; Sadef, Yumna; Ahmad, Sajid Rashid; Mahmood, Adeel; Li, Jun; Zhang, Gan

    2018-03-15

    This study monitored the human health risks through dermal exposure, hazardous risks to ecological integrity, contamination levels, spatio-temporal distribution, and congener specific analysis of organochlorine pesticides (OCPs) across River Ravi and its three northern tributaries (Nullah Bein, Nullah Basanter and Nullah Deg). The residual levels of OCPs isomers were screened for water (n=54) and surface sediment (n=54) samples from twenty seven sampling sites in two alternate seasons (pre-monsoon and post-monsoon). The ∑OCPs concentrations ranged from 13.61 to 1992.18ng/g dry weight and 12.89 to 128.16ng/L with predominance of β-endosulfan and p,p'-DDT in sediment and water matrixes, respectively. Distribution pattern revealed significantly higher concentrations in upstream and midstream, suggesting considerable transboundary OCPs pollution. Calculated ratios of α-HCH/γ-HCH, o,p'-DDT/p,p'-DDT, (DDE+DDD)/∑DDTs and cis/trans-chlordane for water and sediments identified the fresh addition of lindane, technical DDTs and chlordane in the study area. Risk quotient (RQ) based ecological risk was found to be >1 at all studied streams during both seasons and elucidates higher risks for endosulfan (α-endosulfan) and endrin. Human health risk assessment indicated absence of hazardous (non-carcinogenic) risk through bathing in studied streams; as the hazard index values ranged from 1.09E-05 to 2.48E-02 (acceptable limit; ecological risk and carcinogenic human health risk had emphasized an immediate elimination of ongoing OCPs addition in the studied area. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. New method based on combining ultrasonic assisted miniaturized matrix solid-phase dispersion and homogeneous liquid-liquid extraction for the determination of some organochlorinated pesticides in fish

    International Nuclear Information System (INIS)

    Rezaei, Farahnaz; Hosseini, Mohammad-Reza Milani

    2011-01-01

    Highlights: → Ultrasonic assisted miniaturized matrix solid-phase dispersion combined with HLLE was developed as a new method for the extraction of OCPs in fish. → The goal of this combination was to enhance the selectivity of HLLE procedure and to extend its application in biological samples. → This method proposed the advantages of good detection limits, lower consumption of reagents, and does not need any special instrumentation. - Abstract: In this study, ultrasonic assisted miniaturized matrix solid-phase dispersion (US-MMSPD) combined with homogeneous liquid-liquid extraction (HLLE) has been developed as a new method for the extraction of organochlorinated pesticides (OCPs) in fish prior to gas chromatography with electron capture detector (GC-ECD). In the proposed method, OCPs (heptachlor, aldrin, DDE, DDD, lindane and endrin) were first extracted from fish sample into acetonitrile by US-MMSPD procedure, and the extract was then used as consolute solvent in HLLE process. Optimal condition for US-MMSPD step was as follows: volume of acetonitrile, 1.5 mL; temperature of ultrasound, 40 deg. C; time of ultrasound, 10 min. For HLLE step, optimal results were obtained at the following conditions: volume of chloroform, 35 μL; volume of aqueous phase, 1.5 mL; volume of double distilled water, 0.5 mL; time of centrifuge, 10 min. Under the optimum conditions, the enrichment factors for the studied compounds were obtained in the range of 185-240, and the overall recoveries were ranged from 39.1% to 81.5%. The limits of detection were 0.4-1.2 ng g -1 and the relative standard deviations for 20 ng g -1 of the OCPs, varied from 3.2% to 8% (n = 4). Finally, the proposed method has been successfully applied to the analysis of the OCPs in real fish sample, and satisfactory results were obtained.

  19. New method based on combining ultrasonic assisted miniaturized matrix solid-phase dispersion and homogeneous liquid-liquid extraction for the determination of some organochlorinated pesticides in fish

    Energy Technology Data Exchange (ETDEWEB)

    Rezaei, Farahnaz [Department of Analytical Chemistry, Faculty of Chemistry, Iran University of Science and Technology, Narmak, Tehran 16846 (Iran, Islamic Republic of); Hosseini, Mohammad-Reza Milani, E-mail: drmilani@iust.ac.ir [Department of Analytical Chemistry, Faculty of Chemistry, Iran University of Science and Technology, Narmak, Tehran 16846 (Iran, Islamic Republic of); Electroanalytical Chemistry Research Center, Iran University of Science and Technology, Narmak, Tehran 16846 (Iran, Islamic Republic of)

    2011-09-30

    Highlights: {yields} Ultrasonic assisted miniaturized matrix solid-phase dispersion combined with HLLE was developed as a new method for the extraction of OCPs in fish. {yields} The goal of this combination was to enhance the selectivity of HLLE procedure and to extend its application in biological samples. {yields} This method proposed the advantages of good detection limits, lower consumption of reagents, and does not need any special instrumentation. - Abstract: In this study, ultrasonic assisted miniaturized matrix solid-phase dispersion (US-MMSPD) combined with homogeneous liquid-liquid extraction (HLLE) has been developed as a new method for the extraction of organochlorinated pesticides (OCPs) in fish prior to gas chromatography with electron capture detector (GC-ECD). In the proposed method, OCPs (heptachlor, aldrin, DDE, DDD, lindane and endrin) were first extracted from fish sample into acetonitrile by US-MMSPD procedure, and the extract was then used as consolute solvent in HLLE process. Optimal condition for US-MMSPD step was as follows: volume of acetonitrile, 1.5 mL; temperature of ultrasound, 40 deg. C; time of ultrasound, 10 min. For HLLE step, optimal results were obtained at the following conditions: volume of chloroform, 35 {mu}L; volume of aqueous phase, 1.5 mL; volume of double distilled water, 0.5 mL; time of centrifuge, 10 min. Under the optimum conditions, the enrichment factors for the studied compounds were obtained in the range of 185-240, and the overall recoveries were ranged from 39.1% to 81.5%. The limits of detection were 0.4-1.2 ng g{sup -1} and the relative standard deviations for 20 ng g{sup -1} of the OCPs, varied from 3.2% to 8% (n = 4). Finally, the proposed method has been successfully applied to the analysis of the OCPs in real fish sample, and satisfactory results were obtained.

  20. Evaluation of hydrocarbons and organochlorine pesticides and their tolerant microorganisms from an agricultural soil to define its bioremediation feasibility.

    Science.gov (United States)

    Islas-García, Alejandro; Vega-Loyo, Libia; Aguilar-López, Ricardo; Xoconostle-Cázares, Beatriz; Rodríguez-Vázquez, Refugio

    2015-01-01

    The concentrations of hydrocarbons and organochlorine pesticides (OCPs), nutrients and tolerant microorganisms in an agricultural soil from a locality in Tepeaca, Puebla, Mexico, were determined to define its feasibility for bioremediation. The OCPs detected were heptachlor, aldrin, trans-chlordane, endosulfán I, endosulfán II, 1,1,1-bis-(4-chlorophenyl)-2,2-trichloroethane (4,4'-DDT), 1,1-bis-(4-chlorophenyl)-2,2-dichloroethene (4,4'-DDE) and endrin aldehyde, with values of 0.69-30.81 ng g(-1). The concentration of hydrocarbons in the soil of Middle Hydrocarbons Fraction (MHF), C10 to C28, was 4608-27,748 mg kg(-1) and 1117-19,610 mg kg(-1) for Heavy Hydrocarbons Fraction (HHF), C28 to C35, due to an oil spill from the rupture of a pipeline. The soil was deficient in nitrogen (0.03-0.07%) and phosphorus (0 ppm), and therefore it was advisable to fertilize to bio-stimulate the native microorganisms of soil. In the soil samples, hydrocarbonoclast fungi 3.72 × 10(2) to 44.6 × 10(2) CFU g(-1) d.s. and hydrocarbonoclast bacteria (0.17 × 10(5) to 8.60 × 10(5) CFU g(-1) d.s.) were detected, with a tolerance of 30,000 mg kg(-1) of diesel. Moreover, pesticideclast fungi (5.13 × 10(2) to 42.2 × 10(2) CFU g(-1) d.s.) and pesticideclast bacteria (0.15 × 10(5) to 9.68 × 10(5) CFU g(-1) d.s.) were determined with tolerance to 20 mg kg(-1) of OCPs. Fungi and bacteria tolerant to both pollutants were also quantified. Therefore, native microorganisms had potential to be stimulated to degrade hydrocarbons and pesticides or both pollutants. The concentration of pollutants and the microbial activity analyzed indicated that bioremediation of the soil contaminated with hydrocarbons and pesticides using bio-stimulation of native microorganisms was feasible.

  1. Persistence, variance and toxic levels of organochlorine pesticides in fluvial sediments and the role of black carbon in their retention.

    Science.gov (United States)

    Parween, Musarrat; Ramanathan, Al; Khillare, P S; Raju, N J

    2014-05-01

    The present study assesses the persistence and variation of organochlorine pesticides (OCPs) and their regulation by total organic carbon (TOC) and black carbon (BC) in freshwater sediment. Sediment samples from the Yamuna River, a major tributary of the Ganges (one of the most populated and intensively used rivers in Asia), had high levels of Σ20OCPs (21.41 to 139.95 ng g(-1)). β-Hexachlorocyclohexane (β-HCH) was the most predominant component. ΣHCH and Σdichloro-diphenyl-trichloroethane (DDT) constituted ~86% of Σ20OCPs. Isomer ratios indicated fresh usage of lindane, DDT and technical-grade HCH. Toxicological comparison with freshwater sediment quality guidelines showed γ-HCH and DDT at high levels of concern. β-HCH, α-HCH, endrin, heptachlor epoxide, dichloro-diphenyl-dichloroethane (DDD), dichloro-diphenyl-dichloroethylene and chlordane were above some of the guideline levels. TOC and BC had mean concentrations of 1.37 ± 0.51% and 0.46 ± 0.23 mg g(-1), respectively. BC constituted 1.25 to 10.56% of TOC. We observed low to moderate correlations of BC with isomers of HCH, p,p'-DDT and methoxychlor while of TOC with Σ20OCPs, γ-HCH, endosulfan sulfate and methoxychlor. Principal component analysis enabled correlating and clustering of various OCPs, BC and TOC. OCP distribution was related with pH, electrical conductivity, soil moisture and finer fractions of sediment. OCPs with similarity in properties that determine their interactions with carbonaceous components of sediment clustered together. A number of factors may, thus, be involved in the regulation of interactive forces between BC and OCPs. BC in this study may be more important than TOC in the retention of some OCPs into fluvial sediments, thereby reducing their bioavailability. The finding is probably the first of its kind to report and emphasises the role of BC in the persistence of OCPs in fluvial sediments.

  2. Insecticide Resistance Reducing Effectiveness of Malaria Control

    Centers for Disease Control (CDC) Podcasts

    Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field.

  3. Organochlorine Pesticides and Degradation Products in Soil around ...

    African Journals Online (AJOL)

    The levels and compositions of organochlorine pesticides and degradation products in soil samples collected from a former formulation plant in Morogoro municipality, Tanzania, were determined. Extraction was performed by pressurized fluid extraction using n-hexane:acetone (75:25) mixture. Clean-up of extracts was ...

  4. ORGANOCHLORINE PESTICIDES IN THE AMBIENT AIR OF MEXICO

    Science.gov (United States)

    Recent and past use of organochlorine pesticides (OCPs) in Mexico has resulted in concentrations in ambient air that are 1-2 orders of magnitude above levels in the Great Lakes region. Atmospheric transport from Mexico and Central America may be contributing significant amounts ...

  5. Organochlorines in common dolphins caught in shark nets during ...

    African Journals Online (AJOL)

    The concentrations of organochlorines were determined in blubber and liver samples from common dolphins inhabiting the coastal waters of the south-east coast of southern Africa. Liver levels of PCBs and DDTs are far lower and do not appear directly associated with those in blubber. In males, blubber residue ...

  6. Partition distribution of selected organochlorine pesticides in water ...

    African Journals Online (AJOL)

    Organochlorine pesticides (OCPs) were analysed in surface water, pore water and surface sediment samples collected from the uMngeni River, which is one of the largest rivers in the province of KwaZulu-Natal, South Africa. Liquid-liquid extraction was used to extract the analytes from water and pore water samples and ...

  7. Organochlorine residues in tissues of marine fauna along the coast ...

    African Journals Online (AJOL)

    These findings highlight evidence of pollution of marine fauna at the Kenyan coastal sites. It is necessary to have thorough waste management programs as a strategy to minimize marine pollution. KEY WORDS: Environmental samples; Marine samples; Kenya-Mombasa coastline; Marine fauna, Organochlorine, Pesticides.

  8. The contribution of agricultural insecticide use to increasing insecticide resistance in African malaria vectors

    OpenAIRE

    Reid, Molly C.; McKenzie, F. Ellis

    2016-01-01

    The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malari...

  9. Organochlorine pesticide levels in female adipose tissue from Puebla, Mexico.

    Science.gov (United States)

    Waliszewski, Stefan M; Sanchez, K; Caba, M; Saldariaga-Noreña, H; Meza, E; Zepeda, R; Valencia Quintana, R; Infanzon, R

    2012-02-01

    The objective of this study was to determine the levels of organochlorine pesticides HCB, α-β-γ-HCH, pp'DDE, op'DDT and pp'DDT in adipose tissue of females living in Puebla, Mexico. Organochlorine pesticides were analyzed in 75 abdominal adipose tissue samples taken during 2010 by autopsy at the Forensic Services of Puebla. The results were expressed as mg/kg on fat basis. In analyzed samples the following pesticides were detected: p,p'-DDE in 100% of samples at mean 1.464 mg/kg; p,p'-DDT in 96.0.% of samples at mean 0.105 mg/kg; op'DDT in 89.3% of monitored samples at mean 0.025 mg/kg and β-HCH in 94.7% of the samples at mean 0.108 mg/kg. To show if organochlorine pesticide levels in monitored female's adipose tissues are age dependant, the group was divided in three ages ranges (13-26, 26-57 and 57-96 years). The mean and median levels of all organochlorine pesticides increase significantly (p 0.05). The present results compared to previous ones from 2008 indicates an increase in the concentrations during the 2010 study, but only the differences for pp'DDE and op'DDT were statistically significant. The 2010 group of females was older compared to the 2008 group. The presence of organochlorine pesticide residues is still observed, indicating uniform and permanent exposure to the pesticides by Puebla inhabitants.

  10. Pyrethrum flowers and pyrethroid insecticides.

    OpenAIRE

    Casida, J E

    1980-01-01

    The natural pyrethrins from the daisy-like flower, Tanacetum or Chrysanthemum cinerariifolium, are nonpersistent insecticides of low toxicity to mammals. Synthetic analogs or pyrethroids, evolved from the natural compounds by successive isosteric modifications, are more potent and stable and are the newest important class of crop protection chemicals. They retain many of the favorable properties of the pyrethrins.

  11. Limonene--A Natural Insecticide.

    Science.gov (United States)

    Beatty, Joseph H.

    1986-01-01

    Describes a high school chemistry student's research project in which limonene was isolated from the oil of lemons and oranges. Outlines the students' tests on the use of this chemical as an insecticide. Discusses possible extensions of the exercises based on questions generated by the students. (TW)

  12. Radioligand Recognition of Insecticide Targets.

    Science.gov (United States)

    Casida, John E

    2018-04-04

    Insecticide radioligands allow the direct recognition and analysis of the targets and mechanisms of toxic action critical to effective and safe pest control. These radioligands are either the insecticides themselves or analogs that bind at the same or coupled sites. Preferred radioligands and their targets, often in both insects and mammals, are trioxabicyclooctanes for the γ-aminobutyric acid (GABA) receptor, avermectin for the glutamate receptor, imidacloprid for the nicotinic receptor, ryanodine and chlorantraniliprole for the ryanodine receptor, and rotenone or pyridaben for NADH + ubiquinone oxidoreductase. Pyrethroids and other Na + channel modulator insecticides are generally poor radioligands due to lipophilicity and high nonspecific binding. For target site validation, the structure-activity relationships competing with the radioligand in the binding assays should be the same as that for insecticidal activity or toxicity except for rapidly detoxified or proinsecticide analogs. Once the radioligand assay is validated for relevance, it will often help define target site modifications on selection of resistant pest strains, selectivity between insects and mammals, and interaction with antidotes and other chemicals at modulator sites. Binding assays also serve for receptor isolation and photoaffinity labeling to characterize the interactions involved.

  13. Insecticide susceptibility of Aedes aegypti populations from Senegal and Cape Verde Archipelago.

    Science.gov (United States)

    Dia, Ibrahima; Diagne, Cheikh Tidiane; Ba, Yamar; Diallo, Diawo; Konate, Lassana; Diallo, Mawlouth

    2012-10-22

    Two concomitant dengue 3 (DEN-3) epidemics occurred in Cape Verde Archipelago and Senegal between September and October 2009. Aedes aegypti was identified as the vector of these epidemics as several DEN-3 virus strains were isolated from this species in both countries. The susceptibility to pyrethroids, organochlorine, organophosphates and carbamate was investigated in two field strains of Aedes aegypti from both countries using WHO diagnostic bioassay kits in order to monitor their the current status of insecticide susceptibility. The two tested strains were highly resistant to DDT. The Cape Verde strain was found to be susceptible to all others tested insecticides except for propoxur 0.1%, which needs further investigation. The Dakar strain was susceptible to fenitrothion 1% and permethrin 0.75%, but displayed reduced susceptibility to deltamethrin, lambda-cyhalothrin and propoxur. As base-line results, our observations stress a careful management of insecticide use for the control of Ae. aegypti. Indeed, they indicate that DDT is no longer efficient for the control of Ae. aegypti populations in Cape Verde and Dakar and further suggest a thorough follow-up of propoxur susceptibility status in both sites and that of deltamethrin and lambda-cyhalothrin in Ae. aegypti populations in Dakar. Thus, regular monitoring of susceptibility is greatly needed as well as the knowing if this observed resistance/susceptibility is focal or not and for observed resistance, the use of biochemical methods is needed with detailed comparison of resistance levels over a large geographic area. Aedes aegypti, Insecticides, Susceptibility, Cape Verde, Senegal.

  14. The contribution of agricultural insecticide use to increasing insecticide resistance in African malaria vectors.

    Science.gov (United States)

    Reid, Molly C; McKenzie, F Ellis

    2016-02-19

    The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malaria vectors were identified. In 23 of the 25 relevant recent publications from across Africa, higher resistance in mosquito populations was associated with agricultural insecticide use. This association appears to be affected by crop type, farm pest management strategy and urban development.

  15. Organochlorine pesticides residues in bottled drinking water from Mexico City.

    Science.gov (United States)

    Díaz, Gilberto; Ortiz, Rutilio; Schettino, Beatriz; Vega, Salvador; Gutiérrez, Rey

    2009-06-01

    This work describes concentrations of organochlorine pesticides in bottled drinking water (BDW) in Mexico City. The results of 36 samples (1.5 and 19 L presentations, 18 samples, respectively) showed the presence of seven pesticides (HCH isomers, heptachlor, aldrin, and p,p'-DDE) in bottled water compared with the drinking water standards set by NOM-127-SSA1-1994, EPA, and World Health Organization. The concentrations of the majority of organochlorine pesticides were within drinking water standards (0.01 ng/mL) except for beta-HCH of BW 3, 5, and 6 samples with values of 0.121, 0.136, and 0.192 ng/mL, respectively. It is important monitoring drinking bottled water for protecting human health.

  16. Accumulation of current-use and organochlorine pesticides in crab embryos from northern California, USA.

    Science.gov (United States)

    Smalling, Kelly L; Morgan, Steven; Kuivila, Kathryn K

    2010-11-01

    Invertebrates have long been used as resident sentinels for assessing ecosystem health and productivity. The shore crabs, Hemigrapsus oregonensis and Pachygrapsus crassipes, are abundant in estuaries and beaches throughout northern California, USA and have been used as indicators of habitat conditions in several salt marshes. The overall objectives of the present study were to conduct a lab-based study to test the accumulation of current-use pesticides, validate the analytical method and to analyze field-collected crabs for a suite of 74 current-use and legacy pesticides. A simple laboratory uptake study was designed to determine if embryos could bioconcentrate the herbicide molinate over a 7-d period. At the end of the experiment, embryos were removed from the crabs and analyzed by gas chromatography/mass spectrometry. Although relatively hydrophilic (log K(OW) of 2.9), molinate did accumulate with an estimated bioconcentration factor (log BCF) of approximately 2.5. Following method validation, embryos were collected from two different Northern California salt marshes and analyzed. In field-collected embryos 18 current-use and eight organochlorine pesticides were detected including synthetic pyrethroids and organophosphate insecticides, as well as DDT and its degradates. Lipid-normalized concentrations of the pesticides detected in the field-collected crab embryos ranged from 0.1 to 4 ppm. Pesticide concentrations and profiles in crab embryos were site specific and could be correlated to differences in land-use practices. These preliminary results indicate that embryos are an effective sink for organic contaminants in the environment and have the potential to be good indicators of ecosystem health, especially when contaminant body burden analyses are paired with reproductive impairment assays. © 2010 SETAC.

  17. Contamination of persistent organochlorines in sediments from Mekong River Delta, South Vietnam

    Energy Technology Data Exchange (ETDEWEB)

    Hung, Minh Nguyen; Kajiwara, Natsuko; Kunisue, Tatsuya; Subramanian, A.; Iwata, Hisato; Tanabe, Shinsuke [Ehime Univ., Matsuyama (Japan). Center for Marine Environmental Studies; Hung, Viet Pham [Hanoi National Univ., Hanoi (Viet Nam); Cach, Tuyen Bui [Univ. for Agriculture and Forestry, Hochiminh (Viet Nam)

    2004-09-15

    Mekong River is the longest river in southeastern Asia, which flows a distance of almost 4800 km from China through Myanmar, Thailand, Laos, Cambodia and Vietnam. The Mekong River basin with an area of nearly 800 thousand square kilometers is an important habitat for approximately 60 million people. Mekong River delta in South Vietnam, which is inhabited by about 20 million people, is one of the most highly productive agriculture lands in the world. Rice production is major economical sector in Mekong delta contributing half of the rice production in Vietnam - approximately 35 million tons annually. On the other hand, development of agriculture in Mekong delta raised some concern on environmental quality and disturbance on ecosystem. For example, intensive use of organochlorine (OC) insecticides such as DDTs, chlordanes, HCHs may lead to considerable residues in the agriculture land. Moreover, relative persistence of such chemicals together with natural processes like evaporation and run-off, might enhance their ubiquitous distribution in environment, food chains and eventually bio-accumulate in humans. In Vietnam, despite official ban on the usage of OCs on 1995, there have been evidences of recent uses of such chemicals, particularly DDT, throughout the country. It can be anticipated that similar situation may occur in Mekong River delta due to high population density and intensive agriculture activities in this region. Despite this fact, no comprehensive study, to evaluate the status of contamination by persistent OCs in this region, has been made in recent years. In this study, we collected sediments from different locations along Mekong River and determined the concentrations of persistent OCs such as DDTs, HCHs, CHLs, HCB and PCBs in order to elucidate the recent contamination status, their usage pattern as well as to evaluate potential pollution sources of these chemicals to the river.

  18. Dietary biomagnification of organochlorine contaminants in Alaskan polar bears

    Science.gov (United States)

    Bentzen, T.W.; Follmann, Erich H.; Amstrup, Steven C.; York, G.S.; Wooller, M.J.; Muir, D.C.G.; O'Hara, T. M.

    2008-01-01

    Concentrations of organochlorine contaminants in the adipose tissue of polar bears (Ursus maritimus Phipps, 1774) vary throughout the Arctic. The range in concentrations has not been explained fully by bear age, sex, condition, location, or reproductive status. Dietary pathways expose polar bears to a variety of contaminant profiles and concentrations. Prey range from lower trophic level bowhead whales (Balaena mysticetus L., 1758), one of the least contaminated marine mammals, to highly contaminated upper trophic level ringed seals (Phoca hispida (Schreber, 1775)). We used ??15N and ??13C signatures to estimate the trophic status of 42 polar bears sampled along Alaska's Beaufort Sea coast to determine the relationship between organochlorine concentration and trophic level. The ?? 15N values in the cellular portions of blood ranged from 18.2% to 20.7%. We found strong positive relationships between concentrations of the most recalcitrant polychlorinated biphenyls (PCBs) and ??15N values in models incorporating age, lipid content, and ??13C value. Specifically these models accounted for 67% and 76% of the variation in PCB153 and oxychlordane concentration in male polar bears and 85% and 93% in females, respectively. These results are strong indicators of variation in diet and biomagnification of organochlorines among polar bears related to their sex, age, and trophic position. ?? 2008 NRC.

  19. Microemulsion-enhanced remediation of soils contaminated with organochlorine pesticides.

    Science.gov (United States)

    Zhang, Yanlin; Wong, Jonathan W C; Zhao, Zhenyong; Selvam, Ammaiyappan

    2011-12-01

    Soil contaminated by organic pollutants, especially chlorinated aromatic compounds such as DDT (1,1,1-trichloro-2,2-bis(4-chlorophenyl)ethane), is an environmental concern because of the strong sorption of organochlorine pesticide onto the soil matrix and persistence in the environment. The remediation of organochlorine pesticide contaminated soils through microemulsion is an innovative technology to expedite this process. The remediation efficiency was evaluated by batch experiments through studying the desorption of DDT and hexachlorocyclohexane (y-HCH) and sorption of microemulsion composed of Triton X-100, 1-pentanol and linseed oil in the soil-surfactant-water suspension system. The reduction of desorption efficiency caused by the sorption loss of microemulsion components onto the soil could be corrected by the appropriate adjustment of C/S (Cosurfactant/Surfactant) and O/S (Oil/Surfactant) ratio. The C/S and O/S ratios of 1:2 and 3:20 were suitable to desorb DDT and gamma-HCH from the studied soils because of the lower sorption of Triton X-100 onto the soil. Inorganic salts added in microemulsion increased the pesticides desorption efficiency of pesticides and calcium chloride has a stronger ability to enhance the desorption of DDT than sodium chloride. From the remediation perspective, the balance of surfactant or cosurfactant sorbed to soil and desorption efficiency should be taken into consideration to enhance the remediation of soils contaminated by organochlorine pesticides.

  20. Skin diseases associated with Agent Orange and other organochlorine exposures.

    Science.gov (United States)

    Patterson, Andrew T; Kaffenberger, Benjamin H; Keller, Richard A; Elston, Dirk M

    2016-01-01

    Organochlorine exposure is an important cause of cutaneous and systemic toxicity. Exposure has been associated with industrial accidents, intentional poisoning, and the use of defoliants, such as Agent Orange in the Vietnam War. Although long-term health effects are systematically reviewed by the Institute of Medicine, skin diseases are not comprehensively assessed. This represents an important practice gap as patients can present with cutaneous findings. This article provides a systematic review of the cutaneous manifestations of known mass organochlorine exposures in military and industrial settings with the goal of providing clinically useful recommendations for dermatologists seeing patients inquiring about organochlorine effects. Patients with a new diagnosis of chloracne, porphyria cutanea tarda, cutaneous lymphomas (non-Hodgkin lymphoma), and soft-tissue sarcomas including dermatofibrosarcoma protuberans and leiomyosarcomas should be screened for a history of Vietnam service or industrial exposure. Inconclusive evidence exists for an increased risk of other skin diseases in Vietnam veterans exposed to Agent Orange including benign fatty tumors, melanomas, nonmelanoma skin cancers, milia, eczema, dyschromias, disturbance of skin sensation, and rashes not otherwise specified. Affected veterans should be informed of the uncertain data in those cases. Referral to Department of Veterans Affairs for disability assessment is indicated for conditions with established associations. Copyright © 2015 American Academy of Dermatology, Inc. All rights reserved.

  1. Is Bone Mineral Composition Disrupted by Organochlorines in East Greenland Polar Bears (Ursus maritimus)?

    DEFF Research Database (Denmark)

    Sonne, C.; Dietz, R.; Born, E. W.

    2004-01-01

    We analyzed bone mineral density (BMD) in skulls of polar bears (Ursus maritimus) (n = 139) from East Greenland sampled during 1892-2002. Our primary goal was to detect possible changes in bone mineral content (osteopenia) due to elevated exposure to organochlorine [polychlorinated biphenyls (PCBs.......04) and SigmaCHL (p polar...... bears may have been caused by organochlorine exposure. Udgivelsesdato: 2004-Dec...

  2. Concentration of organochlorines in human brain, liver, and adipose tissue autopsy samples from Greenland

    DEFF Research Database (Denmark)

    Dewailly, Éric; Mulvad, Gert; Pedersen, Henning S.

    1999-01-01

    Organochlorines are persistent lipophilic compounds that accumulate in Inuit people living in circumpolar countries. Organochlorines accumulate as a result of the Inuits' large consumption of sea mammal fat; however, available data are limited to blood lipids, milk fat, and adipose tissue. We rep...

  3. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Detailed Conceptual Diagram

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  4. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Simple Conceptual Diagram

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  5. 2 Assessmen of the Efficiency of Insecticide

    African Journals Online (AJOL)

    Administrator

    malaria vectors and nuisance in West Africa – a-part. 2. Field evaluation. Malar J. 9: 341. Mosqueira B., Duchon S., Chandre F., Hougard, J. M., Carnevale P. and Mas-Coma S. (2010). Efficacy of an insecticide paint against insecticide- susceptible and resistant mosquitoes – b- Part 1: Laboratory evaluation. Malar J. 9: 340.

  6. Trifluoromethylphenyl amides as novel insecticides and fungicides

    Science.gov (United States)

    Because of increased resistance to insecticides in arthropods, it is necessary to identify new chemicals that may have novel modes of action. Following an extensive literature search for compounds with insecticidal and mosquito repellent activity, we have designed and synthesized a set of 20 trifluo...

  7. Insecticide Resistance Reducing Effectiveness of Malaria Control

    Centers for Disease Control (CDC) Podcasts

    2007-01-24

    Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field.  Created: 1/24/2007 by Emerging Infectious Diseases.   Date Released: 3/13/2007.

  8. Diagnostic doses and times for Phlebotomus papatasi and Lutzomyia longipalpis sand flies (Diptera: Psychodidae: Phlebotominae) using the CDC bottle bioassay to assess insecticide resistance.

    Science.gov (United States)

    Denlinger, David S; Creswell, Joseph A; Anderson, J Laine; Reese, Conor K; Bernhardt, Scott A

    2016-04-15

    Insecticide resistance to synthetic chemical insecticides is a worldwide concern in phlebotomine sand flies (Diptera: Psychodidae), the vectors of Leishmania spp. parasites. The CDC bottle bioassay assesses resistance by testing populations against verified diagnostic doses and diagnostic times for an insecticide, but the assay has been used limitedly with sand flies. The objective of this study was to determine diagnostic doses and diagnostic times for laboratory Lutzomyia longipalpis (Lutz & Nieva) and Phlebotomus papatasi (Scopoli) to ten insecticides, including pyrethroids, organophosphates, carbamates, and DDT, that are used worldwide to control vectors. Bioassays were conducted in 1,000-ml glass bottles each containing 10-25 sand flies from laboratory colonies of L. longipalpis or P. papatasi. Four pyrethroids, three organophosphates, two carbamates and one organochlorine, were evaluated. A series of concentrations were tested for each insecticide, and four replicates were conducted for each concentration. Diagnostic doses were determined only during the exposure bioassay for the organophosphates and carbamates. For the pyrethroids and DDT, diagnostic doses were determined for both the exposure bioassay and after a 24-hour recovery period. Both species are highly susceptible to the carbamates as their diagnostic doses are under 7.0 μg/ml. Both species are also highly susceptible to DDT during the exposure assay as their diagnostic doses are 7.5 μg/ml, yet their diagnostic doses for the 24-h recovery period are 650.0 μg/ml for Lu. longipalpis and 470.0 μg/ml for P. papatasi. Diagnostic doses and diagnostic times can now be incorporated into vector management programs that use the CDC bottle bioassay to assess insecticide resistance in field populations of Lu. longipalpis and P. papatasi. These findings provide initial starting points for determining diagnostic doses and diagnostic times for other sand fly vector species and wild populations using the CDC

  9. of Several Organophosphorus Insecticide Metabolites

    Directory of Open Access Journals (Sweden)

    Russell L. Carr

    2015-01-01

    Full Text Available Paraoxonase (PON1 is a calcium dependent enzyme that is capable of hydrolyzing organophosphate anticholinesterases. PON1 activity is present in most mammals and previous research established that PON1 activity differs depending on the species. These studies mainly used the organophosphate substrate paraoxon, the active metabolite of the insecticide parathion. Using serum PON1 from different mammalian species, we compared the hydrolysis of paraoxon with the hydrolysis of the active metabolites (oxons of two additional organophosphorus insecticides, methyl parathion and chlorpyrifos. Paraoxon hydrolysis was greater than that of methyl paraoxon, but the level of activity between species displayed a similar pattern. Regardless of the species tested, the hydrolysis of chlorpyrifos-oxon was significantly greater than that of paraoxon or methyl paraoxon. These data indicate that chlorpyrifos-oxon is a better substrate for PON1 regardless of the species. The pattern of species differences in PON1 activity varied with the change in substrate to chlorpyrifos-oxon from paraoxon or methyl paraoxon. For example, the sex difference observed here and reported elsewhere in the literature for rat PON1 hydrolysis of paraoxon was not present when chlorpyrifos-oxon was the substrate.

  10. Insecticide resistance and intracellular proteases.

    Science.gov (United States)

    Wilkins, Richard M

    2017-12-01

    Pesticide resistance is an example of evolution in action with mechanisms of resistance arising from mutations or increased expression of intrinsic genes. Intracellular proteases have a key role in maintaining healthy cells and in responding to stressors such as pesticides. Insecticide-resistant insects have constitutively elevated intracellular protease activity compared to corresponding susceptible strains. This increase was shown for some cases originally through biochemical enzyme studies and subsequently putatively by transcriptomics and proteomics methods. Upregulation and expression of proteases have been characterised in resistant strains of some insect species, including mosquitoes. This increase in proteolysis results in more degradation products (amino acids) of intracellular proteins. These may be utilised in the resistant strain to better protect the cell from stress. There are changes in insect intracellular proteases shortly after insecticide exposure, suggesting a role in stress response. The use of protease and proteasome inhibitors or peptide mimetics as synergists with improved application techniques and through protease gene knockdown using RNA interference (possibly expressed in crop plants) may be potential pest management strategies, in situations where elevated intracellular proteases are relevant. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  11. Insecticide control of vector-borne diseases: when is insecticide resistance a problem?

    Directory of Open Access Journals (Sweden)

    Ana Rivero

    Full Text Available Many of the most dangerous human diseases are transmitted by insect vectors. After decades of repeated insecticide use, all of these vector species have demonstrated the capacity to evolve resistance to insecticides. Insecticide resistance is generally considered to undermine control of vector-transmitted diseases because it increases the number of vectors that survive the insecticide treatment. Disease control failure, however, need not follow from vector control failure. Here, we review evidence that insecticide resistance may have an impact on the quality of vectors and, specifically, on three key determinants of parasite transmission: vector longevity, competence, and behaviour. We argue that, in some instances, insecticide resistance is likely to result in a decrease in vector longevity, a decrease in infectiousness, or in a change in behaviour, all of which will reduce the vectorial capacity of the insect. If this effect is sufficiently large, the impact of insecticide resistance on disease management may not be as detrimental as previously thought. In other instances, however, insecticide resistance may have the opposite effect, increasing the insect's vectorial capacity, which may lead to a dramatic increase in the transmission of the disease and even to a higher prevalence than in the absence of insecticides. Either way-and there may be no simple generality-the consequence of the evolution of insecticide resistance for disease ecology deserves additional attention.

  12. Partitioning of organochlorine pesticides from water to polyethylene passive samplers

    International Nuclear Information System (INIS)

    Hale, Sarah E.; Martin, Timothy J.; Goss, Kai-Uwe; Arp, Hans Peter H.; Werner, David

    2010-01-01

    The mass transfer rates and equilibrium partitioning behaviour of 14 diverse organochlorine pesticides (OCP) between water and polyethylene (PE) passive samplers, cut from custom made PE sheets and commercial polyethylene plastic bags, were quantified. Overall mass transfer coefficients, k O , estimated PE membrane diffusion coefficients, D PE , and PE-water partitioning coefficients, K PE-water, are reported. In addition, the partitioning of three polycyclic aromatic hydrocarbons (PAHs) from water to PE is quantified and compared with literature values. K PE-water values agreed mostly within a factor of two for both passive samplers and also with literature values for the reference PAHs. As PE is expected to exhibit similar sorption behaviour to long-chain alkanes, PE-water partitioning coefficients were compared to hexadecane-water partitioning coefficients estimated with the SPARC online calculator, COSMOtherm and a polyparameter linear free energy relationship based on the Abraham approach. The best correlation for all compounds tested was with COSMOtherm estimated hexadecane-water partitioning coefficients. - The partitioning of organochlorine pesticides between single phase polyethylene passive samplers and water is quantified.

  13. Organochlorine pesticides in the ambient air of Chiapas, Mexico

    International Nuclear Information System (INIS)

    Alegria, Henry; Bidleman, Terry F.; Figueroa, Miguel Salvador

    2006-01-01

    Organochlorine (OC) pesticides were measured in the ambient air of Chiapas, Mexico during 2000-2001. Concentrations of some OC pesticides (DDTs, chlordanes, toxaphene) were elevated compared with levels in the Great Lakes region, while those of other pesticides were not (hexachlorocyclohexanes, dieldrin). While this suggests southern Mexico as a source region for the former group of chemicals, comparably high levels have also been reported in parts of the southern United States, where their suspected sources are soil emissions (DDTs, toxaphene) and termiticide usage (chlordane). Ratios of p,p'-DDT/p,p'-DDE and trans-chlordane/cis-chlordane/trans-nonachlor (TC/CC/TN) in Chiapas suggest a mixture of fresh and weathered sources, while congener profiles of toxaphene suggest emission of old residues from soils. This is supported by air parcel back trajectory analysis, which indicated that air masses over Chiapas at the time of sampling had previously passed over areas of continuing or recent use of some OC pesticides as well as areas of past use. - Elevated levels of several organochlorine pesticides were found in the ambient air of southern Mexico

  14. Weevil x Insecticide: Does 'Personality' Matter?

    Science.gov (United States)

    Morales, Juliana A; Cardoso, Danúbia G; Della Lucia, Terezinha Maria C; Guedes, Raul Narciso C

    2013-01-01

    An insect's behavior is the expression of its integrated physiology in response to external and internal stimuli, turning insect behavior into a potential determinant of insecticide exposure. Behavioral traits may therefore influence insecticide efficacy against insects, compromising the validity of standard bioassays of insecticide activity, which are fundamentally based on lethality alone. By extension, insect 'personality' (i.e., an individual's integrated set of behavioral tendencies that is inferred from multiple empirical measures) may also be an important determinant of insecticide exposure and activity. This has yet to be considered because the behavioral studies involving insects and insecticides focus on populations rather than on individuals. Even among studies of animal 'personality', the relative contributions of individual and population variation are usually neglected. Here, we assessed behavioral traits (within the categories: activity, boldness/shyness, and exploration/avoidance) of individuals from 15 populations of the maize weevil (Sitophilus zeamais), an important stored-grain pest with serious problems of insecticide resistance, and correlated the behavioral responses with the activity of the insecticide deltamethrin. This analysis was performed at both the population and individual levels. There was significant variation in weevil 'personality' among individuals and populations, but variation among individuals within populations accounted for most of the observed variation (92.57%). This result emphasizes the importance of individual variation in behavioral and 'personality' studies. When the behavioral traits assessed were correlated with median lethal time (LT50) at the population level and with the survival time under insecticide exposure, activity traits, particularly the distance walked, significantly increased survival time. Therefore, behavioral traits are important components of insecticide efficacy, and individual variation should be

  15. Estimation of dietary intake of PCB and organochlorine pesticides for children and adults

    DEFF Research Database (Denmark)

    Fromberg, Arvid; Granby, Kit; Højgård, A.

    2011-01-01

    Levels of organochlorine substances, including a number of organochlorine pesticides and PCB, are monitored in food, including meat, fish and dairy products. The substances are slowly degradable and therefore persist for long periods in the environment, where they accumulate in the fatty tissues...... pesticides and 0.9 μg/day for the indicator PCB-sum. People with a relatively high intake of these substances (the 95th percentile) are estimated to consume approximately twice as much. In general, the highest contributions to the intake of the organochlorine environmental contaminants are from fish, meat...

  16. Fungal degradation of organophosphorous insecticides

    Energy Technology Data Exchange (ETDEWEB)

    Bumpus, J.A. [Notre Dame Univ., IN (United States); Kakar, S.N.; Coleman, R.D. [Argonne National Lab., IL (United States)

    1992-07-01

    Organophosphorous insecticides are used extensively to treat a variety of pests and insects. Although as a group they are easily degraded by bacteria in the environment, a number of them have half-lives of several months. Little is known about their biodegradation by fungi. We have shown that Phanerochaete chrysosporium can substantially degrade chlorpyrifos, fonofos, and terbufos (27.5%, 12.2%, and 26.6%, respectively) during 18-day incubation in nitrogen-limited stationary cultures. The results demonstrate that the clorinated pyridinyl ring of chlorpyrifos and the phenyl ring of fonofos undergo ring cleavage during biodegradation by the fungus. The usefulness of the fungus system for bioremediation is discussed. 16 refs., 7 figs., 2 tabs.

  17. Fungal degradation of organophosphorous insecticides

    Energy Technology Data Exchange (ETDEWEB)

    Bumpus, J.A. (Notre Dame Univ., IN (United States)); Kakar, S.N.; Coleman, R.D. (Argonne National Lab., IL (United States))

    1992-01-01

    Organophosphorous insecticides are used extensively to treat a variety of pests and insects. Although as a group they are easily degraded by bacteria in the environment, a number of them have half-lives of several months. Little is known about their biodegradation by fungi. We have shown that Phanerochaete chrysosporium can substantially degrade chlorpyrifos, fonofos, and terbufos (27.5%, 12.2%, and 26.6%, respectively) during 18-day incubation in nitrogen-limited stationary cultures. The results demonstrate that the clorinated pyridinyl ring of chlorpyrifos and the phenyl ring of fonofos undergo ring cleavage during biodegradation by the fungus. The usefulness of the fungus system for bioremediation is discussed. 16 refs., 7 figs., 2 tabs.

  18. Decrease of insecticide resistance over generations without exposure to insecticides in Nilaparvata lugens (Hemipteran: Delphacidae).

    Science.gov (United States)

    Yang, Yajun; Dong, Biqin; Xu, Hongxing; Zheng, Xusong; Tian, Junce; Heong, Kongleun; Lu, Zhongxian

    2014-08-01

    The brown planthopper, Nilaparvata lugens (Stål), is one of the most important insect pests on paddy rice in tropical and temperate Asia. Overuse and misuse of insecticides have resulted in the development of high resistance to many different insecticides in this pest. Studies were conducted to evaluate the change of resistance level to four insecticides over 15 generations without any exposure to insecticides in brown planthopper. After 15 generations' rearing without exposure to insecticide, brown planthopper could reverse the resistance to imidacloprid, chlorpyrifos, fipronil, and fenobucarb. The range and style of resistance reversal of brown planthopper differed when treated with four different insecticides. To monitor potential changes in insect physiological responses, we measured the activity of each of the three selected enzymes, including acetylcholinesterases (AChE), general esterases (EST), and glutathione S-transferases. After multiple generations' rearing without exposure to insecticide, AChE and EST activities of brown planthopper declined with the increased generations, suggesting that the brown planthopper population adjusted activities of EST and AChE to adapt to the non-insecticide environment. These findings suggest that the reducing, temporary stop, or rotation of insecticide application could be incorporated into the brown planthopper management.

  19. Transformation of the insecticide teflubenzuron by microorganisms

    NARCIS (Netherlands)

    Finkelstein, Z.I.; Baskunov, B.P.; Rietjens, I.M.C.M.; Boersma, M.G.; Vervoort, J.; Golovleva, L.A.

    2001-01-01

    Transformation of teflubenzuron, the active component in the insecticide commercialized as Nomolt, by soil microorganisms was studied. It was shown that microorganisms, belonging to Bacillus, Alcaligenes, Pseudomonas and Acinetobacter genera are capable to perform the hydrolytic cleavage of the

  20. Organochlorine contaminant and retinoid levels in blubber of common dolphins (Delphinus delphis) off northwestern Spain

    International Nuclear Information System (INIS)

    Tornero, Victoria; Borrell, Assumpcio; Aguilar, Alex; Forcada, Jaume; Lockyer, Christina

    2006-01-01

    The effect of age, sex, nutritive condition and organochlorine concentration on blubber retinoid concentrations was examined in 74 common dolphins incidentally caught off northwestern Spain. Age and blubber lipid content were strong determinants of the retinoid concentrations in males, while these variables did not account for the variation found in females. Retinoids were positively correlated with organochlorines in males and negatively in females. However, pollution levels were moderate and likely to be below threshold levels above that a toxicological response is to be expected. Thus, a cause-effect relationship between organochlorine and retinoid concentrations could not be properly established, and the observed correlation may be the result of an independent association of the two variables with age. Further research on the influence of the best predictor variables on retinoid dynamics is required to implement the use of retinoids as biomarkers of pollutant exposure in cetaceans. - Organochlorine contaminants and retinoids in common dolphins

  1. Organochlorine residues in some dolphin specimens stranded on Southern Adriatic Coasts (Italy)

    International Nuclear Information System (INIS)

    Storelli, M.M.; Giacominelli Stuffler, R.; Ceci, E.; Marcotrigiano, G.O.

    1999-01-01

    This paper reports the concentration of PCBs and organochlorine compounds and percentage composition of the different PCB congeners in various tissues from four different species of cetaceans stranded on the Adriatic coast of Italy in July-September 1995

  2. Organochlorine compounds and ultrasound measurements of fetal growth in the INMA cohort (Spain)

    NARCIS (Netherlands)

    M.-J. Lopez-Espinosa (Maria-Jose); M. Murcia (Mario); A. Iñiguez (Andrés); E. Vizcaino (Esther); O. Costa (Olga); A. Fernández-Somoano (Ana); M. Basterrechea (Mikel); A. Lertxundi (Aitana); M. Guxens Junyent (Mònica); M. Gascon (Mireia); F. Goñi-Irigoyen (Fernando); J.O. Grimalt (Joan O.); A. Tardón (Adonina); F. Ballester (Ferran)

    2016-01-01

    textabstractBackground: Several studies have reported decreases in birth size associated with exposure to organochlorine compounds (OCs), but uncertainties remain regarding the critical windows of prenatal exposure and the effects on fetal body segments. Objective: We examined the relationship

  3. Factors Influencing the Spatial Distribution of Organochlorine Pesticides in Soils surrounding Chemical Industrial Parks

    NARCIS (Netherlands)

    Wang, G.; Lu, Y.L.; Wang, T.Y.; Zhang, X.; Han, J.Y.; Luo, W.; Shi, Y.J.; Li, J.; Jiao, W.T.

    2009-01-01

    Topsoil samples (n = 105) were collected to Study the distribution of dichlorodiphenyltrichloroethane (DDT) and hexachlorocyclohexane (HCH) residues in the vicinity of chemical industrial parks in Tianjin, China. The occurrence and distribution of target organochlorine pesticides (OCPs) were mapped

  4. Investigation about the presence of organochlorine pollutants in mussels from the Black Sea, Bulgaria

    Directory of Open Access Journals (Sweden)

    Georgieva Stanislava

    2016-06-01

    Full Text Available The aim of this study was to investigate the presence of polychlorinated biphenyls (PCBs, organochlorine pesticides (HCB, DDT and its metabolites and HCBD in mussels from Bulgarian Black Sea coast. Mussels (Mytilus galloprovincialis are aquatic organisms which are immobile so that the concentration of pollutants should primarily be considered as an indication of local levels of organochlorine compounds. Samples were collected from three areas of Black Sea coast of Bulgaria in summer 2015.

  5. Pollution by organochlorine pesticides in Navachiste-Macapule, Sinaloa, Mexico.

    Science.gov (United States)

    Montes, Adriana M; González-Farias, Fernando A; Botello, Alfonso V

    2012-03-01

    The lagoon system of Navachiste-Macapule is located in northern Mexico, in the state of Sinaloa, with an area of 24,000 ha. The main economic activity in the area is agriculture, and the lagoon lies next to the irrigation district ID-063 which covers 116,615 ha. The purpose of this study is to evaluate the levels of pollution generated by organochlorine pesticides (OC) in the surface sediments of the lagoon and in the agricultural drains of the ID-063 that are supposedly transported into the system as a result of agricultural activities and runoff from adjacent land. For this, between 2006 and 2007, 45 surface sediment samples were collected (warm dry, rainy and cold dry) from 15 sampling sites, during the three climatic seasons. Of these, eight were located inside the lagoon in marine conditions (salinity >31 PSU) and seven in the agricultural drains of the ID-063 in freshwater conditions (salinity Mexico.

  6. Organochlorine pesticide levels in breast milk in Guerrero, Mexico.

    Science.gov (United States)

    Chávez-Almazán, Luis A; Diaz-Ortiz, Jesús; Alarcón-Romero, Mario; Dávila-Vazquez, Gustavo; Saldarriaga-Noreña, Hugo; Waliszewski, Stefan M

    2014-09-01

    In Mexico, organochlorine pesticides were used in public health and agriculture programs, causing chronic exposure to the population. Human breast milk samples were collected from 171 mothers who were residents from Guerrero, Mexico. Analysis was carried out by gas chromatography. Median concentrations (mg/kg on fat basis) for the following pesticides were: HCB, 0.009; β-HCH, 0.004; pp'DDE, 0.760; op'DDT, 0.016; pp'DDT, 0.045; and Σ-DDT, 0.833. These values are lower than in other States in Mexico, and in some countries where the use of these pesticides was banned more than 30 years ago. Differences were found in HCB, pp'DDE and pp'DDT concentrations in groups divided according to age (p pesticide levels in human milk is expected in a few years.

  7. Organochlorine residues in harbour porpoises from Southwest Greenland

    Energy Technology Data Exchange (ETDEWEB)

    Borrell, Asuncion; Aguilar, Alex; Cantos, Gemma; Lockyer, Christina; Heide-Joergensen, Mads Peter; Jensen, Jette

    2004-02-01

    During the 1995 hunting season, 75 harbour porpoises (Phocoena phocoena) were sampled in three locations in West Greenland: Maniitsoq, Nuuk, and Paamiut. Sex, age, morphometrics, reproductive condition, and organochlorine compound (OC) levels in blubber were determined for each individual. OC levels were extremely low and, therefore considered unlikely to affect the population adversely: mean blubber concentrations, expressed on lipid weight basis were 1.98 (S.D.=1.1) mg/kg for PCBs, 2.76 (S.D.=1.66) mg/kg for tDDT and 0.21 (S.D.=0.11) mg/kg for HCB. No statistical differences were observed among individuals caught in the various locations. OC concentrations showed statistically significant positive associations with age in males but negative in females; consequently, mature females presented lower pollutant loads than their male counterparts. Juveniles did not show differences between sexes. A higher proportion of less chlorinated and more metabolizable polychlorinated biphenyls (PCBs) compared to tPCBs was found in calves (age<=1) than in mature females, indicating that the feeding habits of these two groups differ and that a greater transfer of less chlorinated compounds is passed from females to their pups through lactation and parturition. Harbour porpoises significantly contribute to the dietary intake of OCs by local Inuit populations. This contribution could be reduced if mature males were selectively avoided; however, current hunting procedures make this selection impracticable. - While organochlorine levels in W. Greenland harbour porpoises are low, their contribution to Inuit dietary intake should not be disregarded.

  8. Organochlorine residues in harbour porpoises from Southwest Greenland

    International Nuclear Information System (INIS)

    Borrell, Asuncion; Aguilar, Alex; Cantos, Gemma; Lockyer, Christina; Heide-Joergensen, Mads Peter; Jensen, Jette

    2004-01-01

    During the 1995 hunting season, 75 harbour porpoises (Phocoena phocoena) were sampled in three locations in West Greenland: Maniitsoq, Nuuk, and Paamiut. Sex, age, morphometrics, reproductive condition, and organochlorine compound (OC) levels in blubber were determined for each individual. OC levels were extremely low and, therefore considered unlikely to affect the population adversely: mean blubber concentrations, expressed on lipid weight basis were 1.98 (S.D.=1.1) mg/kg for PCBs, 2.76 (S.D.=1.66) mg/kg for tDDT and 0.21 (S.D.=0.11) mg/kg for HCB. No statistical differences were observed among individuals caught in the various locations. OC concentrations showed statistically significant positive associations with age in males but negative in females; consequently, mature females presented lower pollutant loads than their male counterparts. Juveniles did not show differences between sexes. A higher proportion of less chlorinated and more metabolizable polychlorinated biphenyls (PCBs) compared to tPCBs was found in calves (age<=1) than in mature females, indicating that the feeding habits of these two groups differ and that a greater transfer of less chlorinated compounds is passed from females to their pups through lactation and parturition. Harbour porpoises significantly contribute to the dietary intake of OCs by local Inuit populations. This contribution could be reduced if mature males were selectively avoided; however, current hunting procedures make this selection impracticable. - While organochlorine levels in W. Greenland harbour porpoises are low, their contribution to Inuit dietary intake should not be disregarded

  9. Modeling global distribution of agricultural insecticides in surface waters.

    Science.gov (United States)

    Ippolito, Alessio; Kattwinkel, Mira; Rasmussen, Jes J; Schäfer, Ralf B; Fornaroli, Riccardo; Liess, Matthias

    2015-03-01

    Agricultural insecticides constitute a major driver of animal biodiversity loss in freshwater ecosystems. However, the global extent of their effects and the spatial extent of exposure remain largely unknown. We applied a spatially explicit model to estimate the potential for agricultural insecticide runoff into streams. Water bodies within 40% of the global land surface were at risk of insecticide runoff. We separated the influence of natural factors and variables under human control determining insecticide runoff. In the northern hemisphere, insecticide runoff presented a latitudinal gradient mainly driven by insecticide application rate; in the southern hemisphere, a combination of daily rainfall intensity, terrain slope, agricultural intensity and insecticide application rate determined the process. The model predicted the upper limit of observed insecticide exposure measured in water bodies (n = 82) in five different countries reasonably well. The study provides a global map of hotspots for insecticide contamination guiding future freshwater management and conservation efforts. Copyright © 2014 Elsevier Ltd. All rights reserved.

  10. Phytoremediation of organochlorine and pyrethroid pesticides by aquatic macrophytes and algae in freshwater systems.

    Science.gov (United States)

    Riaz, Ghazala; Tabinda, Amtul Bari; Iqbal, Shakir; Yasar, Abdullah; Abbas, Mateen; Khan, Abdul Muqeet; Mahfooz, Yusra; Baqar, Mujtaba

    2017-10-03

    Extensive use of Pesticides in agriculture and its surface runoff in river water is a major environmental concern. The present study evaluated the phytoremediation potential of Eichornia crassipes, Pistia strateotes and algae (Chaetomorpha sutoria, Sirogonium sticticum and Zygnema sp.) for organochlorine and pyrethroid pesticides. Water and plant samples were extracted by liquid phase and solid phase extraction respectively and analyzed by high-performance liquid chromatography. Eleven treatments (T1-T11) with and without plants were used for phytoremediation of organochlorine and pyrethroid pesticides. During the experiment, P. strateotes, E. crassipes and algae (C. sutoria, S. sticticum and Zygnema sp.) showed the highest removal efficiency with 62 (71% root, 29% shoot), 60 (67% root, 33% shoot), and 58% respectively for organochlorine and 76 (76% root, 24% shoot), 68 (69% root, 31% shoot), and 70% respectively for pyrethroids for the respective aquatic plants. Dissipation rate constant of treatments with plants (T2, T3, T5, T6, T8, and T9) was significantly higher (p < 0.05) as compared to that of treatments without plants (T10 and T11, control) for both organochlorine and pyrethroid. The bioconcentration factor of pyrethroid treatments (T3, T6, and T9) was significantly higher (p < 0.05) as compared to that of organochlorine treatments (T2, T5 and T8). The removal efficiency of E. crassipes, P. strateotes and algae (C. sutoria, S. sticticum and Zygnema sp.) for pyrethroids was significantly higher (p < 0.01) as compared to that of organochlorine.

  11. Organochlorine concentrations in breast milk and risk assessment in the urban and rural areas of Northern China

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, J.H.; Sun, S.U. [Jichi Medical School, Tochigi (Japan). Dept. of Environmental Medicine, Center for Community Medicine]|[CREST-JST, Kawaguchi, Saitama (Japan); Koga, M. [Prefectural Univ. of Kumamoto (Japan). Fac. of Environmental and Symbiotic Sciences] (and others)

    2004-09-15

    In China, during the past 40 years, organochlorine pesticides (OPs) with impurity were produced and used in a large quantity. However, little is known on the OPs contamination status of the residents in mainland of China. To elucidate body burden of organochlorine compounds and factors associated with organochlorine levels of the residents in North China, we performed life style questionnaire and collected breast milk specimens at Shijiazhuang urban and Tangshan rural area, Hebei Province, North China.

  12. Malaria Vector Control Still Matters despite Insecticide Resistance.

    Science.gov (United States)

    Alout, Haoues; Labbé, Pierrick; Chandre, Fabrice; Cohuet, Anna

    2017-08-01

    Mosquito vectors' resistance to insecticides is usually considered a major threat to the recent progresses in malaria control. However, studies measuring the impact of interventions and insecticide resistance reveal inconsistencies when using entomological versus epidemiological indices. First, evaluation tests that do not reflect the susceptibility of mosquitoes when they are infectious may underestimate insecticide efficacy. Moreover, interactions between insecticide resistance and vectorial capacity reveal nonintuitive outcomes of interventions. Therefore, considering ecological interactions between vector, parasite, and environment highlights that the impact of insecticide resistance on the malaria burden is not straightforward and we suggest that vector control still matters despite insecticide resistance. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Erythritol, a non-nutritive sugar alcohol sweetener and the main component of truvia®, is a palatable ingested insecticide.

    Directory of Open Access Journals (Sweden)

    Kaitlin M Baudier

    Full Text Available Insecticides have a variety of commercial applications including urban pest control, agricultural use to increase crop yields, and prevention of proliferation of insect-borne diseases. Many pesticides in current use are synthetic molecules such as organochlorine and organophosphate compounds. Some synthetic insecticides suffer drawbacks including high production costs, concern over environmental sustainability, harmful effects on human health, targeting non-intended insect species, and the evolution of resistance among insect populations. Thus, there is a large worldwide need and demand for environmentally safe and effective insecticides. Here we show that Erythritol, a non-nutritive sugar alcohol, was toxic to the fruit fly Drosophila melanogaster. Ingested erythritol decreased fruit fly longevity in a dose-dependent manner, and erythritol was ingested by flies that had free access to control (sucrose foods in choice and CAFE studies. Erythritol was US FDA approved in 2001 and is used as a food additive in the United States. Our results demonstrate, for the first time, that erythritol may be used as a novel, environmentally sustainable and human safe approach for insect pest control.

  14. Insecticide resistance and role in malaria transmission of Anopheles funestus populations from Zambia and Zimbabwe.

    Science.gov (United States)

    Choi, Kwang S; Christian, Riann; Nardini, Luisa; Wood, Oliver R; Agubuzo, Eunice; Muleba, Mbanga; Munyati, Shungu; Makuwaza, Aramu; Koekemoer, Lizette L; Brooke, Basil D; Hunt, Richard H; Coetzee, Maureen

    2014-10-08

    Two mitochondrial DNA clades have been described in Anopheles funestus populations from southern Africa. Clade I is common across the continent while clade II is known only from Mozambique and Madagascar. The specific biological status of these clades is at present unknown. We investigated the possible role that each clade might play in the transmission of Plasmodium falciparum and the insecticide resistance status of An. funestus from Zimbabwe and Zambia. Mosquitoes were collected inside houses from Nchelenge District, Zambia and Honde Valley, Zimbabwe in 2013 and 2014. WHO susceptibility tests, synergist assays and resistance intensity tests were conducted on wild females and progeny of wild females. ELISA was used to detect Plasmodium falciparum circumsporozoite protein. Specimens were identified to species and mtDNA clades using standard molecular methods. The Zimbabwean samples were all clade I while the Zambian population comprised 80% clade I and 20% clade II in both years of collection. ELISA tests gave an overall infection rate of 2.3% and 2.1% in 2013, and 3.5% and 9.2% in 2014 for Zimbabwe and Zambia respectively. No significant difference was observed between the clades. All populations were resistant to pyrethroids and carbamates but susceptible to organochlorines and organophosphates. Synergist assays indicated that pyrethroid resistance is mediated by cytochrome P450 mono-oxygenases. Resistance intensity tests showed high survival rates after 8-hrs continuous exposure to pyrethroids but exposure to bendiocarb gave the same results as the susceptible control. This is the first record of An. funestus mtDNA clade II occurring in Zambia. No evidence was found to suggest that the clades are markers of biologically separate populations. The ability of An. funestus to withstand prolonged exposure to pyrethroids has serious implications for the use of these insecticides, either through LLINs or IRS, in southern Africa in general and resistance management

  15. Organochlorine pesticides in the atmosphere of Guangzhou and Hong Kong: Regional sources and long-range atmospheric transport

    Science.gov (United States)

    Li, Jun; Zhang, Gan; Guo, Lingli; Xu, Weihai; Li, Xiangdong; Lee, Celine S. L.; Ding, Aijun; Wang, Tao

    Organochlorine pesticides (OCPs) were measured in the atmosphere over the period of December 2003-December 2004 at four sampling sites in Guangzhou and Hong Kong. Gas phase and particle phase concentrations of 8 OCP species, including trans-chlordane ( t-CHL), cis-chlordane ( c-CHL), p, p'-DDT, p, p'-DDE, o, p'-DDT, α-endosulfan, α- and γ-hexachlorocyclohexane (HCH), were studied. OCPs were found predominantly in the gas phase in all seasons. t-CHL, c-CHL, o, p'-DDT, p, p'-DDT and α-endosulfan had significantly ( pGuangzhou could be attributed to the present usage of lindane and dicofol in the Pearl River Delta (PRD) region. The very high concentrations of p, p'-DDT and α-endosulfan were observed at all sampling sites. The results of 7 days air back trajectory analysis indicated that the unusual high p, p'-DDT levels in summer in both cities could be related to the seasonal usage of DDT containing antifouling paints for fishing ships in the upwind seaports of the region. The high concentrations of α-endosulfan in winter in the study area suggested an atmospheric transport by the winter monsoon from the East China, where endosulfan is being used as insecticide in cotton fields. The consistency of the seasonal variation of concentrations and isomeric ratios of DDTs and α-endosulfan with the alternation of winter monsoon and summer monsoon suggested that the Asian monsoon plays an important role in the long-range atmospheric transport of OCPs.

  16. Modeling global distribution of agricultural insecticides in surface waters

    International Nuclear Information System (INIS)

    Ippolito, Alessio; Kattwinkel, Mira; Rasmussen, Jes J.; Schäfer, Ralf B.; Fornaroli, Riccardo; Liess, Matthias

    2015-01-01

    Agricultural insecticides constitute a major driver of animal biodiversity loss in freshwater ecosystems. However, the global extent of their effects and the spatial extent of exposure remain largely unknown. We applied a spatially explicit model to estimate the potential for agricultural insecticide runoff into streams. Water bodies within 40% of the global land surface were at risk of insecticide runoff. We separated the influence of natural factors and variables under human control determining insecticide runoff. In the northern hemisphere, insecticide runoff presented a latitudinal gradient mainly driven by insecticide application rate; in the southern hemisphere, a combination of daily rainfall intensity, terrain slope, agricultural intensity and insecticide application rate determined the process. The model predicted the upper limit of observed insecticide exposure measured in water bodies (n = 82) in five different countries reasonably well. The study provides a global map of hotspots for insecticide contamination guiding future freshwater management and conservation efforts. - Highlights: • First global map on insecticide runoff through modelling. • Model predicts upper limit of insecticide exposure when compared to field data. • Water bodies in 40% of global land surface may be at risk of adverse effects. • Insecticide application rate, terrain slope and rainfall main drivers of exposure. - We provide the first global map on insecticide runoff to surface water predicting that water bodies in 40% of global land surface may be at risk of adverse effects

  17. Neurobehavioral toxicology of pyrethroid insecticides

    International Nuclear Information System (INIS)

    Crofton, K.M.

    1986-01-01

    Pyrethroid insecticides are classified as either Type I or Type II based upon in vivo toxic signs, and neurophysiological and biochemical data. Both axonal sodium channels and the γ-aminobutyric acid (GABA) receptor complex have been proposed as the major site of action of the Type II pyrethroids. This investigation characterized the behavior and biochemical effects of low dosages of pyrethroids in rats. Type I and II pyrethroids were tested for effects on figure-eight maze activity and the acoustic startle response (ASR). All compounds decreased figure-eight maze activity. Interactions of Type I and II pyrethroids with the three major binding sites on the GABA complex were determined in vivo. Radioligand binding experiments assessed in vitro interactions of pyrethroids with the three major GABA-complex binding sites. None of the pyrethroids competed for [ 3 H]-muscimol or [ 3 H]-flunitrazepam binding. Only Type II pyrethroids inhibited binding of [ 35 S]-t-butylbicyclophosphorothionate (TBPS) in cortical synaptosome preparations with K/sub i/ values of 5 to 10 μM. The [ 35 S]-TBPS data implicate the TBPS/picrotoxinin binding site in the mechanism of Type II pyrethroid toxicity. The results of these experiments support the classification of pyrethroids into two classes, and demonstrate the utility of the figure-eight maze and the ASR in studies to elucidate neurotoxic mechanisms. The interaction of the Type II pyrethroids is probably restricted to the TBPS/picrotoxinin binding domain on the GABA complex as shown by both the in vivo and in vitro studies

  18. Insecticide susceptibility status of human biting mosquitoes in ...

    African Journals Online (AJOL)

    Background: There has been a rapid emergence in insecticide resistance among mosquito population to commonly used public health insecticides. This situation presents a challenge to chemicals that are currently used to control mosquitoes in sub-Saharan African. Furthermore, there is limited information on insecticide ...

  19. Microbes as interesting source of novel insecticides: A review ...

    African Journals Online (AJOL)

    ... strains with good insecticidal properties can be identified, evaluated and utilized for pest control. This paper reviews the insecticidal properties of microbes and their potential utility in pest management. Keywords: Microbes, insecticides, metabolites, pest management. African Journal of Biotechnology, Vol 13(26) 2582- ...

  20. Metabolic control of the insecticides safety use

    Directory of Open Access Journals (Sweden)

    L.I. Solomenko

    2016-06-01

    Full Text Available The results of the conducted research affirm that the phosphororganic insecticides utilization can lead to the break in the nitrogen metabolism, breaking the protein formation, reducing the protein molecules renewal, causing the amino acid and amides accumulation in the active state. It has been revealed that the translocation and transformation of the insecticides under consideration are more closely connected with the changes of insoluble protein fraction. The stagnation point of the Phosphamide and Kaunter impact on the plant has been determined. And only the use of the preparation in optimal norms can influence stimulatingly the course of the process under consideration.

  1. Grau de exposição a praguicidas organoclorados em moradores de aterro a céu aberto Levels of exposure to organochlorine pesticides in open-air dump dwellers

    Directory of Open Access Journals (Sweden)

    Eladio Santos Filho

    2003-08-01

    Full Text Available OBJETIVO: Estimar o grau de exposição interna aos praguicidas organoclorados (POP dos moradores de um atêrro a céu aberto. MÉTODOS: Estudo observacional, de aferição simultânea e controlado, cujo fator de estudo foi residir em área contaminada por POP e o efeito foi a concentração sanguínea dessas substâncias. A população de estudo foi de 238 pessoas residentes em um aterro a céu aberto (Pilões, no município de Cubatão, SP; e a população de controle ficou dimensionada em 258 pessoas, também residentes no mesmo município (Cota 200. Foram analisados os praguicidas HCB, p-p'DDT, p-p'DDE, p-p'DDD, o-p'DDT, a HCH; b HCH; g HCH; Aldrin; Dieldrin; Endrin; Heptaclor; Heptaclor-epoxi e Mirex. RESULTADOS: Os teores médios sangüíneos de HCB em Pilões foram de 4,66 µg/L, 155 vezes maior que a média na Cota 200 (0,03 µg/L. Em Pilões, os teores médios de DDT total foram de 3,71 µg/L, duas vezes maior do que na Cota 200 (1,85 µg/L e o HCH total apresentou concentrações sangüíneas seis vezes maiores em Pilões, 0,84 µg/L, contra 0,13 µg/L. CONCLUSÕES: Evidenciou-se associação positiva entre residir em Pilões e apresentar teores sangüíneos de POP, com risco muitas vezes maior quando comparado a localidades sem a presença desses contaminantes.OBJECTIVE: To estimate the degree of internal exposure to organochlorine pesticides (persistent organic pollutants, POP among inhabitants of an open-air dump. METHODS: This was an observational study with simultaneous measurement and control, in which the criterion for subjects was that they dwelled in an area contaminated by POP and the effect of such contamination was the concentration of such substances into the blood. The study population consisted of 238 people living on an open-air dump in Pilões, in the municipality of Cubatão, SP, Brazil, and the control population was formed by 258 people, also resident in that municipality, in the Cota 200 district. The following

  2. Assessment of organochlorine pesticide residues in Atlantic Rain Forest fragments, Rio de Janeiro, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Soares Quinete, Natalia, E-mail: nataliaquinete@yahoo.com.br [Instituto Nacional de Tecnologia, Departamento de Quimica Analitica, Laboratorio de Quimica Analitica e Metrologia em Quimica, Av. Venezuela, 82 - Rio de Janeiro, RJ 20081-312 (Brazil); Santos de Oliveira, Elba dos [Instituto Nacional de Tecnologia, Departamento de Energia, Av. Venezuela, 82 - Rio de Janeiro, RJ 20081-312 (Brazil); Fernandes, Daniella R. [Universidade Federal do Rio de Janeiro, Instituto de Quimica, Departamento de Quimica Analitica, CT - Bloco A, Cidade Universitaria, 21941-909 - Rio de Janeiro (Brazil); Souza Avelar, Andre de [Universidade Federal do Rio de Janeiro, Departamento de Geografia, Instituto de Geociencias, CCMN, Bloco F, Cidade Universitaria, 21941-919 - Rio de Janeiro (Brazil); Erthal Santelli, Ricardo [Universidade Federal do Rio de Janeiro, Instituto de Quimica, Departamento de Quimica Analitica, CT - Bloco A, Cidade Universitaria, 21941-909 - Rio de Janeiro (Brazil)

    2011-12-15

    A superficial water quality survey in a watershed of the Paraiba do Sul River, the main water supply for the most populated cities of southeastern Brazil, was held in order to assess the impact of the expansion of agricultural activity in the near border of the Atlantic Rain Forest. The aim of this study was to investigate the presence of priority organochlorine pollutants in soils and superficial waters of Atlantic rainforest fragments in Teresopolis, Rio de Janeiro State. Soil sample preparations were compared by using ultrasound, microwave assisted extraction and Soxhlet extraction. Recoveries of matrix spiked samples ranged from 70 to 130%. Analysis of a certified soil material showed recoveries ranging from 71 to 234%. Although low concentrations of organochlorine residues were found in water and soil samples, this area is of environmental importance and concern, thus demanding a monitoring program of its compartments. - Highlights: > The organochlorine pollutants occurrence in the Atlantic Rain Forest was investigated. > PARNASO was considered a control area of environmental quality. > Extractions methods were compared for typical C-rich soils samples from Brazil. > Low concentrations of organochlorine residues were found in water and soil samples. > A monitoring program is demanded due to the environmental importance of the area. - The occurrence of organochlorine pollutants in soils of the Atlantic rainforest fragments in Rio de Janeiro, Brazil demands a monitoring program of its compartments.

  3. Accumulation features of persistent organochlorines in resident and migratory birds from Asia

    International Nuclear Information System (INIS)

    Kunisue, Tatsuya; Watanabe, Mafumi; Subramanian, Annamalai; Sethuraman, Alagappan; Titenko, Alexei M.; Qui, Vo; Prudente, Maricar; Tanabe, Shinsuke

    2003-01-01

    Accumulation features of persistent organochlorines in migratory birds from Asia did not necessarily reflect only the pollution in the sampling area. - Concentrations of organochlorine contaminants including polychlorinated biphenyls (PCBs), dichlorodiphenyltrichloroethane and its metabolites (DDTs), hexachlorocyclohexane isomers (HCHs), chlordane compounds (CHLs), hexachlorobenzene (HCB) were determined in the resident and migratory birds, which were collected from India, Japan, Philippines, Russia (Lake Baikal) and Vietnam. Accumulation patterns of organochlorine concentrations in resident birds suggested that the predominant contaminants of each country were as follows: Japan-PCBs Philippines-PCBs and CHLs, India-HCHs and DDTs, Vietnam-DDTs, and Lake Baikal-PCBs and DDTs. The migratory birds from Philippines and Vietnam retained mostly the highest concentrations of DDTs among the organochlorines analyzed, indicating the presence of stopover and breeding grounds of those birds in China and Russia. On the other hand, migratory birds from India and Lake Baikal showed different patterns of organochlorine residues, reflecting that each species has inherent migratory routes and thus has exposure to different contaminants. Species which have breeding grounds around the Red Sea and Persian Gulf showed high levels of PCBs, indicating the presence of areas heavily polluted by PCBs in the Middle East

  4. Natural Organochlorines as Precursors of 3-Monochloropropanediol Esters in Vegetable Oils.

    Science.gov (United States)

    Tiong, Soon Huat; Saparin, Norliza; Teh, Huey Fang; Ng, Theresa Lee Mei; Md Zain, Mohd Zairey Bin; Neoh, Bee Keat; Md Noor, Ahmadilfitri; Tan, Chin Ping; Lai, Oi Ming; Appleton, David Ross

    2018-01-31

    During high-temperature refining of vegetable oils, 3-monochloropropanediol (3-MCPD) esters, possible carcinogens, are formed from acylglycerol in the presence of a chlorine source. To investigate organochlorine compounds in vegetable oils as possible precursors for 3-MCPD esters, we tested crude palm, soybean, rapeseed, sunflower, corn, coconut, and olive oils for the presence of organochlorine compounds. Having found them in all vegetable oils tested, we focused subsequent study on oil palm products. Analysis of the chlorine isotope mass pattern exhibited in high-resolution mass spectrometry enabled organochlorine compound identification in crude palm oils as constituents of wax esters, fatty acid, diacylglycerols, and sphingolipids, which are produced endogenously in oil palm mesocarp throughout ripening. Analysis of thermal decomposition and changes during refining suggested that these naturally present organochlorine compounds in palm oils and perhaps in other vegetable oils are precursors of 3-MCPD esters. Enrichment and dose-response showed a linear relationship to 3-MCPD ester formation and indicated that the sphingolipid-based organochlorine compounds are the most active precursors of 3-MCPD esters.

  5. Assessment of organochlorine pesticide residues in Atlantic Rain Forest fragments, Rio de Janeiro, Brazil

    International Nuclear Information System (INIS)

    Soares Quinete, Natalia; Santos de Oliveira, Elba dos; Fernandes, Daniella R.; Souza Avelar, Andre de; Erthal Santelli, Ricardo

    2011-01-01

    A superficial water quality survey in a watershed of the Paraiba do Sul River, the main water supply for the most populated cities of southeastern Brazil, was held in order to assess the impact of the expansion of agricultural activity in the near border of the Atlantic Rain Forest. The aim of this study was to investigate the presence of priority organochlorine pollutants in soils and superficial waters of Atlantic rainforest fragments in Teresopolis, Rio de Janeiro State. Soil sample preparations were compared by using ultrasound, microwave assisted extraction and Soxhlet extraction. Recoveries of matrix spiked samples ranged from 70 to 130%. Analysis of a certified soil material showed recoveries ranging from 71 to 234%. Although low concentrations of organochlorine residues were found in water and soil samples, this area is of environmental importance and concern, thus demanding a monitoring program of its compartments. - Highlights: → The organochlorine pollutants occurrence in the Atlantic Rain Forest was investigated. → PARNASO was considered a control area of environmental quality. → Extractions methods were compared for typical C-rich soils samples from Brazil. → Low concentrations of organochlorine residues were found in water and soil samples. → A monitoring program is demanded due to the environmental importance of the area. - The occurrence of organochlorine pollutants in soils of the Atlantic rainforest fragments in Rio de Janeiro, Brazil demands a monitoring program of its compartments.

  6. Levels of organochlorine pesticides in Brazilian human milk

    Energy Technology Data Exchange (ETDEWEB)

    Krauss, T. [INCQS/FIOCRUZ, RJ (Brazil); Braga, A.M.C.B.; Rosa, J.M. [CESTEH/ENSP/FIOCRUZ, RJ (Brazil); Kypke, K.; Malisch, R. [State Inst. for Chemical and Veterinary Analysis of Food, Freiburg (Germany)

    2004-09-15

    Breastfeeding has been intensively encouraged, especially in developing countries, due to its beneficial properties, i.e., increase infant immune factors and resistance to chronic diseases such as asthma, diabetes or allergies. In addition, human exposure to environmental pollution has led the scientific community to study the pathways of these contaminants and the possible risks they pose to human health. Exposure to organochlorine pesticides (OCs), in special, has been the subject of great interest during recent years given their potential toxicity, resistance to degradation and bioaccumulation through the food chain. The major source of OC has been agriculture and public health campaigns to vector control. General population exposure occur mainly through the diet and human milk can be an indicator of exposure since OCs are lipophilic xenobiotics that accumulate in adipose tissue and breastfeeding is the main pathway of elimination through the fatty fraction of milk. In this study pooled samples of mothers living in the capitals of two different states of Brazil were evaluated in order to assess the trends of human exposure to persistent pollutants.

  7. Phytoremediation of organochlorine pesticides: Concept, method, and recent developments.

    Science.gov (United States)

    Singh, Tanvi; Singh, Dileep K

    2017-09-02

    Rapid increase in industrialization of world economy in the past century has resulted in significantly high emission of anthropogenic chemicals in the ecosystem. The organochlorine pesticides (OCPs) are a great risk to the global environment and endanger the human health due to their affinity for dispersion, transportation over long distances, and bioaccumulation in the food chain. Phytoremediation is a promising technology that aims to make use of plants and associated bacteria for the treatment of groundwater and soil polluted by these contaminants. Processes known to be involved in phytoremediation of OCPs include phytoaccumulation, rhizoremediation, and phytotransformation. Vegetation has been accounted to considerably amplify OCP elimination from soil, in contrast to non-planted soil, attributable to both, uptake within plant tissues and high microbial degradation of OCP within the root zone. Developing transgenic plants is a promising approach to enhance phytoremediation capabilities. Recent advances in the application of phytoremediation technique for OCPs, including uptake by plants and plant-microbe association in the rhizosphere for the enhanced degradation and mineralization of these pollutants, is presented in this review. Additionally, some attempts to improve this technique using transgenesis and role of certain enzymes are also discussed.

  8. Reconstruction of organochlorine compound inputs in the Tagus Prodelta.

    Science.gov (United States)

    Mil-Homens, Mário; Vicente, Maria; Grimalt, Joan O; Micaelo, Cristina; Abrantes, Fátima

    2016-01-01

    Twenty century time-resolved variability of riverine deposits of polychlorobiphenyls (PCBs), DDTs, hexachlorocyclohexanes (HCHs) and hexachlorobenzene (HCB) was studied in three (210)Pb dated sediment cores collected in a depositional shelf area adjacent to the Tagus estuary (the Tagus Prodelta). The geographic and temporal distribution patterns were consistent with discharge of these organochlorine compounds (OCs) in the area associated with the Tagus mouth. Their concentrations were not correlated with the sedimentary total organic carbon. The PCB down-core profiles were dominated by CB138 and CB153 (hexa-CBs) congeners followed by CB180 (hepta-CBs). Principal Component Analysis of the congener distributions of these compounds did not define temporal down-core trends. The ratios of DDT metabolites (p,p'-DDE/p,p'-DDT) were consistent with recent DDT inputs into the environment and/or earlier applications and long-term residence in soils/sediments until these were eroded and remobilized. Copyright © 2015 Elsevier B.V. All rights reserved.

  9. Organochlorine pesticides and polychlorinated biphenyls in California sea lions

    Energy Technology Data Exchange (ETDEWEB)

    Kannan, K.; Kajiwara, N.; Le Boeuf, B.J.; Tanabe, S

    2004-10-01

    Concentrations of polychlorinated biphenyls (PCBs), DDTs, chlordanes, HCHs, hexachlorobenzene (HCB), dieldrin, heptachlor epoxide, tris(4-chlorophenyl)methane (TCPMe), and tris(4-chlorophenyl)methanol (TCPMOH) were measured in the blubber of California sea lions (Zalophus californianus) collected in 2000. DDTs were the most predominant contaminants, followed by PCBs, chlordanes, TCPMe, HCHs, TCPMOH, dieldrin, and heptachlor epoxide. Concentrations of PCBs and DDTs varied from a few {mu}g/g to several hundreds of {mu}g/g on a lipid weight basis. Concentrations of DDTs have declined by an order of magnitude over the last three decades in California sea lions; nevertheless, the measured concentrations of PCBs and DDTs in California sea lions are still some of the highest values reported for marine mammals in recent years. Concentrations of organochlorines were highly correlated with one another. Concentrations of PCBs and DDTs in the blubber of gray whale, humpback whale, northern elephant seal, and harbor seal, and in the adipose fat of sea otter, were lower than the levels found in California sea lions, and were in the range of a few to several {mu}g/g on a lipid weight basis.

  10. Organochlorine pesticides in the ambient air of Chiapas, Mexico.

    Science.gov (United States)

    Alegria, Henry; Bidleman, Terry F; Figueroa, Miguel Salvador

    2006-04-01

    Organochlorine (OC) pesticides were measured in the ambient air of Chiapas, Mexico during 2000-2001. Concentrations of some OC pesticides (DDTs, chlordanes, toxaphene) were elevated compared with levels in the Great Lakes region, while those of other pesticides were not (hexachlorocyclohexanes, dieldrin). While this suggests southern Mexico as a source region for the former group of chemicals, comparably high levels have also been reported in parts of the southern United States, where their suspected sources are soil emissions (DDTs, toxaphene) and termiticide usage (chlordane). Ratios of p,p'-DDT/p,p'-DDE and trans-chlordane/cis-chlordane/trans-nonachlor (TC/CC/TN) in Chiapas suggest a mixture of fresh and weathered sources, while congener profiles of toxaphene suggest emission of old residues from soils. This is supported by air parcel back trajectory analysis, which indicated that air masses over Chiapas at the time of sampling had previously passed over areas of continuing or recent use of some OC pesticides as well as areas of past use.

  11. Pollutants in harp seals (Phoca groenlandica). I. Organochlorines

    Energy Technology Data Exchange (ETDEWEB)

    Ronald, K; Frank, R J; Dougan, J L; Frank, R; Braun, H E

    1984-09-01

    Between 1976 and 1978, 248 harp seals were sampled from 5 locations in the Northwest Atlantic and Arctic for organochlorine (OC) residue analysis in tissue. Blood, kidney, brain, muscle and blubber samples were analysed for PCB, DDT, dieldrin, hexachlorobenzene (HCB), and heptachlor epoxide. Levels were generally greatest in blubber tissue. Overall, mean levels of DDT and PCB were greater than those of other OC. A barrier prevented OC compounds from accumulating in the brain to the level one might expect in lipid tissues. Positive correlations were found between 1: DDT and PCB, 2: DDT and dieldrin, and 3: PCB and deildrin. Male harp seals bioaccumulated DDT, PCB, heptachlor epoxide and dieldrin with age. As a group, adult males sampled in the Gulf of St. Lawrence carried the highest concentrations of all OC, except that chlordane did not appear to bioaccumulate and levels of hexachlorobenzene were minimal. Females generally ceased exhibiting significant bioaccumulation once breeding age was reached, due to transplacental and transmammary residue transfer of OC from mother to pup. There were some significant differences in OC levels between locations with DDT: Gulf greater than Front; PCB: Gulf greater than Front; dieldrin: Gulf greater than Front; heptachlor epoxide: Front greater than Gulf. No significant differences were found, however, when northern locations (Grise Fiord, Northwest Greenland, Pangnirtung) were compared to southern (Gulf, Front) on a group basis.

  12. Organochlorine pesticides and polychlorinated biphenyls in California sea lions

    International Nuclear Information System (INIS)

    Kannan, K.; Kajiwara, N.; Le Boeuf, B.J.; Tanabe, S.

    2004-01-01

    Concentrations of polychlorinated biphenyls (PCBs), DDTs, chlordanes, HCHs, hexachlorobenzene (HCB), dieldrin, heptachlor epoxide, tris(4-chlorophenyl)methane (TCPMe), and tris(4-chlorophenyl)methanol (TCPMOH) were measured in the blubber of California sea lions (Zalophus californianus) collected in 2000. DDTs were the most predominant contaminants, followed by PCBs, chlordanes, TCPMe, HCHs, TCPMOH, dieldrin, and heptachlor epoxide. Concentrations of PCBs and DDTs varied from a few μg/g to several hundreds of μg/g on a lipid weight basis. Concentrations of DDTs have declined by an order of magnitude over the last three decades in California sea lions; nevertheless, the measured concentrations of PCBs and DDTs in California sea lions are still some of the highest values reported for marine mammals in recent years. Concentrations of organochlorines were highly correlated with one another. Concentrations of PCBs and DDTs in the blubber of gray whale, humpback whale, northern elephant seal, and harbor seal, and in the adipose fat of sea otter, were lower than the levels found in California sea lions, and were in the range of a few to several μg/g on a lipid weight basis

  13. Effect of selected insecticides on SF9 insect cell line

    International Nuclear Information System (INIS)

    Saleh, M.; Rahmo, A.; Hajjar, J.

    2013-01-01

    The toxic effect of three insecticides: dimethoate (organophosphate insecticide), acetamiprid (neonicotinoid insecticide) and deltamethrin (pyrethroid insecticide) were evaluated in vitro on cultured Sf9 cell line. Cell growth inhibition was measured by the 3- (4,5- dimethylthiazol - 2-yl) - 2,5 - diphenyl tetrazolium bromide (MTT) assay. Regression Analysis was used to estimate the 20% inhibition of cells growth (IC 20). The IC 20 values obtained for deltamethrin, acetamipridand dimethoate were: 46.8, 61.6 and 68.9 μM, respectively. The proportion of phagocytic cells was positively correlated with the applied concentrations of the insecticides. (author)

  14. Possibilities of Botanical Insecticides in Plant Protection

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Sajfrtová, Marie; Sovová, Helena; Bárnet, M.

    2008-01-01

    Roč. 2, č. 1 (2008), s. 16-23 ISSN 1313-2563 Grant - others:MŠk(CZ) 2B08049 Institutional support: RVO:67985858 Keywords : botanical insecticides * plant extracts * supercritical fluid extraction Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection

  15. Possibilities of Botanical Insecticides in Plant Protection

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Sajfrtová, Marie; Sovová, Helena; Bárnet, M.

    2008-01-01

    Roč. 2, č. 1 (2008), s. 16-23 ISSN 1313-2563 Grant - others:GA MŠMT(CZ) 2B08049 Institutional research plan: CEZ:AV0Z40720504 Keywords : botanical insecticides * plant exctracts * supercritical fluid extraction Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection

  16. Insecticidal and fungicidal compounds from Isatis tinctoria.

    Science.gov (United States)

    Seifert, K; Unger, W

    1994-01-01

    Tryptanthrin (1), indole-3-acetonitrile (2) and p-coumaric acid methylester (3) were isolated from the aerial parts of Isatis tinctoria L. The compounds show insecticidal and anti-feedant activity against termites (Reticulitermis santonensis), insect preventive and control activity against larvae of the house longhorn beetle (Hylotrupes bajulus) and fungicidal activity against the brown-rot fungus (Coniophora puteana).

  17. Organochlorine pesticide level differences among female inhabitants from Veracruz, Puebla and Tabasco, Mexico.

    Science.gov (United States)

    Waliszewski, Stefan M; Caba, M; Saldarriaga-Noreña, H; Martínez, A J; Meza, E; Valencia Quintana, R; Zepeda, R

    2014-08-01

    Organochlorine pesticides have been used in Mexico in malaria control programs and against ectoparasites. The objective of this study was to compare the levels of organochlorine pesticides: HCB, α-β-γ-HCH, pp'-DDE, op'-DDT and pp'-DDT in adipose tissue of female inhabitants from three Mexican states: Veracruz, Puebla and Tabasco. Data analyses indicated higher β-HCH levels in Puebla inhabitants. When comparing the mean values of the pp'-DDE concentrations among the three states, no statistically significant differences were noted. A trend of increasing concentrations of op'-DDT from Veracruz to Puebla and Tabasco was observed. Significantly higher pp'-DDT concentrations in Veracruz as compared to Puebla and Tabasco were determined. Using factorial analysis of three age categories (>30, 31-50, pesticide concentrations increases with age of participants, indicating time of exposure as a principal factor of organochlorine pesticides accumulation in adipose tissue.

  18. Bioaccumulation of organochlorine pollutants in the fish community in Lake Arungen, Norway

    International Nuclear Information System (INIS)

    Sharma, Chhatra Mani; Rosseland, Bjorn Olav; Almvik, Marit; Eklo, Ole Martin

    2009-01-01

    Organochlorine pollutants in the major fish species (pike Esox lucius, perch Perca fluviatilis, and roach Rutilus rutilus) of Lake Arungen, Norway, were investigated after an extensive removal of large pike in 2004. The organochlorine pollutants detected in fish liver samples in 2005 were dichlorodiphenyltrichloroethane (DDTs), polychlorinated biphenyls (PCBs), hexachlorobenzene (HCB), and heptachlor epoxide (HCE). DDTs were the dominant among all analyzed OCs. ΣPCB and HCB, detected in fish from two clearly distinct trophic levels (prey and predators), give an indication of biomagnification. All OC concentrations in female pike were significantly lower compared to males, which might be due to the removal of high concentrations of pollutants in roe during spawning. - Organochlorine pollutants in fish tissues tend to magnify up the food chain

  19. Assessing the effects of urbanization on the environment with soil legacy and current-use insecticides: a case study in the Pearl River Delta, China.

    Science.gov (United States)

    Wei, Yan-Li; Bao, Lian-Jun; Wu, Chen-Chou; He, Zai-Cheng; Zeng, Eddy Y

    2015-05-01

    To evaluate the impacts of anthropogenic events on the rapid urbanized environment, the levels of legacy organochlorine pesticides (OCPs) and current-use insecticides (CUPs), i.e., dichlorodiphenyltrichloroethane and its metabolites (DDTs), hexachlorocyclohexanes (HCHs), pyrethroids and organophosphates in soil of the Pearl River Delta (PRD) and surrounding areas were examined. Spatial concentration distributions of legacy OCPs and CUPs shared similar patterns, with higher concentrations occurred in the central PRD with more urbanization level than that in the PRD's surrounding areas. Furthermore, relatively higher concentrations of OCPs and CUPs were found in the residency land than in other land-use types, which may be attributed to land-use change under rapid urbanization. Moderate correlations between gross domestic production or population density and insecticide levels in fifteen administrative districts indicated that insecticide spatial distributions may be driven by economic prosperity. The soil-air diffusive exchanges of DDTs and HCHs demonstrated that soil was a sink of atmospheric o,p'-DDE, o,p'-DDD, p,p'-DDD and o,p'-DDT, and was a secondary source of HCHs and p,p'-DDT to atmosphere. The soil inventories of DDTs and HCHs (100 ± 134 and 83 ± 70 tons) were expected to decrease to half of their current values after 18 and 13 years, respectively, whereas the amounts of pyrethroids and organophosphates (39 and 6.2 tons) in soil were estimated to decrease after 4 and 2 years and then increase to 87 and 1.0 tons after 100 years. In this scenario, local residents in the PRD and surrounding areas will expose to the high health risk for pyrethroids by 2109. Strict ban on the use of technical DDTs and HCHs and proper training of famers to use insecticides may be the most effective ways to alleviate the health effect of soil contamination. Copyright © 2015 Elsevier B.V. All rights reserved.

  20. Study of Organochlorinated Pesticide Residues and Polychlorinated Biphenyls in Soil Samples

    Directory of Open Access Journals (Sweden)

    MSc. Vlora Gashi

    2013-12-01

    Full Text Available This paper presents and discusses the data obtained for organochlorinated pesticides and their residues in the soil samples of agricultural areas. Soil contamination is one of most important factors influencing the quality of agricultural products. Usage of heavy farm equipment, the land drainage, an exces­sive application of agrochemicals, emissions originating from mining, metallurgical, and chemical and coal power plants and transport, all generate a number of undesired substances (nitric and sulphur oxides, PAHs, heavy metals, pesticides, which after deposition in soil may influence crop quality. Thus, input of these contaminants into the environment should be carefully monitored. Levels of organochlorinated pesticides contamination were evaluated in agriculture areas that are in use. 10 soil samples were taken in agricultural areas  Plane of  Dugagjini , Kosovo. Representa­tive soil samples were collected from 0-30 cm top layer of the soil. In the analytical method we combined ultrasonic bath extraction and a Florisil column for samples clean-up. The analysis of the organochlorinated pesticides in soil samples was performed by gas chromatography technique using electron capture detector (GC/ECD. Optima-5 (low/mid polarity, 5% phenyl methyl siloxane 60 m x 0.33 mm x 0.25μm film capillary column was used for isolation and determination of organochlorinated pesticides. Low concentrations of organochlorinated pesticide and their metabolites were found in the studied samples. The presence of organochlorinated pesticides and their residues is probably resulting of their previous uses for agricultural purposes.

  1. Assessment and review of organochlorine pesticide pollution in Kyrgyzstan.

    Science.gov (United States)

    Toichuev, Rakhmanbek Mamatkadyrovich; Zhilova, Liudmila Victorovna; Makambaeva, Gulsanam Bakhtiyarovna; Payzildaev, Timur Rashidinovich; Pronk, Wouter; Bouwknegt, Matthijs; Weber, Roland

    2017-09-06

    The current study describes the preliminary assessment and securing activities of the largest and most hazardous POPs-contaminated sites in Kyrgyzstan. In 2010, cattle died and population were found with high pesticide levels in blood, human milk, and placenta. In the first phase of the study, a historic assessment of the pesticide dumping at the landfill/dump sites have been conducted. In the second phase, soil analysis for organochlorine pesticides in the areas of the pesticide disposal sites, the former pesticides storehouses, agro-air strips, and the cotton-growing fields were conducted. By this assessment, a first overview of the types and sources of pollution and of the scale of the problem is compiled including information gaps. From major pesticides used, DDT, DDE, and HCH were measured in the highest concentrations. With the limited analytical capacity present, a reasonable risk assessment could be performed. This paper also reports on practical risk reduction measures that have been carried out recently at the two major pesticide disposal sites with support of a Dutch environmental engineering company, an international NGO (Green Cross Switzerland) and local authorities from the Suzak region within an UN project. Local population living near the sites of the former pesticide storehouses and agro-airstrips are advised not to cultivate vegetables and melons or to raise cattle on these areas. Instead, it is recommended to grow technical crops or plant trees. Further recommendations on monitoring and assessment is given including the suggestion to consider the findings in the National Implementation Plan of Kyrgyzstan.

  2. Atmospheric deposition of organochlorine contaminants to Galveston Bay, Texas

    Science.gov (United States)

    Park, June-Soo; Wade, Terry L.; Sweet, Stephen

    Atmospheric monitoring of PCBs and chlorinated pesticides (e.g., HCHs, chlordanes, and DDTs) in Galveston Bay was conducted at Seabrook, Texas. Air and wet deposition samples were collected from 2 February 1995 and continued through 6 August 1996. Vapor total PCB ( tPCB) concentrations in air ranged from 0.21 to 4.78 ng m -3 with a dominance of tri-chlorinated PCBs. Dissolved tPCBs in rain ranged from 0.08 to 3.34 ng l -1, with tetra-chlorinated PCBs predominating. The predominant isomers found in air and rain were α- and γ-HCH, α- and γ-chlordanes, 4,4'-DDT, and dieldrin. The concentrations of PCBs and pesticides in the air and rain revealed no clear seasonal trend. Elevated levels of PCBs in the air occurred when temperatures were high and wind came from urban and industrialized areas (S, SW, NW, and W of the site). Concentrations of HCHs were elevated in April, May, and October, perhaps due to local and/or regional applications of γ-HCH (lindane). Other pesticides showed no notable temporal variation. When winds originated from the Gulf of Mexico (southeasterly), lower concentrations of organochlorines were detected in the air. The direct deposition rate (wet+dry) of PCBs to Galveston Bay (6.40 μg m -2 yr -1) was significantly higher than that of pesticides by a factor of 5-10. The net flux from gas exchange estimated for PCBs was from Galveston Bay water to the atmosphere (78 μg m -2 yr -1). Gas exchange of PCBs from bay water to the atmosphere was the dominant flux.

  3. Exploration of Novel Botanical Insecticide Leads: Synthesis and Insecticidal Activity of β-Dihydroagarofuran Derivatives.

    Science.gov (United States)

    Zhao, Ximei; Xi, Xin; Hu, Zhan; Wu, Wenjun; Zhang, Jiwen

    2016-02-24

    The discovery of novel leads and new mechanisms of action is of vital significance to the development of pesticides. To explore lead compounds for botanical insecticides, 77 β-dihydroagarofuran derivatives were designed and synthesized. Their structures were mainly confirmed by (1)H NMR, (13)C NMR, DEPT-135°, IR, MS, and HRMS. Their insecticidal activity was evaluated against the third-instar larvae of Mythimna separata Walker, and the results indicated that, of these derivatives, eight exhibited more promising insecticidal activity than the positive control, celangulin-V. Particularly, compounds 5.7, 6.6, and 6.7 showed LD50 values of 37.9, 85.1, and 21.1 μg/g, respectively, which were much lower than that of celangulin-V (327.6 μg/g). These results illustrated that β-dihydroagarofuran ketal derivatives can be promising lead compounds for developing novel mechanism-based and highly effective botanical insecticides. Moreover, some newly discovered structure-activity relationships are discussed, which may provide some important guidance for insecticide development.

  4. Ion channels: molecular targets of neuroactive insecticides.

    Science.gov (United States)

    Raymond-Delpech, Valérie; Matsuda, Kazuhiko; Sattelle, Benedict M; Rauh, James J; Sattelle, David B

    2005-11-01

    Many of the insecticides in current use act on molecular targets in the insect nervous system. Recently, our understanding of these targets has improved as a result of the complete sequencing of an insect genome, i.e., Drosophila melanogaster. Here we examine the recent work, drawing on genetics, genomics and physiology, which has provided evidence that specific receptors and ion channels are targeted by distinct chemical classes of insect control agents. The examples discussed include, sodium channels (pyrethroids, p,p'-dichlorodiphenyl-trichloroethane (DDT), dihydropyrazoles and oxadiazines); nicotinic acetylcholine receptors (cartap, spinosad, imidacloprid and related nitromethylenes/nitroguanidines); gamma-aminobutyric acid (GABA) receptors (cyclodienes, gamma-BHC and fipronil) and L-glutamate receptors (avermectins). Finally, we have examined the molecular basis of resistance to these molecules, which in some cases involves mutations in the molecular target, and we also consider the future impact of molecular genetic technologies in our understanding of the actions of neuroactive insecticides.

  5. Current trends of some organochlorinated pesticides in Yamuna River sediments around Delhi

    Digital Repository Service at National Institute of Oceanography (India)

    Sethi, P.K.; Bhattacharyya, A.K.; Sarkar, A.

    selected for the purpose of study. Among the organochlorine pesticides detected, t-DDT was the most predominant in the sediments of Yamuna River. The concentration of t-DDT was in the range of 63.0-236.0 ng/g during the pre-monsoon and decreased...

  6. Thirty year monitoring of PCBs, organochlorine pesticides and tetrabromodiphenylether in eel from The Netherlands

    NARCIS (Netherlands)

    Boer, de J.; Dao, Q.T.; Leeuwen, van P.W.; Kotterman, M.J.J.; Schobben, J.H.M.

    2010-01-01

    Because of their excellent properties as a biomonitor, yellow eels (Anguilla anguilla) have been used for time-trend monitoring of polychlorinated biphenyls (PCBs), organochlorine pesticides (OCPs) and tetrabrominated diphenylether (tetra-BDE). The program has now lasted for thirty years and has

  7. Organochlorine pesticides in lacustrine sediments and tilapias of Metztitlan, Hidalgo, Mexico.

    Science.gov (United States)

    Fernández-Bringas, Laura M; Ponce-Vélez, Guadalupe; Calva, Laura G; Salgado-Ugarte, Isaías Hazamamberth; Botello, Alfonso V; Díaz González, Gilberto

    2008-09-01

    The organochlorine pesticides (OP) are very stable molecules, due to this stability; they are very resistant in the environment and highly related to fat tissues with a wide diffusion property and an average time life higher then 10 years. We studied sediments (November 2001, April and June 2002) and organisms collected in April and July (2002) from the lacustric zone of Metzitlán, Hidalgo, Mexico. The analysis was performed according to UNEP/IAEA (1982) (sediments) and UNEP/FAO/IOC/IAEA (1986) (organisms) methods. Three chemical families of organochlorine pesticides were identified and analyzed to determine posible toxicological risk. The principal organochlorine compounds found in sediments were gamma-HCH, delta-HCH, p,p'-DDT and the endosulfan sulfate; these xenobiotics come from agriculture lands near the river and lake, used intensively, and most probably carried by the rain and rain flows into the main water body. In the tilapias tissue, p,p'-DDD y delta-HCH were detected. The average concentrations of organochlorine pesticides in sediments were within the internacional limits for freshwater benthonic fauna, although lindane (gamma-HCH) was near the limit. The fish were above the criteria established in the local legislation (NOM-027-SSA1-1993 y NOM-028-SSA1-1993).

  8. Carry-over of persistent organochlorine pesticides through placenta to fetus

    Directory of Open Access Journals (Sweden)

    Waliszewski Stefan M.

    2000-01-01

    Full Text Available OBJECTIVE: As a consequence of environmental exposure, organochlorine pesticides accumulate in lipid rich-tissues such as maternal adipose tissue and partition to maternal blood serum and umbilical blood serum. To establish their distribution in the human body, the concentration gradients of organochlorine pesticides between these compartments were determined. MATERIAL AND METHODS: Maternal adipose tissue, blood serum and umbilical blood serum samples from 64 volunteers admitted for cesarean delivery at Hospital Benito Coquet Lagunes were studied in Veracruz during 1997 and 1998. The pesticide residues were determined by gas chromatography and results obtained from different sample groups were analyzed using Pearson correlation coefficients and simple lineal regression. RESULTS: Significant results expressed on fat basis of organochlorine pesticides indicate that 1,1,1-trichloro-2,2-bis(4-chlorophenylethane (DDT levels are higher in maternal adipose tissue (4.51 mg/kg DDE and 1.27 mg/kg pp'DDT, maternal blood serum (4.45 mg/kg DDE and 0.78 mg/kg pp'DDT, and umbilical blood serum (4.70 mg/kg DDE and 0.88 mg/kg pp'DDT, due to greater affinity of DDT for lipids. CONCLUSIONS: The statistical evaluation of results and the pairing of samples analyzed indicate that absorbed organochlorine pesticides cross the placental barrier and reach a balanced state between mother and fetus.

  9. Organochlorine pesticide levels in umbilical cord blood of newborn in Veracruz, Mexico.

    Science.gov (United States)

    Herrero-Mercado, Margarita; Waliszewski, S M; Caba, M; Martínez-Valenzuela, C; Hernández-Chalate, F

    2010-10-01

    Organochlorine pesticides accumulate in lipid rich compartments of organisms. During pregnancy, the compounds pass through the placental barrier appear in cord blood. The aim of this study was to monitor the levels of organochlorine pesticides in 70 umbilical cord blood samples taken during deliveries in Veracruz in 2009. For organochlorine pesticides, only the presence β-HCH (4%, 3.9 μg/L median concentration on wet weight), pp'DDE (100%, 0.7 μg/L) and pp'DDT (4%, 1.4 μg/L) were detected. The total pool of samples divided according to sex of new born babies, showed no statistical differences among median concentrations. The number of deliveries considered as a determinant contamination factor affirmed there were no statistical differences among median concentrations; however pp'DDE levels increased from the one to two childbirth groups. Age of pregnant women as a discriminate factor manifests in a significant increase in contamination levels among first, second and third tertile. In general, umbilical cord blood samples in Veracruz contained organochlorine pesticides, especially pp'DDE, confirming the presence of these compounds in the environment and their transfer from the mother to the developing fetus.

  10. Evaluation of the quality of measurement of organochlorine contaminants in the marine environment: the QUASIMEME experience

    NARCIS (Netherlands)

    Wells, D.E.; Boer, de J.

    2006-01-01

    Organochlorine residues in marine environmental test materials have been included in QUASIMEME Laboratory Performance Studies since 1996. The methods of data assessment include the Cofino model, which provides a sound basis for obtaining a reliable assigned value from the wide range of data

  11. Is bone mineral composition disrupted by organochlorines in east Greenland polar bears (Ursus maritimus)?

    DEFF Research Database (Denmark)

    Sonne, Christian; Dietz, Rune; Born, Erik W

    2004-01-01

    We analyzed bone mineral density (BMD) in skulls of polar bears (Ursus maritimus) (n = 139) from East Greenland sampled during 1892-2002. Our primary goal was to detect possible changes in bone mineral content (osteopenia) due to elevated exposure to organochlorine [polychlorinated biphenyls (PCBs...

  12. Organochlorine pesticides in lacustrine sediments and tilapias of Metztitlan, Hidalgo, Mexico

    International Nuclear Information System (INIS)

    Fernandez-Bringas, Laura M.; Ponce-Velez, Guadalupe; Botello, Alfonso V.; Calva B, Laura G.; Salgado-Ugarte, Isaias Hazamamberth; Diaz Gonzalez, Gilberto

    2008-01-01

    The organochlorine pesticides (OP) are very stable molecules, due to this stability; they are very resistant in the environment and highly related to fat tissues with a wide diffusion property and an average time life higher than 10 years. Sediments were studied in November 2001, April and June 2002 and organisms collected in April and July 2002, from the lacustric zone of Metzitlan, Hidalgo, Mexico. The analysis was performed according to UNEP/IAEA (1982) (sediments) and UNEP/FAO/IOC/IAEA (1986) (organisms) methods. Three chemical families of organochlorine pesticides were identified and analyzed to determine possible toxicological risk. The principal organochlorine compounds found in sediments were γ-HCH, δ-HCH, p,p'-DDT and the endosulfan sulfate; these xenobiotics come from agriculture lands near the river and lake, used intensively, and most probably carried by the rain and rain flows into the main water body. The p,p'-DDD and δ-HCH were detected in the tilapias tissue. The average concentrations of organochlorine pesticides in sediments were within the international limits for freshwater benthic fauna, although lindane, γ-HCH, was near the limit. The fish was above the criteria established in the local legislation (NOM-027-SSA1-1993 y NOM-028-SSA1-1993). (author)

  13. Uptake of polychlorinated biphenyls and organochlorine pesticides from soil and air into radishes (Raphanus sativus)

    DEFF Research Database (Denmark)

    Mikes, Ondrej; Cupr, P.; Trapp, Stefan

    2009-01-01

    Uptake of organochlorine pesticides and polychlorinated biphenyls from soil and air into radishes was measured at a heavily contaminated field site. The highest contaminant concentrations were found for DDT and its metabolites, and for beta-hexachlorocyclohexane. Bioconcentration factor (BCF, def...

  14. RESEARCH OF HEAVY METALS, ORGANOCHLORINE AND ORGANOPHOSPHORUS PESTICIDES IN POWDERED INFANT FORMULA

    Directory of Open Access Journals (Sweden)

    M.C. Abete

    2009-02-01

    Full Text Available During the period between october 2007 and november 2008 were collected 60 samples of powdered infant formula. The analysis for the detection of heavy metals, organochlorine and organophosphorus pesticides show that the environmental situation is under control and powdered infant formula satisfies this health requisite.

  15. Chloride – a precursor in the formation of volatile organochlorines by forest plants?

    Czech Academy of Sciences Publication Activity Database

    Laturnus, F.; Matucha, Miroslav

    2008-01-01

    Roč. 99, č. 1 (2008), s. 119-125 ISSN 0265-931X R&D Projects: GA ČR GA526/05/0636 Institutional research plan: CEZ:AV0Z50380511 Keywords : 36Chloride * Volatile Organochlorines * VOCl Subject RIV: DF - Soil Science Impact factor: 1.114, year: 2008

  16. Determination of organochlorine pesticides in Indian coastal water using a moored in-situ sampler

    Digital Repository Service at National Institute of Oceanography (India)

    Sarkar, A.; SenGupta, R.

    An attempt has been made to determine the concentration of different organochlorine pesticides in the seawater off the central West Coast of India using an in-situ-sampler. The Seastar in-situ sampler is an instrument, which is designed to pump...

  17. Monitoring of organochlorine pesticide residue levels in adipose tissue of Veracruz, Mexico inhabitants.

    Science.gov (United States)

    Waliszewski, Stefan M; Caba, M; Herrero-Mercado, M; Saldariaga-Noreña, H; Meza, E; Zepeda, R; Martínez-Valenzuela, C; Infanzon, R; Hernández-Chalate, F

    2011-11-01

    The objective of the present study was to monitor the levels of organochlorine pesticides HCB, α-β-γ-HCH, pp'DDE, op'DDT and pp'DDT in 150 adipose tissue samples of Veracruz, Mexico inhabitants. In analyzed samples, the following pesticides were detected: p,p'-DDE in 100% of the samples at mean 1.643 mg/kg; p,p'-DDT in 99.3.% of the samples at mean 0.227 mg/kg; β-HCH in 97.3% of the samples at mean 0.063 mg/kg; and op'DDT in 93.3% of the samples at mean 0.022 mg/kg. Comparing mean, median and geometric mean concentrations of organochlorine pesticides shows a decrease in values from mean to median and to geometric mean which points out a prevalence of lower concentrations among the total samples and the existence of occasional cases of extreme exposure expressed in range values. The pooled samples divided according to sex, showed only significant differences of pp'DDE median concentrations between sexes. The other organochlorine pesticides indicated no statistical differences between sexes, including the pp'DDE/pp'DDT ratio. The samples grouped according to age, showed that the third tertile was more contaminated for both sexes, indicating age as a positively associated factor with organochlorine pesticide levels in adipose tissue of Veracruz inhabitants. Comparing organochlorine pesticide levels between 2008 and 2010 years, a decreased tendency for β-HCH, pp'DDE, Σ-DDT and pp'DDE/pp'DDT ratio levels was observed.

  18. Mixture for Controlling Insecticide-Resistant Malaria Vectors

    OpenAIRE

    Pennetier, Cédric; Costantini, Carlo; Corbel, Vincent; Licciardi, Séverine; Dabire, R. K.; Lapied, B.; Chandre, Fabrice; Hougard, Jean-Marc

    2008-01-01

    The spread of resistance to pyrethroids in the major Afrotropical malaria vectors Anopheles gambiae s.s. necessitates the development of new strategies to control resistant mosquito populations. To test the efficacy of nets treated with repellent and insecticide against susceptible and insecticide-resistant An. gambiae mosquito populations, we impregnated mosquito bed nets with an insect repellent mixed with a low dose of organophosphorous insecticide and tested them in a rice-growing area ne...

  19. Evaluation of the ecotoxicological impact of the organochlorine chlordecone on soil microbial community structure, abundance, and function.

    Science.gov (United States)

    Merlin, Chloé; Devers, Marion; Béguet, Jérémie; Boggio, Baptiste; Rouard, Nadine; Martin-Laurent, Fabrice

    2016-03-01

    The insecticide chlordecone applied for decades in banana plantations currently contaminates 20,000 ha of arable land in the French West Indies. Although the impact of various pesticides on soil microorganisms has been studied, chlordecone toxicity to the soil microbial community has never been assessed. We investigated in two different soils (sandy loam and silty loam) exposed to different concentrations of CLD (D0, control; D1 and D10, 1 and 10 times the agronomical dose) over different periods of time (3, 7, and 32 days): (i) the fate of chlordecone by measuring (14)C-chlordecone mass balance and (ii) the impact of chlordecone on microbial community structure, abundance, and function, using standardized methods (-A-RISA, taxon-specific quantitative PCR (qPCR), and (14)C-compounds mineralizing activity). Mineralization of (14)C-chlordecone was inferior below 1 % of initial (14)C-activity. Less than 2 % of (14)C-activity was retrieved from the water-soluble fraction, while most of it remained in the organic-solvent-extractable fraction (75 % of initial (14)C-activity). Only 23 % of the remaining (14)C-activity was measured in nonextractable fraction. The fate of chlordecone significantly differed between the two soils. The soluble and nonextractable fractions were significantly higher in sandy loam soil than in silty loam soil. All the measured microbiological parameters allowed discriminating statistically the two soils and showed a variation over time. The genetic structure of the bacterial community remained insensitive to chlordecone exposure in silty loam soil. In response to chlordecone exposure, the abundance of Gram-negative bacterial groups (β-, γ-Proteobacteria, Planctomycetes, and Bacteroidetes) was significantly modified only in sandy loam soil. The mineralization of (14)C-sodium acetate and (14)C-2,4-D was insensitive to chlordecone exposure in silty loam soil. However, mineralization of (14)C-sodium acetate was significantly reduced in soil

  20. Ecotoxicology of organochlorine chemicals in birds of the Great Lakes

    Science.gov (United States)

    Tillitt, Donald E.; Giesy, John P.

    2013-01-01

    Silent Spring was fulfilled in the United States with passage of environmental legislation such as the Clean Water Act, the Federal Insecticide, Fungicide, and Rodenticide Act, and the Toxic Substance Control Act in the 1970s. Carson's writings, television interviews, and testimony before Congress alerted a nation and the world to the unintended effects of persistent, bioaccumulative chemicals on populations of fish, wildlife, and possibly humans. Her writings in the popular press brought attention to scientific findings that declines in populations of a variety of birds were directly linked to the widespread use of dichlorodiphenyltrichloroethane (DDT) in agriculture, public health, and horticulture. By the 1970s, DDT and other persistent organic pollutants (POPs) were being banned or phased out, and the intent of these regulatory acts became apparent in a number of locations across the United States, including the Great Lakes. Concentrations of DDT and its major product of transformation, dichlorodiphenylchloroethane (DDE), were decreasing in top predators, such as bald eagles (Haliaeetus leucocephalus), osprey (Pandion haliaetus), colonial waterbirds, and other fish-eating wildlife. Eggshell thinning and the associated mortality of bird embryos caused by DDE had decreased in the Great Lakes and elsewhere by the early 1980s.

  1. Organochlorine pesticide levels in Clarias gariepinus from polluted freshwater impoundments in South Africa and associated human health risks

    CSIR Research Space (South Africa)

    Barnhoorn, IEJ

    2014-02-01

    Full Text Available There are increasing concerns regarding the safe human consumption of fish from polluted, freshwater impoundments. The aim of this study was to analyse the muscle tissue of the sharptooth catfish Clarias gariepinus for selected organo-chlorine...

  2. Sentinel California sea lions provide insight into legacy organochlorine exposure trends and their association with cancer and infectious disease

    Directory of Open Access Journals (Sweden)

    Nistara Randhawa

    2015-12-01

    Conclusion: Organochlorine contamination has significant associations with health outcomes in California sea lions, raising concerns for humans and other animals eating tainted seafood. While environmental exposure to these organochlorines appears to be decreasing over time based on levels in sea lion tissues, their persistence in the environment and food web for all predators, including humans, and the associated serious health risks, warrant monitoring, possibly through sentinel species like marine mammals.

  3. Polychlorinated biphenyls, organochlorine pesticides and polycyclic aromatic hydrocarbons in a one-off global survey of bivalves

    DEFF Research Database (Denmark)

    Vorkamp, Katrin; Strand, Jakob; Christensen, Jan H.

    2010-01-01

    During the Danish Galathea 3 expedition, bivalve samples were collected at the Faroe Islands, Greenland, Ghana, South Africa, Australia, Solomon Islands, New Zealand, Chile, US Virgin Islands, Boston, Newfoundland and Shetland Islands and analysed for organochlorines and PAHs. Concentration...... in terms of PCB and PAH levels, while other Greenland samples came closest to representing PAH background levels. Several locations had undetectable organochlorine levels, including Hobart and Chile, which had the lowest Sigma PAH concentrations (group the stations...

  4. Insecticides suppress natural enemies and increase pest damage in cabbage.

    Science.gov (United States)

    Bommarco, Riccardo; Miranda, Freddy; Bylund, Helena; Björkman, Christer

    2011-06-01

    Intensive use of pesticides is common and increasing despite a growing and historically well documented awareness of the costs and hazards. The benefits from pesticides of increased yields from sufficient pest control may be outweighed by developed resistance in pests and killing of beneficial natural enemies. Other negative effects are human health problems and lower prices because of consumers' desire to buy organic products. Few studies have examined these trade-offs in the field. Here, we demonstrate that Nicaraguan cabbage (Brassica spp.) farmers may suffer economically by using insecticides as they get more damage by the main pest diamondback moth, Plutella xylostella (L.) (Lepidoptera: Plutellidae), at the same time as they spend economic resources on insecticides. Replicated similarly sized cabbage fields cultivated in a standardized manner were either treated with insecticides according common practice or not treated with insecticides over two seasons. Fields treated with insecticides suffered, compared with nontreated fields, equal or, at least in some periods of the seasons, higher diamondback moth pest attacks. These fields also had increased leaf damage on the harvested cabbage heads. Weight and size of the heads were not affected. The farmers received the same price on the local market irrespective of insecticide use. Rates of parasitized diamondback moth were consistently lower in the treated fields. Negative effects of using insecticides against diamondback moth were found for the density of parasitoids and generalist predatory wasps, and tended to affect spiders negatively. The observed increased leaf damages in insecticide-treated fields may be a combined consequence of insecticide resistance in the pest, and of lower predation and parasitization rates from naturally occurring predators that are suppressed by the insecticide applications. The results indicate biological control as a viable and economic alternative pest management strategy

  5. Diagnostic Doses of Insecticides for Adult Aedes aegypti to Assess Insecticide Resistance in Cuba.

    Science.gov (United States)

    Rodríguez, María Magdalena; Crespo, Ariel; Hurtado, Daymi; Fuentes, Ilario; Rey, Jorge; Bisset, Juan Andrés

    2017-06-01

    The objective of this study was to determine diagnostic doses (DDs) of 5 insecticides for the Rockefeller susceptible strain of Aedes aegypti , using the Centers for Disease Control and Prevention (CDC) bottle bioassay as a tool for monitoring insecticide resistance in the Cuban vector control program. The 30-min DD values determined in this study were 13.5 μg/ml, 6.5 μg/ml, 6 μg/ml, 90.0 μg/ml, and 15.0 μg/ml for cypermethrin, deltamethrin, lambda-cyhalothrin, chlorpyrifos, and propoxur, respectively. To compare the reliability of CDC bottle bioassay with the World Health Organization susceptible test, 3 insecticide-resistant strains were evaluated for deltamethrin and lambda-cyhalothrin. Results showed that the bottles can be used effectively from 21 to 25 days after treatment and reused up to 4 times, depending on the storage time. The CDC bottle bioassay is an effective tool to assess insecticide resistance in field populations of Ae. aegypti in Cuba and can be incorporated into vector management programs using the diagnostic doses determined in this study.

  6. Emamectin benzoate: new insecticide against Helicoverpa armigera.

    Science.gov (United States)

    Fanigliulo, A; Sacchetti, M

    2008-01-01

    Emamectin benzoate is a new insecticide of Syngenta Crop Protection, with a new mechanism of action and a strong activity against Lepidoptera as well as with and a high selectivity on useful organisms. This molecule acts if swallowed and has some contact action. It penetrates leaf tissues (translaminar activity) and forms a reservoir within the leaf. The mechanism of action is unique in the panorama of insecticides. In facts, it inhibits muscle contraction, causing a continuous flow of chlorine ions in the GABA and H-Glutamate receptor sites. During 2006 and 2007, experimentation was performed by the Bioagritest test facility, according to EPPO guidelines and Principles of Good Experimental Practice (GEP), aiming at establishing the biological efficacy and the selectivity of Emamectin benzoate on industry tomato against Helicoverpa armigera (Lepidoptera: Noctuidoe). The study was performed in Tursi-Policoro (Matera), southern Italy. Experimental design consisted in random blocks, in 4 repetitions. A dosage of 1.5 Kg/ha of the formulate was compared with two commercial formulates: Spinosad 0.2 kg/ha (Laser, Dow Agrosciences Italia) and Indoxacarb 0.125 kg/ha (Steward EC insecticide, Dupont). Three foliage applications were applied every 8 days. The severity of damage induced by H. armigera was evaluated on fruits. Eventual phytotoxic effects were also evaluated. Climatic conditions were optimal for Lepidoptera development, so that the percentage of fruits attacked in 2007 at the first scouting was 68.28%. Emamectin benzoate has shown, in two years of testing, a high control of H. armigera if compared with the standards Indoxacarb and Spinosad. No effect of phytotoxicity was noticed on fruits.

  7. BACILLUS THURINGIENSIS ELASTASES WITH INSECTICIDE ACTIVITY

    Directory of Open Access Journals (Sweden)

    E. V. Matseliukh

    2015-10-01

    Full Text Available The purpose of the research was a screening of proteases with elastase activity among Bacillus thuringiensis strains, their isolation, partially purification, study of physicochemical properties and insecticide activity in relation to the larvae of the Colorado beetle. The objects of the investigation were 18 strains of B. thuringiensis, isolated from different sources: sea water, dry biological product "Bitoksibatsillin" and also from natural populations of Colorado beetles of the Crimea, Kherson, Odesa, Mykolaiv and Zaporizhiia regions of Ukraine. Purification of enzymes with elastase activity isolated from above mentioned strains was performed by gel-chromatography and insecticide activity was studied on the 3–4 larvae instar of Colorado beetle. The ability of a number of B. thuringiensis strains to synthesize the proteases with elastase activity has been established. The most active were enzymes obtained from strains IMV B-7465, IMV B-7324 isolated from sea water, and strains 9, 902, Bt-H and 0-239 isolated from Colorado beetles. The study of the physicochemical properties of the partially purified proteases of these strains showed that they belonged to enzymes of the serine type. Peptidases of a number of B. thuringiensis strains (IMV B-7324, IMV B-7465, 902, 0-239, 9 are metal-dependent enzymes. Optimal conditions of action of all tested enzymes are the neutral and alkaline рН values and the temperatures of 30–40 °С. The studies of influence of the complex enzyme preparations and partially purified ones of B. thuringiensis strains on the larvae instar of Colorado beetles indicated that enzymes with elastase activity could be responsible for insecticide action of the tested strains.

  8. Effectiveness and profitability of insecticide formulations used for ...

    African Journals Online (AJOL)

    To identify optimal pest control with lower economic risks to farmers, we investigated the effectiveness and profitability of different insecticides and insecticide formulations against bean fly (Ophiomyia spp.) and bean flower thrips (Megalurothrips sjostedtii). Two separate experiments were conducted during 2009 to 2012.

  9. Effects of insecticide spray application on insect pest infestation and ...

    African Journals Online (AJOL)

    USER

    2010-03-15

    Mar 15, 2010 ... This study provides information on the incidence of major insect pests of cowpea as well as the minimum insecticide control intervention necessary for effectively reducing cowpea yield losses on the field. Two insecticide spray regimes (once at flowering and podding) significantly reduced insect population ...

  10. Effects of insecticide spray application on insect pest infestation and ...

    African Journals Online (AJOL)

    Field studies were conducted during the 2008 - 2009 cropping season to determine the minimal insecticide application which can reduce cowpea yield losses on the field due to insect pest infestations in the Transkei region of South Africa. Treatments consisted of five cowpea varieties and four regimes of insecticide spray ...

  11. Design, Synthesis and Insecticidal Activities of Novel Phenyl Substituted Isoxazolecarboxamides

    Institute of Scientific and Technical Information of China (English)

    LIU Peng-fei; ZHANG Ji-feng; YAN Tao; XIONG Li-xia; LI Zheng-ming

    2012-01-01

    Thirteen novel phenyl substituted isoxazolecarboxamides were synthesized,and their structures were characterized by 1H NMR,elementary analysis and high-resolution mass spectrometry(HRMS) techniques.Their evaluated insecticidal activities against oriental armyworm(Mythimna separata) indicate that the phcnyl substituted isoxazolecarboxamides exhibited moderate insecticidal activities,among which compounds 9c and 9k showed comparatively higher activities.

  12. Mechanistic modeling of insecticide risks to breeding birds in ...

    Science.gov (United States)

    Insecticide usage in the United States is ubiquitous in urban, suburban, and rural environments. In evaluating data for an insecticide registration application and for registration review, scientists at the United States Environmental Protection Agency (USEPA) assess the fate of the insecticide and the risk the insecticide poses to the environment and non-target wildlife. At the present time, current USEPA risk assessments do not include population-level endpoints. In this paper, we present a new mechanistic model, which allows risk assessors to estimate the effects of insecticide exposure on the survival and seasonal productivity of birds known to use agricultural fields during their breeding season. The new model was created from two existing USEPA avian risk assessment models, the Terrestrial Investigation Model (TIM v.3.0) and the Markov Chain Nest Productivity model (MCnest). The integrated TIM/MCnest model has been applied to assess the relative risk of 12 insecticides used to control corn pests on a suite of 31 avian species known to use cornfields in midwestern agroecosystems. The 12 insecticides that were assessed in this study are all used to treat major pests of corn (corn root worm borer, cutworm, and armyworm). After running the integrated TIM/MCnest model, we found extensive differences in risk to birds among insecticides, with chlorpyrifos and malathion (organophosphates) generally posing the greatest risk, and bifenthrin and ë-cyhalothrin (

  13. Expression of melanin and insecticidal protein from Rhodotorula ...

    African Journals Online (AJOL)

    Both the salmon/red melanin and the insecticidal producing genes of Rhodotorula glutinis was successfully expressed in Escherichia coli using plasmid pZErO-1. This work suggests that in Rhodotorula species melanin and insecticidal toxin are co-expressed and therefore possibly co-evolved. Keywords: Rhodotorula ...

  14. Guide to testing insecticides on coniferous forest defoliators

    Science.gov (United States)

    Carroll B Jr. Williams; David A. Sharpnack; Liz Maxwell; Patrick J. Shea; Mark D. McGregor

    1985-01-01

    This report provides a guide to techniques for designing field tests of candidate insecticides, and for carrying out pilot tests and control projects. It describes experimental designs for testing hypotheses, and for sampling trees to estimate insect population densities and percent reduction after treatments. Directions for applying insecticides by aircraft and for...

  15. Biological efficacy of the ecotoxically favourable insecticides and ...

    African Journals Online (AJOL)

    Administrator

    2011-05-30

    May 30, 2011 ... different, studies done in natural conditions should be favored. Key words: Insecticides ... insecticide was applied on synthetic or natural food of the target insect ..... Pozsgay M, Fast P, Kaplan H, Carey PR (1987). The effect of ...

  16. Ecdysone Agonist: New Insecticides with Novel Mode of Action

    Directory of Open Access Journals (Sweden)

    Y. Andi Trisyono

    2002-12-01

    Full Text Available Development of insect resistance to insecticide has been the major driving force for the development of new insecticides. Awareness and demand from public for more environmentally friendly insecticides have contributed in shifting the trend from using broad spectrum to selective insecticides. As a result, scientists have looked for new target sites beyond the nervous system. Insect growth regulators (IGRs are more selective insecticides than conventional insecticides, and ecdysone agonists are the newest IGRs being commercialized, e.g. tebufenozide, methoxyfenozide, and halofenozide. Ecdysone agonists bind to the ecdysteroid receptors, and they act similarly to the molting hormone 20-hydroxyecdysone. The binding provides larvae or nymphs with a signal to enter a premature and lethal molting cycle. In addition, the ecdysone agonists cause a reduction in the number of eggs laid by female insects. The ecdysone agonists are being developed as selective biorational insecticides. Tebufenozide and methoxyfenozide are used to control lepidopteran insect pests, whereas halofenozide is being used to control coleopteran insect pests. Their selectivity is due to differences in the binding affinity between these compounds to the receptors in insects from different orders. The selectivity of these compounds makes them candidates to be used in combinations with other control strategies to develop integrated pest management programs in agricultural ecosystems. Key words: new insecticides, selectivity, ecdysone agonists

  17. Identification and cloning of two insecticidal protein genes from ...

    African Journals Online (AJOL)

    Bacillus thuringiensis (Bt) is the most widely applied type of microbial pesticide due to its high specificity and environmental safety. The activity of Bt is largely attributed to the insecticidal crystal protein encoded by the cry genes. Different insecticidal crystal proteins of Bt have different bioactivity against distinct agricultural ...

  18. Interactions of transgenic Bacillus thuringiensis insecticidal crops with spiders (Araneae)

    Science.gov (United States)

    Genetically modified crops expressing insecticidal proteins from Bacillus thuringiensis (Bt) have dramatically increased in acreage since their introduction in the mid-1990’s. Although the insecticidal mechanisms of Bt target specific pests, concerns persist regarding direct and indirect effects on...

  19. Conifer flavonoid compounds inhibit detoxification enzymes and synergize insecticides.

    Science.gov (United States)

    Wang, Zhiling; Zhao, Zhong; Cheng, Xiaofei; Liu, Suqi; Wei, Qin; Scott, Ian M

    2016-02-01

    Detoxification by glutathione S-transferases (GSTs) and esterases are important mechanisms associated with insecticide resistance. Discovery of novel GST and esterase inhibitors from phytochemicals could provide potential new insecticide synergists. Conifer tree species contain flavonoids, such as taxifolin, that inhibit in vitro GST activity. The objectives were to test the relative effectiveness of taxifolin as an enzyme inhibitor and as an insecticide synergist in combination with the organophosphorous insecticide, Guthion (50% azinphos-methyl), and the botanical insecticide, pyrethrum, using an insecticide-resistant Colorado potato beetle (CPB) Leptinotarsa decemlineata (Say) strain. Both taxifolin and its isomer, quercetin, increased the mortality of 1(st) instar CPB larvae after 48h when combined with Guthion, but not pyrethrum. Taxifolin had greater in vitro esterase inhibition compared with the commonly used esterase inhibitor, S, S, S-tributyl phosphorotrithioate (DEF). An in vivo esterase and GST inhibition effect after ingestion of taxifolin was measured, however DEF caused a greater suppression of esterase activity. This study demonstrated that flavonoid compounds have both in vitro and in vivo esterase inhibition, which is likely responsible for the insecticide synergism observed in insecticide-resistant CPB. Crown Copyright © 2015. Published by Elsevier Inc. All rights reserved.

  20. Botanical insecticides inspired by plant-herbivore chemical interactions.

    Science.gov (United States)

    Miresmailli, Saber; Isman, Murray B

    2014-01-01

    Plants have evolved a plethora of secondary chemicals to protect themselves against herbivores and pathogens, some of which have been used historically for pest management. The extraction methods used by industry render many phytochemicals ineffective as insecticides despite their bioactivity in the natural context. In this review, we examine how plants use their secondary chemicals in nature and compare this with how they are used as insecticides to understand why the efficacy of botanical insecticides can be so variable. If the commercial production of botanical insecticides is to become a viable pest management option, factors such as production cost, resource availability, and extraction and formulation techniques need be considered alongside innovative application technologies to ensure consistent efficacy of botanical insecticides. Copyright © 2013 Elsevier Ltd. All rights reserved.

  1. Ecotoxicological study of insecticide effects on arthropods in common bean.

    Science.gov (United States)

    de Barros, Emerson Cristi; Ventura, Hudson Vaner; Gontijo, Pablo Costa; Pereira, Renata Ramos; Picanço, Marcelo Coutinho

    2015-01-01

    Arthropods are an important group of macroorganisms that work to maintain ecosystem health. Despite the agricultural benefits of chemical control against arthropod pests, insecticides can cause environmental damage. We examined the effects of one and two applications of the insecticides chlorfenapyr (0.18 liters a.i. ha-1) and methamidophos (0.45 liters a.i. ha-1), both independently and in combination, on arthropods in plots of common bean. The experiment was repeated for two growing seasons. Principal response curve, richness estimator, and Shannon-Wiener diversity index analyses were performed. The insecticides generally affected the frequency, richness, diversity, and relative abundance of the arthropods. In addition, the arthropods did not experience recovery after the insecticide applications. The results suggest that the insecticide impacts were sufficiently drastic to eliminate many taxa from the studied common bean plots. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.

  2. An Operational Framework for Insecticide Resistance Management Planning.

    Science.gov (United States)

    Chanda, Emmanuel; Thomsen, Edward K; Musapa, Mulenga; Kamuliwo, Mulakwa; Brogdon, William G; Norris, Douglas E; Masaninga, Freddie; Wirtz, Robert; Sikaala, Chadwick H; Muleba, Mbanga; Craig, Allen; Govere, John M; Ranson, Hilary; Hemingway, Janet; Seyoum, Aklilu; Macdonald, Michael B; Coleman, Michael

    2016-05-01

    Arthropod vectors transmit organisms that cause many emerging and reemerging diseases, and their control is reliant mainly on the use of chemical insecticides. Only a few classes of insecticides are available for public health use, and the increased spread of insecticide resistance is a major threat to sustainable disease control. The primary strategy for mitigating the detrimental effects of insecticide resistance is the development of an insecticide resistance management plan. However, few examples exist to show how to implement such plans programmatically. We describe the formulation and implementation of a resistance management plan for mosquito vectors of human disease in Zambia. We also discuss challenges, steps taken to address the challenges, and directions for the future.

  3. Organochlorine pesticides in sediment and biological samples from the coastal lagoons of Nicaragua

    International Nuclear Information System (INIS)

    Montenegro, S.; Lacayo, M.; Picado, F.; Lopez, A.

    1999-01-01

    A study was carried out on the Pacific coast of Nicaragua to investigate the contamination of the coastal lagoons with residues of agricultural pesticides. Samples were taken during 1995 from the areas of Estero Real, Padre Ramos, Maderas Negras, Naranjo and Paso Caballos, and during 1996 from Aposentillo to Estero Barquito - Posoltega River. Analysis of the samples of sediment and aquatic life (fishes, oysters and bivalves) showed that they were contaminated with organochlorine pesticides. The pesticides found in the highest concentrations were toxaphene (1,734 μg.kg -1 ) and p,p-DDE (275 μg kg -1 ). These data indicate widespread contamination of the ecosystem with organochlorine pesticides in the main Pacific coastal lagoons of Nicaragua, resulting from intensive agricultural use of pesticides during the past decades. The contamination has been carried from the agricultural areas to the coastal lagoons by the rivers passing through the cultivated areas. (author)

  4. Investigation of organochlorine pesticide residues in samples of 40 nursing mothers residing in Tehran

    Directory of Open Access Journals (Sweden)

    Afshar M

    1997-09-01

    Full Text Available Organochlorine pesticides are a group of persistant compounds which have been used for a long time. Due to their stability, some of them such as DDT, BHC and their derivatives are still used in the areas with malaria epidemic condition, hence the chance of food contamination always exists. The present survey demonstrated that human milk is one of the best indicator substances in monitoring the environment and human body contamination by organochlorine compounds. We studied the level of residues in the milk of nursing mothers who could be exposed to these compounds through food chain in their contaminated environment. In this investigation, we collected 40 samples from the nursing mothers of two hospitals located in the north and south of Tehran. Detection was carried out by Gas chromatography (GC with 3% OV17 column and Ni63 ECD (Electron Capture Detector. Reference substances were obtained from WHO. Results are discussed in the text.

  5. A cross-taxa survey of organochlorine pesticide contamination in a Costa Rican wildland

    Energy Technology Data Exchange (ETDEWEB)

    Klemens, J.A.; Wieland, M.L.; Flanagin, V.J.; Frick, J.A.; Harper, R.G

    2003-04-01

    Amphibians, turtles, mice and birds from a protected Costa Rican wildland were contaminated with organochlorine pesticides and metabolites. - Amphibians, turtles, birds (mostly passerines) and mice collected from a conservation area in northwestern Costa Rica were analyzed for organochlorine (OC) pesticide contamination. Six of 39 amphibians (three of eight species), three of six turtles (two species), one of eight mice (one species) and 19 of 55 birds (five of seven species) contained OCs at levels up to 580 ng/g. The most frequently detected compound in 23 of 108 organisms was p,p'DDE. Dieldrin, delta-BHC, heptachlor, p,p'DDD, and endosulfan II were each found in at least four organisms, while eight other OCs were found in at least one organism. The presence of OCs in taxa from the conservation area indicates the likelihood of long-distance transport of such compounds through the atmosphere.

  6. CYP polymorphisms and pathological conditions related to chronic exposure to organochlorine pesticides

    Directory of Open Access Journals (Sweden)

    Anca Oana Docea

    Full Text Available The association between genetic variations in the cytochrome P450 (CYP family genes and pathological conditions related to long-term exposure to organochlorine compounds (OCs deserves further elucidation. OCs are persistent organic pollutants with bioaccumulative and lipophilic characteristics. They can act as endocrine disruptors and perturb cellular mechanisms. Prolonged exposure to OCs has been associated with different pathological manifestations. CYP genes are responsible for transcribing enzymes essential in xenobiotic metabolism. Therefore, polymorphisms in these genetic sequences a. alter the metabolic pathways, b. induce false cellular responses, and c. may provoke pathological conditions. The main aim of this review is to define the interaction between parameters a, b and c at a mechanistic/molecular level, with references in clinical cases. Keywords: Organochlorine compounds, Cytochrome P450, Genetic polymorphisms, Pathogenesis, Environmental pollutants

  7. Residues, Sources and Potential Biological Risk of Organochlorine Pesticides in Surface Sediments of Qiandao Lake, China.

    Science.gov (United States)

    Yang, Huayun; Zhou, Shanshan; Li, Weidong; Liu, Qi; Tu, Yunjie

    2015-10-01

    Sediment samples were analyzed to comprehensively characterize the concentrations, distribution, possible sources and potential biological risk of organochlorine pesticides in Qiandao Lake, China. Concentrations of sumHCH and sumDDT in sediments ranged from 0.03 to 5.75 ng/g dry weight and not detected to 14.39 ng/g dry weight. The predominant β-HCH and the α-HCH/γ-HCH ratios indicated that the residues of HCHs were derived not only from historical technical HCH use but also from additional usage of lindane. Ratios of o,p'-DDT/p,p'-DDT and DDD/DDE suggested that both dicofol-type DDT and technical DDT applications may be present in most study areas. Additionally, based on two sediment quality guidelines, γ-HCH, o,p'-DDT and p,p'-DDT could be the main organochlorine pesticides species of ecotoxicological concern in Qiandao Lake.

  8. Organochlorine compounds and the biogeochemical cycle of chlorine in soils: A review

    Science.gov (United States)

    Vodyanitskii, Yu. N.; Makarov, M. I.

    2017-09-01

    Chloride ions in soil may interact with soil organic matter and form organochlorine compounds in situ. The biotic chlorination of soil organic substances takes places under aerobic conditions with participation of H2O2 forming from peroxidases released by soil microorganisms (in particular, by microscopic fungi). The abiotic chlorination results also from the redox reactions with the participation of Fe3+/Fe2+ system, but it develops several times slower. Chlorination of soil organic substances is favored by Cl- coming to soil both from natural (salinized soil-forming rocks and groundwater, sea salt) and anthropogenic sources of chlorides, i.e., spills of saline water at oil production, road deicing chemicals, mineral fertilizers, etc. The study of the biogeochemical chlorine cycle should take into account the presence of organochlorine compounds in soils, in addition to transformation and migration of chloride ions.

  9. Prenatal exposure to persistent organochlorine pollutants and female reproductive function in young adulthood

    DEFF Research Database (Denmark)

    Kristensen, Susanne Lund; Ramlau-Hansen, Cecilia Høst; Ernst, Erik

    2016-01-01

    . OBJECTIVES: To investigate effects on female reproduction following intrauterine exposure to selected biopersistent organochlorines. METHODS: We used data from a Danish pregnancy cohort with follow-up on 436 eligible daughters at approximately 20years of age. Information on age of menarche (n=335), menstrual...... cycle length (n=230) and serum concentrations of reproductive hormones (n=243) was obtained. Number of antral follicles was counted by vaginal ultrasound (n=147). Of 244 daughters who attended clinical examination, 170 used hormonal contraceptives and 74 were non-users. Concentrations of p,p'-DDE, HCB...... and six PCB congeners were analysed in maternal serum samples obtained in pregnancy week 30. RESULTS: Age of menarche and menstrual cycle length were found not to be statistically significant associated with prenatal organochlorine exposure. Among non-users of hormonal contraceptives with information...

  10. Geochemical distribution of trace metals and organochlorine contaminants of a lake ontario shoreline marsh

    Energy Technology Data Exchange (ETDEWEB)

    Glooschenko, W A; Capocianco, J; Coburn, J; Glooschenko, V

    1981-02-01

    Rattray Marsh, an 8 ha marsh on the Lake Ontario shoreline at Mississauga, Ontario, is an important local habitat for waterfowl and shorebirds during spring and fall migration. A study was conducted to determine the distribution of nutrients (carbon, nitrogen, and phosphorus) and potential trace metal and organochlorine pollutants in the marsh as evidenced by the sedimentary concentrations of these compounds. Generally, copper, zinc, lead, and mercury were higher in concentration in local soils than in Lake Ontario sediments. Metals and organic carbon levels did not correlate, and the metals appeared to be associated with silts and clays. Organochlorine contaminants include p,p1-DDE, p,p1-DDD, p,p1-DDT, alpha-chlordane, PCB, mirex, and HCB.

  11. Review Article. Organochlorine pesticides, their toxic effects on living organisms and their fate in the environment

    Directory of Open Access Journals (Sweden)

    Jayaraj Ravindran

    2016-12-01

    Full Text Available Organochlorine (OC pesticides are synthetic pesticides widely used all over the world. They belong to the group of chlorinated hydrocarbon derivatives, which have vast application in the chemical industry and in agriculture. These compounds are known for their high toxicity, slow degradation and bioaccumulation. Even though many of the compounds which belong to OC were banned in developed countries, the use of these agents has been rising. This concerns particularly abuse of these chemicals which is in practice across the continents. Though pesticides have been developed with the concept of target organism toxicity, often non-target species are affected badly by their application. The purpose of this review is to list the major classes of pesticides, to understand organochlorine pesticides based on their activity and persistence, and also to understand their biochemical toxicity.

  12. Organochlorine Pesticides (OCs) and Polychlorinated Biphenyls (PCBs) in Tilapia zillii from Lake El-Manzala, Egypt

    International Nuclear Information System (INIS)

    El-Greisy, Zeinab Abdalbagi; Abdallah, A. Mohamed Ali

    2005-01-01

    A fresh water fish species, (Tilapia zillii) from Lake El-Manzala was analyzed for concentrations of several Organochlorine pesticides (OCs) and Polychlorine piphenyl's (PCBs) in liver, gonads, mesenteric fat, flesh and the digestive tract in mature fish during the breeding season. Polychlorinated piphenyls (PCBs) and Organochloripe pesticides (OCs) were calculated in (ng/g) dry weight (dw) in homogenized samples. The obtained results revealed differences in lipid content between these different organs. The females showed higher lipid content than males. There was significant positive correlation the lipid content and organochlorines and polychlorinated biphenyls (PCBs). The results come concomitant with the lipophilicity of studied compounds. However, the recoded concentration of these studied pollutants still does not exceed international hazardous levels. (author)

  13. Persistent organochlorine residues and toxic evaluation of polychlorinated biphenyls in sharks from the Mediterranean Sea (Italy)

    Energy Technology Data Exchange (ETDEWEB)

    Storelli, M.M.; Marcotrigiano, G.O. [Bari Univ., Dip. Farmaco-Biologico, Bari (Italy)

    2001-07-01

    Persistent organochlorines such as polychlorinated biphenyls including coplanar congeners, DDT compounds and HCB were measured in different tissues (muscle, liver and eggs) of two Mediterranean shark species: namely Centrophorus granulosus and Squalus blainvillei. The concentrations of organochlorines in the tissues and organs of both species were in the order DDTs>PCBs>HCB. The highest values of DDTs, PCBs and HCB were found in liver followed by eggs and muscle. Among DDTs the compound found in greatest concentration was p,p -DDE. The PCB profiles were dominated by congeners 138, 153, and 180. The isomers with higher TEQs values were non- and mono-ortho congeners than di-ortho ones in muscle, liver and eggs of both species. Among the non-ortho, PCB 126 was the major contributing individual to the total TEQs in both species. (Author)

  14. A cross-taxa survey of organochlorine pesticide contamination in a Costa Rican wildland

    International Nuclear Information System (INIS)

    Klemens, J.A.; Wieland, M.L.; Flanagin, V.J.; Frick, J.A.; Harper, R.G.

    2003-01-01

    Amphibians, turtles, mice and birds from a protected Costa Rican wildland were contaminated with organochlorine pesticides and metabolites. - Amphibians, turtles, birds (mostly passerines) and mice collected from a conservation area in northwestern Costa Rica were analyzed for organochlorine (OC) pesticide contamination. Six of 39 amphibians (three of eight species), three of six turtles (two species), one of eight mice (one species) and 19 of 55 birds (five of seven species) contained OCs at levels up to 580 ng/g. The most frequently detected compound in 23 of 108 organisms was p,p'DDE. Dieldrin, delta-BHC, heptachlor, p,p'DDD, and endosulfan II were each found in at least four organisms, while eight other OCs were found in at least one organism. The presence of OCs in taxa from the conservation area indicates the likelihood of long-distance transport of such compounds through the atmosphere

  15. Preparation of reference material for organochlorine pesticides in a herbal matrix.

    Science.gov (United States)

    Wong, Yiu Chung; Wong, Siu Kay; Kam, Tat Ting

    2008-12-01

    The development of reference material for four organochlorine pesticides, namely hexachlorobenzene and three isomers of hexachlorocyclohexane (alpha-hexachlorocyclohexane, beta-hexachlorocyclohexane and gamma-hexachlorocyclohexane), in a ginseng root sample is presented. Raw materials (Panax ginseng) were purchased from a local market and confirmed to contain certain levels of incurred organochlorine pesticide residues by a validated gas chromatography-mass selective detection method. A total of more than 300 bottles each containing 25 g of samples were prepared after the materials had been freeze-dried, milled and thoroughly mixed. The homogeneity and stability of samples from randomly selected bottles were verified and the reference values were characterized using a highly precise isotope dilution gas chromatography-mass spectrometry (ID-GCMS) method that was recently developed by our laboratory. The purity of standard organochlorine chemicals was determined against certified reference materials to establish the accuracy of the ID-GCMS analysis. The concentrations (+/- expanded uncertainty) of hexachlorobenzene, alpha-hexachlorocyclohexane, beta-hexachlorocyclohexane and gamma-hexachlorocyclohexane in the reference material were 0.198 +/- 0.015, 0.450 +/- 0.022, 0.213 +/- 0.011 and 0.370 +/- 0.032 mg kg(-1), respectively. A portion (70 bottles) of the samples was also used in a proficiency testing (PT) scheme for assessing the testing capabilities of field laboratories. The consensus mean values of the PT obtained from the 70 participants were on the same order but deviated by -2.7 to -14.1% from those of the assigned reference values. Because of the wide spread of participants' data (relative standard deviation ranging from 44 to 56%), the PT results were not included in the calculation of the assigned values of the reference materials. The materials served as suitable reference materials to ascertain the quality control and validation processes for the

  16. Persistent organochlorines in high-Antarctic fish; Persistente chlororganische Verbindungen in hochantarktischen Fischen

    Energy Technology Data Exchange (ETDEWEB)

    Zimmermann, S.

    1997-11-01

    24 chlorinated hydrocarbons from different classes (PCB, HCH, DDT, Chlordane, Hexachlorobenzene and Octachlorostyrene) were analyzed in four species of high-Antarctic fish (Aethotaxis mitopteryx, Pleuragramma antarcticum, Trematomus lepidorhinus, and Chinodraco myersi). The concentrations were in the order of 1 {mu}g/kg wet weight or 10 {mu}g/kg lipid weight, respectively. Highest concentrations were measured for HCB in all species. The species showed different distribution patterns for the organochlorines studied. Compared with concentrations in fish from other regions the organochlorine levels measured in Antarctic fish are rather low. It is unlikely that the burden of organochlorines will cause any toxic effects in high-Antarctic fish yet. Nevertheless, with regard to the sensitive Antarctic ecosystem, even small concentrations carry a high risk of harm for Antarctic life. Environmental pollution in Antarctica should be observed with a monitoring program using standardized methods. For this purpose, the fish species studied are very useful as bioindicators for organochlorine contamination. (orig.) [Deutsch] 24 persistente Chlorkohlenwasserstoffe verschiedener Schadstoffgruppen (PCB, HCH, DDT, Chlordan, Hexachlorbenzol und Octachlorstyrol) wurden in vier hochantarktischen Fischarten (Aethotaxis mitopteryx, Pleuragramma antarcticum, Trematomus lepidorhinus und Chionodraco myersi). Die Konzentrationen der nachgewiesenen Schadstoffe im Ganzfisch liegen jeweils in der Groessenordnung von 1 {mu}g/kg Feuchtgewicht bzw. 10 {mu}g/kg Lipidgewicht mit erheblichen Schwankungen je nach Schadstoff und Art. Die Spezies zeigen artspezifische Schadstoffverteilungsmuster. Die Konzentrationen sind gegenueber denen in Fischen aus Gebieten mit staerkerem zivilisatorischem Einfluss eher niedrig. Die Fremstoffbelastungen der hochantarktischen Fische fuehren wahrscheinlich noch nicht zu messbaren toxischen Effekten bei den Fischen. Dennoch geht von den Schadstoffen in Hinblick auf das

  17. Organochlorine pesticide residue levels in blood serum of inhabitants from Veracruz, Mexico.

    Science.gov (United States)

    Waliszewski, Stefan M; Caba, M; Herrero-Mercado, M; Saldariaga-Noreña, H; Meza, E; Zepeda, R; Martínez-Valenzuela, C; Gómez Arroyo, S; Villalobos Pietrini, R

    2012-09-01

    The objective of the present study was to monitor the levels of organochlorine pesticides HCB; α-, β-, γ-HCH; pp'DDE; op'DDT; and pp'DDT in blood serum of Veracruz, Mexico inhabitants. Organochlorine pesticides were analyzed in 150 blood serum samples that constituted that which remained after clinical analyses, using gas chromatography-electron-capture detection (GC-ECD). The results were expressed as milligrams per kilogram on fat basis and micrograms per liter on wet weight. Only the following pesticides were detected: p,p'-DDE was the major organochlorine component, detected in 100% of samples at mean 15.8 mg/kg and 8.4 μg/L; p,p'-DDT was presented in 41.3.% of monitored samples at mean 3.1 mg/kg and 1.4 μg/L; β-HCH was found in 48.6% of the samples at mean 4.9 mg/kg and 2.7 μg/L; op'DDT was determined to be in only 3.3% of monitored samples at mean 2.7 mg/kg and 1.4 μg/L. The pooled samples divided according to sex showed significant differences of β-HCH and pp'DDE concentrations in females. The samples grouped according to age presented the third tertile as more contaminated in both sexes, indicating age as a positively associated factor with serum organochlorine pesticide levels in Veracruz inhabitants.

  18. Organochlorines and heavy metals in pregnant women from the Disko Bay area in Greenland

    DEFF Research Database (Denmark)

    Bjerregaard, P; Hansen, J C

    2000-01-01

    Recent studies from Greenland and the Canadian Arctic have shown high concentrations of heavy metals, such as mercury, and organochlorines in the blood and fatty tissue of the Inuit. This is attributed in particular to their high consumption of the meat and blubber of marine mammals. In the present...... systems but the high concentrations of pollutants have so far not been shown to influence health in Greenland....

  19. Organochlorine pesticide residues in human breast milk and placenta in Tohoku, Japan

    Energy Technology Data Exchange (ETDEWEB)

    Nakai, K.; Suzuki, K.; Oka, T.; Sugawara, N.; Ohba, T.; Kameo, S.; Satoh, H. [Environmental Heath Sciences, Tohoku Univ. Graduate School of Medicine, Sendai (Japan); Nakamura, T.; Saitoh, Y. [Miyagi Prefectural Inst. of Piblic Health and Environment (Japan); Okamura, K. [Dept. of Obstetrics, Tohoku Univ. Graduate School of Medicine, Sendai (Japan)

    2004-09-15

    Recently, we have started a birth cohort study to examine the effects of exposure to persistent organochemical pollutants and heavy metals on neurodevelopment in Japanese children, The Tohoku Study of Child Development. In this cohort study, biological samples, including maternal peripheral blood, cord blood, placenta, cord tissue, and breast milk have been collected from more than six hundred mother-infant pairs for chemical determinations. The growth of infants has been monitored using neurodevelopmental tests, including the Brazelton Neonatal Behavioral Assessment Scale, the Bayley Scale of Infant Development, the Kyoto Scale of Psychological Development, and others. Exposures to dioxin and related compounds, polychlorinated biphenyls, methylmercury, and several heavy metals were assessed. Additionally, since perinatal exposure to organochlorine pesticides may affect the neurodevelopment of children, we examined the effects of those pesticides in the cohort study. In the present study, several organochlorine pesticides were analyzed in human breast milk and placenta from 20 mothers to identify the major pesticide compounds found in the cohort subjects. The relationship between pesticides in breast milk and the placenta was analyzed to examine the utilization of the placenta as the material for exposure assessment. Some information regarding the factors affecting the contamination of breast milk and the placenta with organochlorine pesticides are also discussed.

  20. Vertical distribution of organochlorine pesticides in humus along Alpine altitudinal profiles in relation to ambiental parameters

    Energy Technology Data Exchange (ETDEWEB)

    Kirchner, M., E-mail: kirchner@helmholtz-muenchen.d [Helmholtz Zentrum Muenchen, GmbH, Institutes of Ecological Chemistry, Developmental Genetics and Soil Ecology, Ingolstaedter Landstrasse 1, D-85764 Neuherberg (Germany); Faus-Kessler, T.; Jakobi, G.; Levy, W.; Henkelmann, B.; Bernhoeft, S.; Kotalik, J.; Zsolnay, A. [Helmholtz Zentrum Muenchen, GmbH, Institutes of Ecological Chemistry, Developmental Genetics and Soil Ecology, Ingolstaedter Landstrasse 1, D-85764 Neuherberg (Germany); Bassan, R. [Regional Agency for Environmental Prevention and Protection of Veneto (Italy); Belis, C. [Regional Agency for Environmental Protection of Lombardy (Italy); Kraeuchi, N. [Swiss Federal Institute for Forest, Snow and Landscape Research (Switzerland); Moche, W. [Federal Environment Agency Ltd. (Austria); Simoncic, P. [Slovenian Forestry Institute (Slovenia); Uhl, M.; Weiss, P. [Federal Environment Agency Ltd. (Austria); Schramm, K.-W. [Helmholtz Zentrum Muenchen, GmbH, Institutes of Ecological Chemistry, Developmental Genetics and Soil Ecology, Ingolstaedter Landstrasse 1, D-85764 Neuherberg (Germany)

    2009-12-15

    In forest soils along vertical profiles located in different parts of the Alps, concentrations of persistent organic pollutants (POPs), namely organochlorine pesticides (OCPs) like dichlorodiphenyltrichloroethanes (DDTs), hexachlorobenzene (HCB), hexachlorocyclohexanes (HCH), heptachlor, aldrin, dieldrin and mirex, were measured. Though local characteristics of the sites are influenced by numerous factors like orographic and meteorological parameters, forest stand characteristics and humus parameters, we ascertained a marked vertical increase of concentrations of some organochlorine compounds in the soil. On the basis of climatological values of each site, we found that the contamination increase with altitude can be ascribed to a certain 'cold condensation effect'. In addition, the perennial atmospheric deposition of POPs is controlled by precipitation. Other key parameters explaining the accumulation of POPs are the soil organic carbon stocks, the turnover times, the re-volatilisation and degradation processes, which vary with altitude. - Caused by temperature-dependent processes regarding deposition, re-volatilization and decomposition of POPs, the concentration of organochlorine pesticides varies in the Alpine region with altitude.

  1. Organochlorine Pesticides in the Ferruginous Pygmy Owl (Glaucidium brasilianum) in Chiapas, Mexico.

    Science.gov (United States)

    Arrona-Rivera, Alicia E; Enríquez, Paula L; García-Feria, Luis M; Orellana, Sergio Alvarado; von Osten, Jaime Rendón

    2016-09-01

    Concentrations of organochlorine pesticides were quantified in samples of feathers (n = 17) and blood (n = 15) of the ferruginous pygmy owl (Glaucidium brasilianum). The individuals were captured near the Protected Natural Area Cerro Sonsonate, Chiapas, Mexico, between February and June 2014. In both tissues, pesticides belonging to seven organochlorine chemical families were detected. However, the organochlorine pesticide concentrations differed between feathers and blood. The highest concentrations of hexachlorocyclohexanes were found in feathers (0.63 ± 0.89 μg/g), whereas the highest concentrations of ΣDrines were found in blood (0.31 ± 0.47 μg/mL). By using the summed concentrations for each of the seven families of pesticides found in feathers, we did not find any significant correlation between the pesticides and pectoral muscle or body weight (p > 0.15). The ΣDDT group was the only pesticide family that showed a positive correlation with owl body weight (r = 0.60, p = 0.05); the concentrations of these pesticides were also high in feather and blood tissues (r = 0.87, p = 0.02). Our results confirm that ferruginous pygmy owls in the study area are exposed to these pesticides.

  2. Organochlorine pesticide distribution in an organic production system for cow's milk in Chiapas, Mexico.

    Science.gov (United States)

    Murga, María N; Gutiérrez, Rey; Vega, Salvador; Pérez, José J; Ortiz, Rutilio; Schettino, Beatriz; Yamasaki, Alberto; Ruíz, Jorge L

    2016-09-01

    The objective of this study was to evaluate the presence of organochlorine pesticides in samples of forage, soil, water, and milk in four units of an organic production system for cow´s milk (samples of forage, milk, soil, and water) in Tecpatan, Chiapas, Mexico. The organochlorine pesticides were extracted from forage, soil and water based on the USEPA (2005) guideline and from milk based on the IDF 1991 guideline. The pesticides were identified and quantified by gas chromatography with electron capture detector (CG-ECD). In general, the highest average concentration of total pesticides was found in the samples of milk and forage (311 ± 328 and 116.5 ±77 ng g(-1) respectively). Although, the production systems analyzed are organic, organochlorine pesticides were detected in all environmental samples (forage, soil, water, and organic milk). Although no values surpassed the defined limits of Mexican and International regulation it is advisable that a monitoring program of contaminants in these production systems is continued.

  3. Polychlorinated biphenyls and organochlorine pesticides in various bird species from northern China

    International Nuclear Information System (INIS)

    Chen Da; Zhang Xiulan; Mai Bixian; Sun Quanhui; Song Jie; Luo Xiaojun; Zeng, Eddy Y.; Hale, Robert C.

    2009-01-01

    Little data are available on organochlorine contamination in Chinese terrestrial birds of prey. This study examined the presence of PCBs, DDTs and other organochlorine pesticides in various raptors from northern China. DDE exhibited the highest concentrations among targeted compounds. Greatest levels (23.5-1020 mg/kg lipid weight) were observed in Eurasian sparrowhawks. This may be due to their stopover in southeastern China, where high DDT and dicofol applications have been documented. Residential kestrels exhibited much lower DDE, but similar PCB and HCH concentrations. ΣTEQs and PCB-126/-77 concentration ratios exhibited significant positive correlations with ΣPCB concentrations, respectively. Similar results were also demonstrated by a meta-analysis of previously published data across avian species. Possible hepatic sequestration of coplanar PCB-77, -126, -169 and -118 was observed as liver TEQs increased in Eurasian sparrowhawks. These observations may indicate an induction of CYP1A enzymes, as a result of elevated contamination in some species. - Substantial bioaccumulation of organochlorine contaminants may cause toxic effects (i.e., an induction of Cytochrome P450 enzymes) in birds of prey from the northern China.

  4. Polychlorinated biphenyls and organochlorine pesticides in various bird species from northern China

    Energy Technology Data Exchange (ETDEWEB)

    Chen Da [Department of Environmental and Aquatic Animal Health, Virginia Institute of Marine Science, College of William and Mary, 1208 Greate Road, Gloucester Point, VA 23062 (United States); Zhang Xiulan; Mai Bixian [State Key Laboratory of Organic Chemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou 510640 (China); Sun Quanhui [Beijing Raptor Rescue Center, International Fund for Animal Welfare, Beijing 100875 (China); Song Jie [Key Laboratory for Biodiversity Science and Ecological Engineering, College of Life Sciences, Beijing Normal University, Beijing 100875 (China); Luo Xiaojun; Zeng, Eddy Y. [State Key Laboratory of Organic Chemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou 510640 (China); Hale, Robert C., E-mail: hale@vims.ed [Department of Environmental and Aquatic Animal Health, Virginia Institute of Marine Science, College of William and Mary, 1208 Greate Road, Gloucester Point, VA 23062 (United States)

    2009-07-15

    Little data are available on organochlorine contamination in Chinese terrestrial birds of prey. This study examined the presence of PCBs, DDTs and other organochlorine pesticides in various raptors from northern China. DDE exhibited the highest concentrations among targeted compounds. Greatest levels (23.5-1020 mg/kg lipid weight) were observed in Eurasian sparrowhawks. This may be due to their stopover in southeastern China, where high DDT and dicofol applications have been documented. Residential kestrels exhibited much lower DDE, but similar PCB and HCH concentrations. SIGMATEQs and PCB-126/-77 concentration ratios exhibited significant positive correlations with SIGMAPCB concentrations, respectively. Similar results were also demonstrated by a meta-analysis of previously published data across avian species. Possible hepatic sequestration of coplanar PCB-77, -126, -169 and -118 was observed as liver TEQs increased in Eurasian sparrowhawks. These observations may indicate an induction of CYP1A enzymes, as a result of elevated contamination in some species. - Substantial bioaccumulation of organochlorine contaminants may cause toxic effects (i.e., an induction of Cytochrome P450 enzymes) in birds of prey from the northern China.

  5. Organochlorine pollutants in small cetaceans from the Pacific and south Atlantic Oceans, November 1968-June 1976

    Energy Technology Data Exchange (ETDEWEB)

    O' Shea, T.J.; Brownell, R.L. Jr.; Clark, D.R. Jr.; Walker, W.A.; Gay, M.L.; Lamont, T.G.

    1980-09-01

    Organochlorine residues were analyzed in blubber, brain, or muscle tissues of 69 individuals representing 10 species of small cetaceans. Collections were made from November 1968 through June 1976 at localities in the Eastern Tropical Pacific and along the coasts of California, Hawaii, Japan, and Uruguay, Relations of residue concentrations between tissues are described for DDE and PCBs in two dolphin species. sigma DDT and PCB residues in blubber of most of the 19 individuals of the five southern California species sampled exceed concentrations that are associated with reproductive impairment in pinnipeds, although the nature of such associations is not well defined. The sigma DDT residue of 2,695 ppm in blubber of one California coastal Tursiops truncatus is one of the highest concentrations reported in tissues of members of any population of wild mammals. Except for one rough-toothed dolphin (Steno bredanensis) from Maui, Hawaii, all individuals from all localities surveyed were contaminated with organochlorine compounds. Seventeen different organochlorines were detected; greatest diversity occurred near Japan and California. This is the first report of several of these compounds in tissues of any species of marine mammals. The o,p'-isomers and metabolites of DDT were detected unusually frequently. Ratios of p,p'-DDT to p,p'-DDE in blubber of cetaceans from waters off countries where use of this pesticide has been relatively recent and ongoing were at least an order of magnitude higher than in cetaceans from United States waters.

  6. Concentrations of organochlorine pesticides and 2,4,6-trichloroanisole in cork bark.

    Science.gov (United States)

    Olivella, M Àngels; Caixach, Josep; Planas, Carles; Oliveras, Anna; Jové, Patrícia

    2012-02-01

    Organochlorine pesticides are persistent lipophilic organic pollutants and tend to accumulate in growing plants. During growth, cork is in contact with the open air for long periods (9-12 years). Owing to the previous widespread use of organochlorine pesticides and their high persistence in the environment, there is a risk that residues of such pesticides may be present in cork. In this study, the concentrations of 14 organochlorine pesticides-all of which are indicators of environmental pollution-were analyzed in cork bark samples from three regions in Spain and one in Portugal. In addition, the concentrations of 2,4,6-trichlorophenol (TCP) and 2,4,6-trichloroanisole (TCA) were also analyzed. Our results show only very low concentrations of lindane, γ-HCH (cork sample from Extremadura (0.1 ng g(-1)) and p,p'-DDE was present at a maximum concentration of 2.9 ng g(-1) in a cork sample from Castile-La Mancha. However, all concentrations were well below the legal limit established by Regulation (EC) No. 396/2005 (10 ng g(-1) in foodstuffs). We can conclude, therefore, that the cork samples we studied complied with food safety standards. Copyright © 2011 Elsevier Ltd. All rights reserved.

  7. Rice Production without Insecticide in Smallholder Farmer's Field

    Directory of Open Access Journals (Sweden)

    M. P. Ali

    2017-05-01

    Full Text Available Highlights:Use of perching, sweeping, and need based insecticide (IPM technique useage produce at par yields compared to prophylactic insecticide useage in rice fields.There exists a technique that can reduce 75% of insecticide useage in rice field.The results were obtained in cooperation between smallholder rice farmers and researchers of Bangladesh.Currently rice protection from insect pests solely depends on chemical pesticides which have tremendous impact on biodiversity, environment, animal, and human health. To reduce their impact from our society we need to cut pesticide use from agricultural practices. To address this issue, we did an experiment to identify realistic solutions that could help farmers build sustainable crop protection systems and minimize useage of insecticides and thus reduce the impact of pesticides in the environment. Innovations developed jointly by farmers and researchers and evaluated for their potential to be adopted by more farmers. In this paper we tested four management practices jointly with smallholder farmer fields in order to select the best one. Four management practices were used namely, T1 = Prophylactic use of insecticide where insecticide was applied in rice field at every 15 days interval without judging the infestation level; T2 = Perching (that is, placing roosting (perching sites for insectivorous birds within the rice field and concurrent sweep net samples along with need-based insecticide application; T3 = Perching only; and T4 = Farmer's own practices. The results revealed that routine application of insecticides for crop protection is not mandatory which is commonly found at use in rice farmers. In our experiment, where prophylactic method or farmers used 3–4 times insecticides without judging the insect pests infestation level, the similar pest population was found when compared to the field where insecticide was not applied. Our management system reduced by 75% the use of insecticides even

  8. Association between serum organochlorines and global methylation level of leukocyte DNA among Japanese women: a cross-sectional study

    Energy Technology Data Exchange (ETDEWEB)

    Itoh, Hiroaki [Department of Epidemiology and Environmental Health, Juntendo University Faculty of Medicine, 2-1-1 Hongo, Bunkyo-ku, Tokyo 113–8421 Japan (Japan); Iwasaki, Motoki, E-mail: moiwasak@ncc.go.jp [Epidemiology Division, Research Center for Cancer Prevention and Screening, National Cancer Center, 5-1-1 Tsukiji, Chuo-ku, Tokyo 104–0045 Japan (Japan); Kasuga, Yoshio [Department of Surgery, Nagano Matsushiro General Hospital, 183 Matsushiro, Matsushiro-cho, Nagano City, Nagano Prefecture 381–1231 Japan (Japan); Yokoyama, Shiro; Onuma, Hiroshi [Department of Breast and Thyroid Surgery, Nagano Red Cross Hospital, 5-22-1 Wakasato, Nagano City, Nagano Prefecture 380–8582 Japan (Japan); Nishimura, Hideki [Department of Respiratory Surgery and Breast Surgery, Nagano Municipal Hospital, 1333–1 Tomitake, Nagano City, Nagano Prefecture 381–8551 Japan (Japan); Kusama, Ritsu [Department of Surgery, Hokushin General Hospital, 1-5-63 Nishi, Nakano City, Nagano Prefecture 383–8505 Japan (Japan); Yoshida, Teruhiko [Division of Genetics, National Cancer Center Research Institute, 5-1-1 Tsukiji, Chuo-ku, Tokyo 104–0045 Japan (Japan); Yokoyama, Kazuhito [Department of Epidemiology and Environmental Health, Juntendo University Faculty of Medicine, 2-1-1 Hongo, Bunkyo-ku, Tokyo 113–8421 Japan (Japan); Tsugane, Shoichiro [Dierctor Research Center for Cancer Prevention and Screening, National Cancer Center, 5-1-1 Tsukiji, Chuo-ku, Tokyo 104–0045 Japan (Japan)

    2014-08-15

    While the global methylation level of leukocyte DNA may be a suitable biomarker for cancer risk, the level may be influenced by multiple factors, both environmental and host-related, one of which is exposure to environmental pollutants. To date, three epidemiologic studies have examined associations between serum organochlorine levels and global DNA methylation level, but their findings are not fully consistent, and the associations thus require confirmation in other well-characterized populations. We tested the association between organochlorine exposure and the global DNA methylation level of leukocytes in Japanese women. We conducted a cross-sectional study using the control group of a breast cancer case–control study in Japan. Subjects were 403 Japanese women who provided blood samples. Serum polychlorinated biphenyls (PCBs) and nine pesticide-related organochlorines were measured by gas chromatography isotope-dilution high-resolution mass spectrometry. Further, global methylation level of peripheral leukocyte DNA among 399 women was measured by luminometric methylation assay. Linear trends in the association between methylation and quartile levels of organochlorines were evaluated by regression coefficients in a multivariable linear regression model. We found significant inverse associations between the global methylation level in leukocyte DNA and many of the organochlorine levels measured. Global methylation level was significantly decreased by 0.33–0.83% per quartile category for serum o,p′-dichlorodiphenyltrichloroethane (o,p′-DDT), p,p′-DDT, p,p′-dichlorodiphenyldichloroethylene, trans-nonachlor, oxychlordane, hexachlorobenzene, β-hexachlorocyclohexane, PCB17, PCB52/69, PCB74, PCB114, and PCB183. Serum organochlorine levels were inversely associated with the global methylation level of leukocyte DNA in a relatively large sample of Japanese women. - Highlights: • Many serum organochlorine pesticides were inversely associated with the global

  9. Insecticide-induced hormesis and arthropod pest management.

    Science.gov (United States)

    Guedes, Raul Narciso C; Cutler, G Christopher

    2014-05-01

    Ecological backlashes such as insecticide resistance, resurgence and secondary pest outbreaks are frequent problems associated with insecticide use against arthropod pest species. The last two have been particularly important in sparking interest in the phenomenon of insecticide-induced hormesis within entomology and acarology. Hormesis describes a biphasic dose-response relationship that is characterized by a reversal of response between low and high doses of a stressor (e.g. insecticides). Although the concept of insecticide-induced hormesis often does not receive sufficient attention, or has been subject to semantic confusion, it has been reported in many arthropod pest species and natural enemies, and has been linked to pest outbreaks and potential problems with insecticide resistance. The study of hormesis remains largely neglected in entomology and acarology. Here, we examined the concept of insecticide-induced hormesis in arthropods, its functional basis and potential fitness consequences, and its importance in arthropod pest management and other areas. © 2013 Society of Chemical Industry.

  10. Inadvertent exposure to organochlorine pesticides DDT and derivatives in people from the Canary Islands (Spain)

    International Nuclear Information System (INIS)

    Zumbado, Manuel; Goethals, Muriel; Alvarez-Leon, Eva E.; Luzardo, Octavio P.; Cabrera, Felix; Serra-Majem, Lluis; Dominguez-Boada, Luis

    2005-01-01

    In 1998, one of the largest determinations of organochlorine pesticides in a representative sample of a Spanish population (682 serum samples from the Canary Islands) was made in the context of the 'Canary Islands Nutrition Survey' (ENCA). In the Canary Islands, extensive farming areas have been developed in these last decades, with greenhouses dedicated to intensive cultivation using DDT in huge amounts. In Spain, similarly to other European countries, DDT was banned in the late 1970s. The pesticide residues in human serum are indicative of past and present exposure to them. Our objective is to point out the differences of pesticide contamination between islands; and together with this, if a connection could be established with gender, age, or habitat of subjects. Concentration of selected persistent organochlorine pollutants (p,p'-DDT, o,p'-DDT, p,p'-DDE, o,p'-DDE, p,p'-DDD, and o,p'-DDD) was measured with gas chromatography-electron capture detector. Almost all of the samples (99.3%) presented detectable levels of some DDT-derivatives, being p,p'-DDE the most frequently detected organochlorine. The median concentration of total DDT body burden, expressed in ng/g fat, present in the Canary Islands (370 ng/g fat) was similar to that found in other European countries, although it was noteworthy that a fourth of the population showed a total DDT body burden higher than 715 ng/g. Interestingly, statistical significant differences were found in serum levels of organochlorine pesticides between islands, being these levels higher in people from Tenerife and Gran Canaria (415 and 612 ng/g fat, respectively), the islands that present both highest population and highest surface devoted to intensive agriculture. As expected, serum levels of both total DDT body burden and p,p'-DDE increased with age. Statistically significant differences were also found in relation to gender, women showing higher levels of these organochlorine pesticides than men. One of the most relevant

  11. Induced tolerance from a sublethal insecticide leads to cross-tolerance to other insecticides.

    Science.gov (United States)

    Hua, Jessica; Jones, Devin K; Relyea, Rick A

    2014-04-01

    As global pesticide use increases, the ability to rapidly respond to pesticides by increasing tolerance has important implications for the persistence of nontarget organisms. A recent study of larval amphibians discovered that increased tolerance can be induced by an early exposure to low concentrations of a pesticide. Since natural systems are often exposed to a variety of pesticides that vary in mode of action, we need to know whether the induction of increased tolerance to one pesticide confers increased tolerance to other pesticides. Using larval wood frogs (Lithobates sylvaticus), we investigated whether induction of increased tolerance to the insecticide carbaryl (AChE-inhibitor) can induce increased tolerance to other insecticides that have the same mode of action (chlorpyrifos, malathion) or a different mode of action (Na(+)channel-interfering insecticides; permethrin, cypermethrin). We found that embryonic exposure to sublethal concentrations of carbaryl induced higher tolerance to carbaryl and increased cross-tolerance to malathion and cypermethrin but not to chlorpyrifos or permethrin. In one case, the embryonic exposure to carbaryl induced tolerance in a nonlinear pattern (hormesis). These results demonstrate that that the newly discovered phenomenon of induced tolerance also provides induced cross-tolerance that is not restricted to pesticides with the same mode of action.

  12. Quantitative structure-activity relationship (QSAR) for insecticides: development of predictive in vivo insecticide activity models.

    Science.gov (United States)

    Naik, P K; Singh, T; Singh, H

    2009-07-01

    Quantitative structure-activity relationship (QSAR) analyses were performed independently on data sets belonging to two groups of insecticides, namely the organophosphates and carbamates. Several types of descriptors including topological, spatial, thermodynamic, information content, lead likeness and E-state indices were used to derive quantitative relationships between insecticide activities and structural properties of chemicals. A systematic search approach based on missing value, zero value, simple correlation and multi-collinearity tests as well as the use of a genetic algorithm allowed the optimal selection of the descriptors used to generate the models. The QSAR models developed for both organophosphate and carbamate groups revealed good predictability with r(2) values of 0.949 and 0.838 as well as [image omitted] values of 0.890 and 0.765, respectively. In addition, a linear correlation was observed between the predicted and experimental LD(50) values for the test set data with r(2) of 0.871 and 0.788 for both the organophosphate and carbamate groups, indicating that the prediction accuracy of the QSAR models was acceptable. The models were also tested successfully from external validation criteria. QSAR models developed in this study should help further design of novel potent insecticides.

  13. Insecticidal defenses of Piperaceae from the neotropics.

    Science.gov (United States)

    Bernard, C B; Krishanmurty, H G; Chauret, D; Durst, T; Philogène, B J; Sánchez-Vindas, P; Hasbun, C; Poveda, L; San Román, L; Arnason, J T

    1995-06-01

    Insecticidal and growth-reducing properties of extracts of 14 species of American neotropical Piperaceae were investigated by inclusion in diets of a polyphagous lepidopteran, the European corn borer,Ostrinia nubilalis. Nutritional indices suggested most extracts acted by postdigestive toxicity.Piper aduncum, P. tuberculatum, andP. decurrens were among the most active species and were subjected to bioassay-guided isolation of the active components. Dillapiol was isolated from the active fraction ofP. aduncum, piperlonguminine was isolated fromP. tuberculatum, and a novel neolignan fromP. decurrens. The results support other studies on Asian and AfricanPiper species, which suggest that lignans and isobutyl amides are the active defence compounds in this family.

  14. Insecticidal Constituents from Buddlej aalbiflora Hemsl.

    Science.gov (United States)

    Zhang, Xiu-Yun; Shen, Jing; Zhou, Yu; Wei, Zhi-Ping; Gao, Jin-Ming

    2017-06-01

    Eleven known compounds, deoxymikanolide (1), 1,3-dihydroxyxanthone (2), kumatakenin (3), apigenin (4), chrysin (5), kaempferol (6), Iso-kaempferol (7), luteolin (8), luteolin-3',4'-dimethylether-7-O-β-glucoside (9), luteolin-7-O-β-glucoside (10) and quercetin (11) were identified in MeOH extract of Buddleja albiflora Hemsl (Oleaceae). These compounds (each, 1, 0.5 and 0.25 mg mL -1 ) were tested for insecticidal activity against 3rd and 4th-instar larvae of Plutella xylostella, 3rd-instar larvae of Mythimna separata and 3rd-instar larvae of Macrosiphoniella sanborni. The lowest 50% anti-feedant concentration (AFC 50 ) against P. xylostella and 50% lethal concentration (LC 50 ) against P. xylostella and M. sanborni were observed as 0.0058, 0.0046 and 3.4048 mg L -1 , respectively.

  15. Insecticidal Activity of Cyanohydrin and Monoterpenoid Compounds

    Directory of Open Access Journals (Sweden)

    Joel R. Coats

    2000-04-01

    Full Text Available The insecticidal activities of several cyanohydrins, cyanohydrin esters and monoterpenoid esters (including three monoterpenoid esters of a cyanohydrin were evaluated. Topical toxicity to Musca domestica L. adults was examined, and testing of many compounds at 100 mg/fly resulted in 100% mortality. Topical LD50 values of four compounds for M. domestica were calculated. Testing of many of the reported compounds to brine shrimp (Artemia franciscana Kellog resulted in 100% mortality at 10 ppm, and two compounds caused 100% mortality at 1 ppm. Aquatic LC50 values were calculated for five compounds for larvae of the yellow fever mosquito (Aedes aegypti (L.. Monoterpenoid esters were among the most toxic compounds tested in topical and aquatic bioassays.

  16. Occurrence and distribution of persistent chlorinated hydrocarbons in the seas around India

    Digital Repository Service at National Institute of Oceanography (India)

    Sarkar, A.

    Article deals with an evaluation of the levels of contamination of various organochlorine pesticides such as DDTs, HCHs, aldrin, dieldrin, endrin, and different congeners of polychlorinated biphenyls in different compartment of the ocean (water...

  17. Evaluation of Ricinus communis L. for the Phytoremediation of Polluted Soil with Organochlorine Pesticides

    Directory of Open Access Journals (Sweden)

    Sandra Regina Rissato

    2015-01-01

    Full Text Available Phytoremediation is an attractive alternative to conventional treatments of soil due to advantages such as low cost, large application areas, and the possibility of in situ treatment. This study presents the assessment of phytoremediation processes conducted under controlled experimental conditions to evaluate the ability of Ricinus communis L., tropical plant species, to promote the degradation of 15 persistent organic pollutants (POPs, in a 66-day period. The contaminants tested were hexachlorocyclohexane (HCH, DDT, heptachlor, aldrin, and others. Measurements made in rhizosphere soil indicate that the roots of the studied species reduce the concentration of pesticides. Results obtained during this study indicated that the higher the hydrophobicity of the organic compound and its molecular interaction with soil or root matrix the greater its tendency to concentrate in root tissues and the research showed the following trend: HCHs < diclofop-methyl < chlorpyrifos < methoxychlor < heptachlor epoxide < endrin < o,p′-DDE < heptachlor < dieldrin < aldrin < o,p′-DDT < p,p′-DDT by increasing order of log Kow values. The experimental results confirm the importance of vegetation in removing pollutants, obtaining remediation from 25% to 70%, and demonstrated that Ricinus communis L. can be used for the phytoremediation of such compounds.

  18. Organochlorinated pesticides in sediments from the Lake Albufera of Valencia (Spain).

    Science.gov (United States)

    Peris, E; Requena, S; de la Guardia, M; Pastor, A; Carrasco, J M

    2005-09-01

    Bottom sediment samples from 121 sites of the Lake Albufera of Valencia were analyzed. Dieldrin, endrin, heptachlor and op'-DDT were not detected (<0.01 ng g(-1)) in 88-93% of the sites. Aldrin and HCB concentration ranges were between <0.01 and 0.1 ng g(-1) in 86% and 94% of the sites, respectively. Heptachlor-epoxide and lindane 95% confidence intervals were 0.2-0.5 and 0.06-0.12, respectively. The greatest average concentration corresponds to pp'-DDE, pp'-DDD and pp'-DDT. The sum of six isomers and derivatives of the DDT average concentration reaches 2.1 ng g(-1), as opposed to 2.7 ng g(-1) for the sum of 13 pesticides considered. In the site with a major contamination, 27.0 ng g(-1) of pp'-DDD and 12.8 ng g(-1) of pp'-DDT were accumulated. The DDE:DDT proportion average was 0.37, indicating an aged DDT contamination. Concentrations of pesticides in sediments were compared to three sediment quality guidelines, and indicated that a low biological effects level can be expected in either sediments or aquatic organisms.

  19. Teenage organophosphate insecticide poisoning: An ugly trend in ...

    African Journals Online (AJOL)

    UNIBEN

    is worsened by uncontrolled sale of organophosphorus insecticides on the streets and in open markets. We report ..... Nicotinic activity results in autonomic nervous system .... optimize outcome.23 Oximes are cholinesterase re-activators used ...

  20. Gas Chromaotography-Mass Spectrometry Analysis of Insecticidal ...

    African Journals Online (AJOL)

    Insecticidal Essential Oil Derived from Chinese Ainsliaea fragrans Champ ex Benth ... Methods: The essential oil of A. fragrans aerial parts was obtained by hydrodistillation and analyzed by ..... toxicity than the crude oil. Caryophyllene showed.

  1. Scepticism towards insecticide treated mosquito nets for malaria ...

    African Journals Online (AJOL)

    Scepticism towards insecticide treated mosquito nets for malaria control in rural ... especially among under-five year children and pregnant women in poor rural ... through social marketing strategy for malaria control prior to the introduction of ...

  2. Design, Synthesis and Insecticidal Activity of Novel Phenylurea Derivatives

    Directory of Open Access Journals (Sweden)

    Jialong Sun

    2015-03-01

    Full Text Available A series of novel phenylurea derivatives were designed and synthesized according to the method of active groups linkage and the principle of aromatic groups bioisosterism in this study. The structures of the novel phenylurea derivatives were confirmed based on ESI-MS, IR and 1H-NMR spectral data. All of the compounds were evaluated for the insecticidal activity against the third instars larvae of Spodoptera exigua Hiibner, Plutella xyllostella Linnaeus, Helicoverpa armigera Hubner and Pieris rapae Linne respectively, at the concentration of 10 mg/L. The results showed that all of the derivatives displayed strong insecticidal activity. Most of the compounds presented higher insecticidal activity against S. exigua than the reference compounds tebufenozide, chlorbenzuron and metaflumizone. Among the synthesized compounds, 3b, 3d, 3f, 4b and 4g displayed broad spectrum insecticidal activity.

  3. Neurotoxicological effects and the mode of action of pyrethroid insecticides

    NARCIS (Netherlands)

    Vijverberg, H.P.M.; Bercken, Joep van den

    1990-01-01

    Neuroexcitatory symptoms of acute poisoning of vertebrates by pyrethroids are related to the ability of these insecticides to modify electrical activity in various parts of the nervous system. Repetitive nerve activity, particularly in the sensory nervous system, membrane depolarization, and

  4. Effect of natural and chemical insecticides on Hyalopterus pruni and ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-06-17

    Jun 17, 2008 ... Anthmis pseudocotula and their mixtures with chemical insecticide (Malathion) on growth of ... ed the use of natural extracts of Fagonia arabica, Salix ..... Studies on the efficacy of neem products against the aphid Aphis.

  5. Process optimization and insecticidal activity of alkaloids from the ...

    African Journals Online (AJOL)

    Process optimization and insecticidal activity of alkaloids from the root bark of Catalpa ovata G. Don by response surface methodology. ... Tropical Journal of Pharmaceutical Research. Journal Home · ABOUT THIS JOURNAL · Advanced ...

  6. Insect P450 inhibitors and insecticides: challenges and opportunities.

    Science.gov (United States)

    Feyereisen, René

    2015-06-01

    P450 enzymes are encoded by a large number of genes in insects, often over a hundred. They play important roles in insecticide metabolism and resistance, and growing numbers of P450 enzymes are now known to catalyse important physiological reactions, such as hormone metabolism or cuticular hydrocarbon synthesis. Ways to inhibit P450 enzymes specifically or less specifically are well understood, as P450 inhibitors are found as drugs, as fungicides, as plant growth regulators and as insecticide synergists. Yet there are no P450 inhibitors as insecticides on the market. As new modes of action are constantly needed to support insecticide resistance management, P450 inhibitors should be considered because of their high potential for insect selectivity, their well-known mechanisms of action and the increasing ease of rational design and testing. © 2014 Society of Chemical Industry.

  7. Gas Chromatography-Mass Spectrometric Analysis and Insecticidal ...

    African Journals Online (AJOL)

    HP

    Original Research Article. Gas Chromatography-Mass Spectrometric Analysis and ... into a natural fumigant/insecticide for the control of stored product insects. Keywords: Mallotus ..... stability as well as reduce cost. ACKNOWLEDGEMENT.

  8. Gas Chromatography-Mass Spectrometric Analysis and Insecticidal ...

    African Journals Online (AJOL)

    Tropical Journal of Pharmaceutical Research ... apelta aerial parts was analyzed by gas chromatography/mass spectrometric (GC/MS) to determine its composition. ... into a natural fumigant/insecticide for the control of stored product insects.

  9. Federal Insecticide, Fungicide, and Rodenticide Act Section 18 Database

    Data.gov (United States)

    U.S. Environmental Protection Agency — Section 18 of Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA) authorizes EPA to allow an unregistered use of a pesticide for a limited time if EPA...

  10. PRN 73-4: Residual Insecticides in Food Handling Establishments

    Science.gov (United States)

    This notice provides a copy of a Federal Register notice published July 6, 1973, regarding certain insecticides used in food-handling establishments. It establishes certain definitions and requirements related to approval for crack and crevice treatment.

  11. Log bioassay of residual effectiveness of insecticides against bark beetles

    Science.gov (United States)

    Richard H. Smith

    1982-01-01

    Residual effectiveness of nine insecticides applied to bark was tested against western, mountain, and Jeffrey pine beetles. Ponderosa and Jeffrey pine trees were treated and logs cut from them 2 to 13 months later, and bioassayed with the three beetles. The insecticides were sprayed at the rate of 1 gal (3.8 l) per 40- or 80-ft² (3.6 or 7.2 m²) bark surface at varying...

  12. The use of insecticides to control insect pests

    OpenAIRE

    M Wojciechowska; P Stepnowski; M Gołębiowski

    2016-01-01

    Pesticides are used as plants protection products. Among those, insecticides serve as agents to control insects. When incorrectly applied, however these substances may negatively affect people's health and natural environment. Administration routes of insecticides depend on many factors and vary from spraying to fertilizers. These different methods influence how insects prey and how pests develop. Additionally, too frequent use of the same chemicals can lead to development of resi...

  13. Insecticidal activity of Trichilia claussenii (Meliaceae) fruits against Spodoptera frugiperda

    International Nuclear Information System (INIS)

    Nebo, Liliane; Matos, Andrea Pereira; Vieira, Paulo Cezar; Fernandes, Joao Batista; Silva, Maria Fatima das Gracas Fernandes da; Rodrigues, Ricardo Ribeiro

    2010-01-01

    An evaluation of the insecticidal activity of the fruits extracts of Trichilia claussenii was carried out and the methanol extract revealed to have strong insecticidal activity. The fractionation of methanol extract of T. claussenii seeds bioassay-guided against Spodoptera frugiperda has led to the identification of the ω-phenylalkyl and alkenyl fatty acids as active compounds in this extract. The structures of the compounds were proposed by spectroscopic analysis and comparison with literature data. (author)

  14. Plant compounds insecticide activity against Coleoptera pests of stored products

    OpenAIRE

    MOREIRA, M.D.; PICANÇO, M.C.; BARBOSA, L.C. de A.; GUEDES, R.N.C.; CAMPOS, M.R. de; SILVA, G.A.; MARTINS, J.C.

    2008-01-01

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed...

  15. Organochlorine Pesticides Residues in Human Breast Milk from the Middle Governorates in Jordan in 2013/2014.

    Science.gov (United States)

    Al Antary, Tawfiq M; Alawi, Mahmoud A; Estityah, Hussein; Haddad, Nizar

    2017-07-01

    One hundred samples of mother breast milk were gathered from six middle governorates and districts in Jordan in 2013/2014 to monitor Organochlorine pesticides pollutants. The results showed clearly that banned organochlorine pesticides are still detected in the monitored samples in low concentration despite banning of these persistent pollutants in Jordan since 36 years ago. However, the results indicated that 1% of the contaminated samples contained β-HCH, 5% γ-HCH, 3% p,p'-DDD, 2% heptachlor, 45% p,p'-DDE and 3% p,p'-DDT. In addition, these monitored samples had no residues of aldrin, dieldrin, α-endosulfan, β-endosulfan, HCB, o,p'-DD, o,p'-DDT and o,p'-DDE. In conclusion, there was a decline in the residues of Organochlorine pesticides, particularly DDT group members.

  16. Impact of some selected insecticides application on soil microbial respiration.

    Science.gov (United States)

    Latif, M A; Razzaque, M A; Rahman, M M

    2008-08-15

    The aim of present study was to investigate the impact of selected insecticides used for controlling brinjal shoot and fruit borer on soil microorganisms and to find out the insecticides or nontoxic to soil microorganism the impact of nine selected insecticides on soil microbial respiration was studied in the laboratory. After injection of different insecticides solutions, the soil was incubated in the laboratory at room temperature for 32 days. The amount of CO2 evolved due to soil microbial respiration was determined at 2, 4, 8, 16, 24 and 32 days of incubation. Flubendiamide, nimbicidine, lambda-cyhalothrin, abamectin and thiodicarb had stimulatory effect on microbial respiration during the initial period of incubation. Chlorpyriphos, cartap and carbosulfan had inhibitory effect on microbial respiration and cypermethrin had no remarkable effect during the early stage of incubation. The negative effect of chlorpyriphos, cartap and carbosulfan was temporary, which was disappeared after 4 days of insecticides application. No effect of the selected insecticides on soil microorganisms was observed after 24 or 32 days of incubation.

  17. Serum organochlorine pesticide residues and risk of testicular germ cell carcinoma: a population-based case-control study.

    Science.gov (United States)

    Biggs, Mary L; Davis, Mark D; Eaton, David L; Weiss, Noel S; Barr, Dana B; Doody, David R; Fish, Sherianne; Needham, Larry L; Chen, Chu; Schwartz, Stephen M

    2008-08-01

    Testicular germ cell carcinoma (TGCC) is the most common malignancy among men ages 20 to 34 years. Although the pathogenesis of TGCC is poorly understood, suboptimal androgen levels or impaired androgen signaling may play a role. Some persistent organochlorine pesticides commonly found in human tissue possess antiandrogenic properties. We examined whether the risk of TGCC is associated with serum levels of 11 organochlorine pesticides, including p,p'-DDE, and whether the p,p'-DDE-TGCC association is modified by CAG or GGN repeat polymorphisms in the androgen receptor gene. We conducted a population-based case-control study among 18- to 44-year-old male residents of three Washington State counties. Cases (n = 246) were diagnosed during 1999 to 2003 with a first, primary TGCC. Controls (n = 630) were men of similar age with no history of TGCC from the same population identified through random-digit telephone dialing. Questionnaires elicited information on demographic, medical, and lifestyle factors. A blood specimen provided serum for gas chromatography-high-resolution mass spectrometry analysis of organochlorine pesticide residues and DNA for genotyping. We observed no clear patterns between TGCC risk and concentrations of any of the organochlorines measured, nor did we observe that the risk associated with p,p'-DDE was modified by androgen receptor CAG ( or =23 repeats) or GGN ( or =17 repeats) genotype. This study does not provide support for the hypothesis that adult exposure to organochlorine pesticides is associated with risk of TGCC. Due to uncertainty regarding how well organochlorine levels measured in adulthood reflect exposures during early life, further research is needed using exposure measurements collected in utero or during infancy.

  18. Human health risk assessment of organochlorines associated with fish consumption in a coastal city in China

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Q.T. [Department of Biology and Chemistry, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China); Lee, T.K.M. [Department of Biology and Chemistry, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China); Chen, K. [Department of Epidemiology and Health Statistics, School of Medicine, Zhejiang University, 353, Yan-an Road, Hangzhou, Zhejiang Province, 310031 (China); Wong, H.L. [Department of Biology and Chemistry, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China); Zheng, J.S. [Department of Biology and Chemistry, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China); Giesy, J.P. [Department of Biology and Chemistry, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China); Department of Zoology, National Food Safety and Toxicology Center, Michigan State University, East Lansing, MI 48824 (United States); Lo, K.K.W. [Department of Biology and Chemistry, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China); Yamashita, N. [National Institute of Advanced Industrial Science and Technology (AIST), EMTECH, 16-1 Onogawa, Tsukuba (Japan); Lam, P.K.S. [Department of Biology and Chemistry, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China)]. E-mail: bhpksl@cityu.edu.hk

    2005-07-15

    Food consumption is an important route of human exposure to organochlorines (OCs). In order to assess the potential health risks associated with these contaminants due to fish consumption, five species of fish were collected from a local market in Zhoushan City, an island in the East China Sea. Dioxin-like compounds, such as polychlorinated dibenzo-p-dioxins/ dibenzofurans, in the fish samples were screened by H4IIE-luc cell bioassay, and the concentrations of specific organochlorines were measured by gas chromatograph-electron capture detector (GC-ECD). The bioassay results indicated that concentrations of dioxin-like compounds in the fish samples were below detection limit (0.64 pg/mL). The concentrations of OC pesticides and PCBs ranged from 0.67 to 13 and 0.24 to 1.4 ng/g wet wt., respectively. Significantly, concentrations of p,p'-DDE in fish meat were comparatively high (average 3.9 ng/g wet wt.) compared with the other OC pesticides. The daily fish consumption, based on a dietary survey conducted among 160 local healthy residents, was determined to be 105 g/person. The relevant cancer benchmark concentrations of HCB, dieldrin, chlordane, DDTs and PCBs were 0.36, 0.04, 1.6, 1.7, and 0.29 ng/kg per day, respectively, based on the local diet. The hazard ratios (HRs), based on non-cancer endpoints were all less than 1.0, while the HRs based on cancer were greater than 1.0 for certain contaminants based on the 95th centile concentration in fish tissue. - Health risk assessment of organochlorines associated with fish consumption reveals potential cancer risks for some contaminants in a coastal population in China.

  19. Human health risk assessment of organochlorines associated with fish consumption in a coastal city in China

    International Nuclear Information System (INIS)

    Jiang, Q.T.; Lee, T.K.M.; Chen, K.; Wong, H.L.; Zheng, J.S.; Giesy, J.P.; Lo, K.K.W.; Yamashita, N.; Lam, P.K.S.

    2005-01-01

    Food consumption is an important route of human exposure to organochlorines (OCs). In order to assess the potential health risks associated with these contaminants due to fish consumption, five species of fish were collected from a local market in Zhoushan City, an island in the East China Sea. Dioxin-like compounds, such as polychlorinated dibenzo-p-dioxins/ dibenzofurans, in the fish samples were screened by H4IIE-luc cell bioassay, and the concentrations of specific organochlorines were measured by gas chromatograph-electron capture detector (GC-ECD). The bioassay results indicated that concentrations of dioxin-like compounds in the fish samples were below detection limit (0.64 pg/mL). The concentrations of OC pesticides and PCBs ranged from 0.67 to 13 and 0.24 to 1.4 ng/g wet wt., respectively. Significantly, concentrations of p,p'-DDE in fish meat were comparatively high (average 3.9 ng/g wet wt.) compared with the other OC pesticides. The daily fish consumption, based on a dietary survey conducted among 160 local healthy residents, was determined to be 105 g/person. The relevant cancer benchmark concentrations of HCB, dieldrin, chlordane, DDTs and PCBs were 0.36, 0.04, 1.6, 1.7, and 0.29 ng/kg per day, respectively, based on the local diet. The hazard ratios (HRs), based on non-cancer endpoints were all less than 1.0, while the HRs based on cancer were greater than 1.0 for certain contaminants based on the 95th centile concentration in fish tissue. - Health risk assessment of organochlorines associated with fish consumption reveals potential cancer risks for some contaminants in a coastal population in China

  20. Organic amendments for risk mitigation of organochlorine pesticide residues in old orchard soils

    International Nuclear Information System (INIS)

    Centofanti, Tiziana; McConnell, Laura L.; Chaney, Rufus L.; Beyer, W. Nelson; Andrade, Natasha A.; Hapeman, Cathleen J.; Torrents, Alba; Nguyen, Anh; Anderson, Marya O.; Novak, Jeffrey M.

    2016-01-01

    Performance of compost and biochar amendments for in situ risk mitigation of aged DDT, DDE and dieldrin residues in an old orchard soil was examined. The change in bioavailability of pesticide residues to Lumbricus terrestris L. relative to the unamended control soil was assessed using 4-L soil microcosms with and without plant cover in a 48-day experiment. The use of aged dairy manure compost and biosolids compost was found to be effective, especially in the planted treatments, at lowering the bioavailability factor (BAF) by 18–39%; however, BAF results for DDT in the unplanted soil treatments were unaffected or increased. The pine chip biochar utilized in this experiment was ineffective at lower the BAF of pesticides in the soil. The US EPA Soil Screening Level approach was used with our measured values. Addition of 10% of the aged dairy manure compost reduced the average hazard quotient values to below 1.0 for DDT + DDE and dieldrin. Results indicate this sustainable approach is appropriate to minimize risks to wildlife in areas of marginal organochlorine pesticide contamination. Application of this remediation approach has potential for use internationally in areas where historical pesticide contamination of soils remains a threat to wildlife populations. - Highlights: • Historical applications of organochlorine pesticides are a risk to local ecosystems. • Low cost and sustainable mitigation measures are needed to reduce risks. • Organic matter rich amendments were added to contaminated soil. • Earthworms microcosms were used to measure bioaccumulation factors. • Aged composts were most effective at mitigating risks to ecosystems. - Incorporation of aged dairy manure and biosolids compost amendments is an effective, low cost approach to mitigate risks to terrestrial wildlife from organochlorine pesticides in soils.

  1. Evaluation of organochlorine pesticides in serum from students in Coimbra, Portugal: 1997-2001

    International Nuclear Information System (INIS)

    Lino, Celeste Matos; Silveira, M. Irene Noronha da

    2006-01-01

    In 1997, 1999, 2000, and 2001, in an attempt to evaluate the contamination level of a Portuguese population, organochlorine pesticide residues were evaluated in human serum from students of the University of Coimbra. Concentrations of selected organochlorine pollutants (α-, β-, and γ-HCH, aldrin, dieldrin, HE, HCB, p,p'-DDT, o,p'-DDT, p,p'-DDE, p,p'-DDD) and endosulfan sulfate was measured with gas chromatography-electron capture detector. Our objective is to point out the general levels of pesticide contamination and the differences between the four populations; and together with this, if a connection could be established with gender or the residence area of the subjects. Endosulfan sulfate, p,p'-DDE, o,p'-DDT, and p,p'-DDD were the most frequently identified residues. Endosulfan sulfate present the highest concentrations for all subjects, 42.6 μg/l, with concentrations ranging from undetected to 1295.5 μg/l. Between DDT, isomers, and analogues, o,p'-DDT, and p,p'-DDT presented the highest levels, 24.8 and 21.9 μg/l, respectively. Mean total DDT levels were higher than mean total HCH levels. For Σ-DDT, the highest levels were found among female gender and urban samples. An opposite situation was found in Σ-HCH: males presented higher levels than females. The mean concentration of organochlorine pesticide residues, present in the student populations, showed that it is among the highest levels of contamination, when compared with others from Europe, Asia, and America

  2. Targeting of detoxification potential of microorganisms and plants for cleaning environment polluted by organochlorine pesticides

    Directory of Open Access Journals (Sweden)

    M.V. Kurashvili

    2016-09-01

    Full Text Available The goal of presented work is the development phytoremediation method targeted to cleaning environment polluted with organochlorine pesticides, based on joint application of specially selected plants and microorganisms. Initial degradation of pesticides carry out by microorganisms; the forming dehalogenated products easily uptake by the plants and undergo oxidative degradation via plant detoxification enzymes. This approach can complete degradation of toxicants and their mineralization into nontoxic compounds. In the presented work the results of using selected strains from genera Pseudomonas and plants phytoremediators in the model experiments are given. It has been shown that the using developed technological approach effectively decreased degree of pollution in artificially polluted soil samples.

  3. Organochlorine pesticide contamination of ground water in the city of Hyderabad.

    Science.gov (United States)

    Shukla, Gangesh; Kumar, Anoop; Bhanti, Mayank; Joseph, P E; Taneja, Ajay

    2006-02-01

    Organochlorine pesticides are ubiquitous and persistent organic pollutants used widely throughout the world. Due to the extensive use in agriculture, organic environmental contaminants such as HCH, DDT along with other organochlorine pesticides are distributed globally by transport through air and water. The main aim of present study is to determine contamination levels of organochlorine pesticides in the ground water of Hyderabad City. Water samples were collected from 28 domestic well supplies of the city. For this study, random sampling technique was applied, all the samples were collected in high purity glass bottles and refrigerated at 4 degrees C until analysis. Solid Phase Extraction (SPE) is used for the extraction of organochlorine pesticide residues in water sample. The collected water samples were pre-filtered through a 0.45 microg glass fiber filter (Wattman GF/F) to remove particulate matter and were acidified with hydrochloric acid (6N) to pH 2.5. Methanol modifier (BDH, for pesticide residue analysis, 10 mL) was added to water sample for better extraction. SPE using pre-packed reversed phase octadecyl (C-18 bonded silica) contained in cartridges was used for sample preparation. Prior to the extraction, the C-18 bonded phase, which contains 500 mg of bonded phase, was washed with 20 mL methanol. The sample was mixed well and allowed to percolate through the cartridges with flow rate of 10-15 mL/min under vacuum. After sample extraction, suction continued for 15 min to dry the packing material and pesticides trapped in the C-18 bonded phases were eluted by passing 10 mL hexane and fraction was evaporated in a gentle steam of Nitrogen. In all samples pesticide residues were analyzed by GC (Chemito-8510) with Ni63 ECD detector. Helium was used as carrier gas and nitrogen was used as make up gas. The injection technique was split/split less. All the samples analyzed were found to be contaminated with four pesticides i.e. DDT, beta-Endosulfan, alpha

  4. Exposure of Inuit in Greenland to organochlorines through the marine diet

    DEFF Research Database (Denmark)

    Bjerregaard, P; Dewailly, E; Ayotte, P

    2001-01-01

    statistically significant positive associations with age, marine diet, and male sex in multiple linear regression analyses. The exceptionally high plasma concentrations of several organochlorines among the Inuit of Greenland are attributed to a lifelong high intake of seafood, in particular marine mammals....... Concentrations of PCB adjusted for the consumption of marine food increased until approximately 40 yr of age, which is equivalent to the birth cohorts of the early 1950s. The age pattern indicates that bioaccumulation of PCB started in the 1950s, which is a likely date for the introduction of the compounds...

  5. Organochlorine residues in sediments from selected tributaries to Manila Bay, Philippines

    International Nuclear Information System (INIS)

    Bajet, C.M.; Varca, L.M.; Navarro, M.P.

    1999-01-01

    Sediment borne pesticides are the major route of transport of pesticides in the marine environment and benthic dwellers, filter feeders and the flora/fauna closely associated with the sediments could greatly be affected. This paper focuses on the monitoring of organochlorine pesticides in sediments collected from the mouth of rivers draining to Manila Bay and relate to the contribution of inland activities to the overall pollution of the Bay. Sediments from 14-25 tributaries were collected in 1996 to 1998 and analyzed for the presence of HCB, aldrin, dieldrin, lindane, DDT, DDE, DDD, endosulfan I, endosulfan II and endosulfan sulfate using GLC-ECD

  6. Organochlorines and heavy metals in 17-year cicadas pose no apparent dietary threat to birds

    Science.gov (United States)

    Clark, D.R.

    1992-01-01

    Organochlorine and heavy metal concentrations in 17-year cicadas from Prince Georges and Anne Arundel Counties, Maryland, were well below levels known to be harmful to birds. Cicadas contained concentrations of metals similar to or less than other local invertebrates except they contained more copper than did earthworms. Copper and lead concentrations in cicadas from one site may have been elevated by sewage plant effluent deposited during river floodings. Cicadas from the median of a major highway did not contain more lead than cicadas from non-traffic sites.

  7. Efeitos tardios dos praguicidas organoclorados no homem Delayed effects of organochlorine pesticides in man

    Directory of Open Access Journals (Sweden)

    Mônica Vannucci Nunes

    1998-08-01

    Full Text Available Procurou-se relacionar as informações disponíveis sobre os organoclorados e os efeitos crônicos provocados pela exposição. Os compostos organoclorados são os praguicidas mais persistentes já fabricados. Embora sejam geralmente eficientes no controle das pragas, são importantes poluentes ambientais e potenciais causas de problemas de saúde para o homem, tendo sido proibidos ou controlados na maioria dos países. Com poucas exceções, os efeitos tardios desses compostos sobre a saúde humana são difíceis de detectar, em função de dificuldades metodológicas e da extrapolação dos resultados. A genotoxicidade está entre os mais sérios dos possíveis danos causados por esses compostos e merece atenção especial, devido à natureza irreversível do processo. Outro ponto a ser considerado é o aumento na incidência de alterações no desenvolvimento do trato reprodutivo e na fertilidade masculina observada nas últimas décadas provavelmente decorrente do aumento da exposição intra-uterina a compostos estrogênicos e anti-androgênicos, como os organoclorados.Available information on organochlorines and the chronic effects of exposure to them are set out. Organochlorinated compounds are the most persistent pesticides and can be found in all ecosystems. Although they are generally efficient in pest control, they are also a potent environment pollutant and can provoke health problems in man. The evidences of the carcinogenic potential of organochlorines are controversial and insufficient, but they have been related to an increase in the incidence of some kinds of tumors, such as leukemia and solid tumors. Reproductive effects, due to anti-androgenic and estrogenic action, on embryonic virilization, the incidence of abortion and the frequency of prematurity, have also been observed. The accumulation of the organochlorines in the adipous tissue is positively correlated to the increase in aging and could be implicated in the

  8. ORGANOCHLORINE PESTICIDES IN FISH OF THE KILIYA DELTA OF THE DANUBE (2003–2005

    Directory of Open Access Journals (Sweden)

    Yu. Sytnik

    2015-09-01

    Full Text Available Purpose. Identification and analysis of the content of organochlorine pesticides (OCP in organs and tissues of benthivorous and predatory fish species of the Kiliya delta of the Danube (Eastern mouth and their comparison with previous years. Methodology. The analysis of the samples of aquatic organisms for the content of residual organochlorine pesticides was carried out by gas-liquid chromatography (GLH based on a unified methodology. The chromatographic analysis was carried out on the gas chromatograph "Color 5" with electron capture detector at the Institute of Hydrobiology of the National Academy of Sciences of Ukraine. Findings. The effect of stable organochlorine pesticides on aquatic organisms is characterized by marked persistence in the environment and by high ability for migration and accumulation on different levels of food chains in aquatic ecosystems. The continuous presence of OCP in all investigated organs and tissues of selected species with the presence of a certain amount of fat and consequently, the fixation of residual organochlorine pesticides. Among benthivorous fishes, the content of OCP in organs and tissues (total is as follows: vimba → roach → wild carp → bream → gibel carp. Among the predators: asp → perch → European catfish → pikeperch. Originality. Recently, a significant number of scientists all around the world returns to the problem of the accumulation and distribution (redistribution of OCP in the components of aquatic ecosystems. This is associated with certain threats to the environment and human health, that could lead to negative consequences as a result of the consumption of fish as the highest trophic level in fresh waters of Ukraine. Practical value. The obtained data indicate that the major commercial fish species of the Kiliya delta of the Danube river contains residual quantities of pesticides. This indicates to the need for continuous hygienic and toxicological monitoring of fish caught

  9. Persistent organochlorine pollutants (POP's) in coastal environments of Southeast Gulf of Mexico

    International Nuclear Information System (INIS)

    Vazquez-Botello, A.; Diaz-Gonzalez, G.; Rueda-Quintana, L.

    1999-01-01

    Analyses to determine the presence and concentrations of persistent organochlorine pollutants (POP's) were carried out in sediments and estuarine organisms (Crassostrea virginica) from five coastal lagoons of the Southeast Gulf of Mexico. The results of this study show high levels of POP's in sediments with high concentration of Heptachlor, Aldrin, Dieldrin and ppDDT, either in sediments or biological tissues. According to national regulations, the use and dispersion of these chemical have been severely restricted or totally prohibited in developed countries, however their presence in coastal areas indicate an extensive use and recent application of them. (author)

  10. Concentrations of organochlorine pesticides, polybrominated diphenyl ethers and perfluorinated compounds in the atmosphere of North Greenland

    DEFF Research Database (Denmark)

    Bossi, Rossana; Vorkamp, Katrin; Skov, Henrik

    2016-01-01

    Atmospheric concentrations of organochlorine pesticides (OCPs), polybrominated diphenyl ethers (PBDEs) and neutral per- and polyfluoroalkyl substances (PFAS) have been measured at Villum Research Station, Station Nord (North Greenland) in the period 2008–2013. Atmospheric concentrations of OCPs...... for neutral PFAS we present for the first time a multiyear series of measurements for North Greenland. The average sum of the seven measured neutral PFAS (∑7PFAS) ranged from 1.82 to 32.1 pg m−3. The most abundant compound was 8:2 FTOH (44% of ∑7PFAS), followed by 6:2 FTOH and 10:2 FTOH. Perfluoroalkyl...

  11. Insecticide mixtures could enhance the toxicity of insecticides in a resistant dairy population of Musca domestica L [corrected].

    Directory of Open Access Journals (Sweden)

    Hafiz Azhar Ali Khan

    Full Text Available House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-"A" and LC50: LC50-"B" significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies.

  12. Insecticide Mixtures Could Enhance the Toxicity of Insecticides in a Resistant Dairy Population of Musca domestica L

    Science.gov (United States)

    Khan, Hafiz Azhar Ali; Akram, Waseem; Shad, Sarfraz Ali; Lee, Jong-Jin

    2013-01-01

    House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-“A” and LC50: LC50-“B”) significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies. PMID:23613758

  13. The gut microbiota of insecticide-resistant insects houses insecticide-degrading bacteria: A potential source for biotechnological exploitation

    Science.gov (United States)

    de Almeida, Luis Gustavo; de Moraes, Luiz Alberto Beraldo; Trigo, José Roberto; Omoto, Celso

    2017-01-01

    The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects. PMID:28358907

  14. The gut microbiota of insecticide-resistant insects houses insecticide-degrading bacteria: A potential source for biotechnological exploitation.

    Directory of Open Access Journals (Sweden)

    Luis Gustavo de Almeida

    Full Text Available The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects.

  15. Enzymes and Inhibitors in Neonicotinoid Insecticide Metabolism

    Science.gov (United States)

    Shi, Xueyan; Dick, Ryan A.; Ford, Kevin A.; Casida, John E.

    2009-01-01

    Neonicotinoid insecticide metabolism involves considerable substrate specificity and regioselectivity of the relevant CYP450, aldehyde oxidase, and phase II enzymes. Human CYP450 recombinant enzymes carry out the following conversions: CYP3A4, 2C19 and 2B6 for thiamethoxam (TMX) to clothianidin (CLO); 3A4, 2C19 and 2A6 for CLO to desmethyl-CLO; 2C19 for TMX to desmethyl-TMX. Human liver aldehyde oxidase reduces the nitro substituent of CLO to nitroso much more rapidly than that of TMX. Imidacloprid (IMI), CLO and several of their metabolites do not give detectable N-glucuronides but 5-hydroxy-IMI, 4,5-diol-IMI and 4-hydroxy-thiacloprid are converted to O-glucuronides in vitro with mouse liver microsomes and UDP-glucuronic acid or in vivo in mice. Mouse liver cytosol with S-adenosylmethionine converts desmethyl-CLO to CLO but not desmethyl-TMX to TMX. Two organophosphorus CYP450 inhibitors partially block IMI, thiacloprid and CLO metabolism in vivo in mice, elevating the brain and liver levels of the parent compounds while reducing amounts of the hydroxylated metabolites. PMID:19391582

  16. Azobenzene Modified Imidacloprid Derivatives as Photoswitchable Insecticides: Steering Molecular Activity in a Controllable Manner

    Science.gov (United States)

    Xu, Zhiping; Shi, Lina; Jiang, Danping; Cheng, Jiagao; Shao, Xusheng; Li, Zhong

    2015-10-01

    Incorporating the photoisomerizable azobenzene into imidacloprid produced a photoswitchable insecticidal molecule as the first neonicotinoid example of remote control insecticide performance with spatiotemporal resolution. The designed photoswitchable insecticides showed distinguishable activity against Musca both in vivo and in vitro upon irradiation. Molecular docking study further suggested the binding difference of the two photoisomers. The generation of these photomediated insecticides provides novel insight into the insecticidal activity facilitating further investigation on the functions of insect nicotinic acetylcholine receptors and opens a novel way to control and study insect behavior on insecticide poisoning using light.

  17. Climate change, agricultural insecticide exposure, and risk for freshwater communities.

    Science.gov (United States)

    Kattwinkel, Mira; Kühne, Jan-Valentin; Foit, Kaarina; Liess, Matthias

    2011-09-01

    Climate change exerts direct effects on ecosystems but has additional indirect effects due to changes in agricultural practice. These include the increased use of pesticides, changes in the areas that are cultivated, and changes in the crops cultivated. It is well known that pesticides, and in particular insecticides, affect aquatic ecosystems adversely. To implement effective mitigation measures it is necessary to identify areas that are affected currently and those that will be affected in the future. As a consequence, we predicted potential exposure to insecticide (insecticide runoff potential, RP) under current conditions (1990) and under a model scenario of future climate and land use (2090) using a spatially explicit model on a continental scale, with a focus on Europe. Space-for-time substitution was used to predict future levels of insecticide application, intensity of agricultural land use, and cultivated crops. To assess the indirect effects of climate change, evaluation of the risk of insecticide exposure was based on a trait-based, climate-insensitive indicator system (SPEAR, SPEcies At Risk). To this end, RP and landscape characteristics that are relevant for the recovery of affected populations were combined to estimate the ecological risk (ER) of insecticides for freshwater communities. We predicted a strong increase in the application of, and aquatic exposure to, insecticides under the future scenario, especially in central and northern Europe. This, in turn, will result in a severe increase in ER in these regions. Hence, the proportion of stream sites adjacent to arable land that do not meet the requirements for good ecological status as defined by the EU Water Framework Directive will increase (from 33% to 39% for the EU-25 countries), in particular in the Scandinavian and Baltic countries (from 6% to 19%). Such spatially explicit mapping of risk enables the planning of adaptation and mitigation strategies including vegetated buffer strips and

  18. Organochlorine compounds in soils and sediments of the mountain Andean Lakes

    International Nuclear Information System (INIS)

    Borghini, Francesca; Grimalt, Joan O.; Sanchez-Hernandez, Juan C.; Barra, Ricardo; Garcia, Carlos J. Torres; Focardi, Silvano

    2005-01-01

    Semi-volatile organochlorine compounds (OC) were analyzed in remote Andean soils and lake sediments. The sampling sites covered a wide latitudinal gradient from 18 deg. S to 46 deg. S along Chile and an altitudinal gradient (10-4500 m). The concentrations were in the order of background levels, involving absence of major pollution sources in the high mountain areas. Significant correlations were found between log-transformed concentrations of hexachlorobenzene, α- and γ-hexachlorocyclohexane in soils and total organic content (TOC). In addition, TOC-normalized concentrations of the most volatile OC showed a significant linear dependence with air temperature. This good agreement points to temperature as a significant factor for the retention of long range transported OC in remote ecosystems such as the Andean mountains, although other variables should not be totally excluded. The highest concentrations of OCs were achieved in the sites located at highest altitude and lowest temperature of the dataset. - Distribution of persistent organochlorine compounds in the Andean Mountain lakes is influenced by temperature

  19. Contamination status and accumulation features of persistent organochlorines in pet dogs and cats from Japan

    International Nuclear Information System (INIS)

    Kunisue, Tatsuya; Nakanishi, Shigeyuki; Watanabe, Mafumi; Abe, Takao; Nakatsu, Susumu; Kawauchi, Sakio; Sano, Akihiko; Horii, Akira; Kano, Yasumasa; Tanabe, Shinsuke

    2005-01-01

    Concentrations of persistent organochlorines (OCs) such as polychlorinated dibenzo-p-dioxin (PCDDs), dibenzofurans (PCDFs), biphenyls, dichlorodiphenyltrichloroethane and their metabolites (DDTs), hexachlorocyclohexane isomers, hexachlorobenzene, and chlordane compounds were determined in genital organs of pet dogs and cats and pet foods from Japan. Levels of OCs in dogs were relatively lower than those in cats, while residue levels in their diets were almost similar, implying that accumulation and elimination mechanisms of these contaminants are different between dogs and cats. When bioconcentration factors (BCFs) were estimated from concentrations of OCs in dogs, cats, and their diets, BCFs of all the OCs except PCDD/DFs exceeded 1.0 in cats. On the other hand, in all the dogs, BCFs of DDTs were below 1.0, suggesting that dogs do not bioconcentrate DDTs. Furthermore, BCFs of all the OCs except PCDD/DFs in dogs were notably lower than those in cats, suggesting that dogs have higher metabolic and elimination capacity for these contaminants than cats. When residue levels of OCs in livers, adipose tissue, and genital organs of two pet dogs were examined, hepatic sequestration of PCDD/DFs and oxychlordane was observed. - Pet dogs may have higher metabolic and elimination capacity for organochlorines than pet cats

  20. Organochlorines in the Vaccares Lagoon trophic web (Biosphere Reserve of Camargue, France)

    Energy Technology Data Exchange (ETDEWEB)

    Roche, H., E-mail: helene.roche@u-psud.f [Ecologie, Systematique et Evolution, UMR8079 CNRS, Universite Paris-Sud, AgroParisTech, F91405 Orsay Cedex (France); Vollaire, Y.; Persic, A.; Buet, A. [Ecologie, Systematique et Evolution, UMR8079 CNRS, Universite Paris-Sud, AgroParisTech, F91405 Orsay Cedex (France); Oliveira-Ribeiro, C. [Departamento de Biologia Celular, Universidade Federal do Parana, Caixa Postal 19031, CEP: 81.531-990, Curitiba, PR (Brazil); Coulet, E. [Nature Reserve of Camargue, La Capeliere, F13200 Arles (France); Banas, D.; Ramade, F. [Ecologie, Systematique et Evolution, UMR8079 CNRS, Universite Paris-Sud, AgroParisTech, F91405 Orsay Cedex (France)

    2009-08-15

    During a decade (1996-2006), ecotoxicological studies were carried out in biota of the Vaccares Lagoon (Biosphere Reserve in Rhone Delta, France). A multicontamination was shown at all levels of the trophic web due to a direct bioconcentration of chemical from the medium combined with a food transfer. Here, the pollutants investigated were organochlorines, among which many compounds banned or in the course of prohibition (or restriction) (PCB, lindane, pp'-DDE, dieldrin, aldrin, heptachlor, endosulfan...) and some substances likely still used in the Rhone River basin (diuron, fipronil). The results confirmed the ubiquity of contamination. It proves to be chronic, variable and tends to regress; however contamination levels depend on the trophic compartment. A biomagnification process was showed. A comparison of investigation methods used in other Mediterranean wetlands provides basis of discussion, and demonstrates the urgent need of modelling to assess the ecotoxicological risk in order to improve the management of such protected areas. - The Vaccares Lagoon trophic web biomagnifies organochlorine pollutants.

  1. Organochlorine pollution in tropical rivers (Guadeloupe): Role of ecological factors in food web bioaccumulation

    Energy Technology Data Exchange (ETDEWEB)

    Coat, Sophie, E-mail: coatsophie@gmail.com [EA 926 DYNECAR, Laboratoire de Biologie Marine, UFR Sciences, Universite des Antilles et de la Guyane, BP592, 97159 Pointe-a-Pitre Cedex (France); Monti, Dominique, E-mail: dominique.monti@univ-ag.fr [EA 926 DYNECAR, Laboratoire de Biologie Marine, UFR Sciences, Universite des Antilles et de la Guyane, BP592, 97159 Pointe-a-Pitre Cedex (France); Legendre, Pierre, E-mail: pierre.legendre@umontreal.ca [Departement de Sciences Biologique, Universite de Montreal, C.P. 6128, succursale A, Montreal, Quebec H3C 3J7 (Canada); Bouchon, Claude, E-mail: claude.bouchon@univ-ag.fr [EA 926 DYNECAR, Laboratoire de Biologie Marine, UFR Sciences, Universite des Antilles et de la Guyane, BP592, 97159 Pointe-a-Pitre Cedex (France); Massat, Felix, E-mail: fmassat@ladrome.fr [LDA26, laboratoire Departemental d' Analyses de la Drome, 27 avenue Lautagne, 26000 Valence (France); Lepoint, Gilles, E-mail: g.lepoint@ulg.ac.be [MARE Centre, Laboratoire d' Oceanologie, Universite de Liege, Bat. B6, 4000 Sart Tilman, Belgique (Belgium)

    2011-06-15

    Concentrations of organochlorine pesticides and stable isotope ratios of nitrogen and carbon were measured in a tropical freshwater ecosystem to evaluate the contamination level of biota and examine the bioaccumulation patterns of pollutants through the food web. Chemical analyses showed a general and heavy contamination of the entire food web. They revealed the strong accumulation of pollutants by juveniles of diadromous fishes and shrimps, as they re-enter the river. The role of ecological factors in the bioaccumulation of pesticides was evaluated. Whereas the most persistent pollutants (chlordecone and monohydro-chlordecone) were related to the organisms diet and habitat, bioaccumulation of {beta}-HCH was only influenced by animal lipid content. The biomagnification potential of chlordecone through the food chain has been demonstrated. It highlighted the importance of trophic transfer in this compound bioaccumulation process. In contrast, bioconcentration by passive diffusion from water seemed to be the main exposure route of biota to {beta}-HCH. - Highlights: > We measured OC pesticides and stable isotope ratios in a tropical stream. > Results showed a strong and ubiquitous contamination of the entire food web. > Diadromous juveniles strongly accumulated pollutants when they re-enter the river. > The most persistent pollutant (chlordecone) was related to species diet and habitat. > {beta}-HCH was only influenced by animal lipid content. - This paper determines the bioaccumulation and transfer processes of organochlorine pesticides within the stream food web in Guadeloupe (Caribbean).

  2. Exposure to organochlorine pollutants and type 2 diabetes: a systematic review and meta-analysis.

    Directory of Open Access Journals (Sweden)

    Mengling Tang

    Full Text Available OBJECTIVE: Though exposure to organochlorine pollutants (OCPs is considered a risk factor for type 2 diabetes (T2DM, epidemiological evidence for the association remains controversial. A systematic review and meta-analysis was applied to quantitatively evaluate the association between exposure to OCPs and incidence of T2DM and pool the inconsistent evidence. DESIGN AND METHODS: Publications in English were searched in MEDLINE and WEB OF SCIENCE databases and related reference lists up to August 2013. Quantitative estimates and information regarding study characteristics were extracted from 23 original studies. Quality assessments of external validity, bias, exposure measurement and confounding were performed, and subgroup analyses were conducted to examine the heterogeneity sources. RESULTS: We retrieved 23 eligible articles to conduct this meta-analysis. OR (odds ratio or RR (risk ratio estimates in each subgroup were discussed, and the strong associations were observed in PCB-153 (OR, 1.52; 95% CI, 1.19-1.94, PCBs (OR, 2.14; 95% CI, 1.53-2.99, and p,p'-DDE (OR, 1.33; 95% CI, 1.15-1.54 based on a random-effects model. CONCLUSIONS: This meta-analysis provides quantitative evidence supporting the conclusion that exposure to organochlorine pollutants is associated with an increased risk of incidence of T2DM.

  3. A mechanistic overview of health associated effects of low levels of organochlorine and organophosphorous pesticides

    International Nuclear Information System (INIS)

    Androutsopoulos, Vasilis P.; Hernandez, Antonio F.; Liesivuori, Jyrki; Tsatsakis, Aristidis M.

    2013-01-01

    Organochlorine and organophosphate pesticides are compounds that can be detected in human populations as a result of occupational or residential exposure. Despite their occurrence in considerably low levels in humans, their biological effects are hazardous since they interact with a plethora of enzymes, proteins, receptors and transcription factors. In this review we summarize the cell and molecular effects of organochlorine and organophosphate pesticides with respect to their toxicity, with particular emphasis on glucose and lipid metabolism, their interaction with some members of the nuclear receptor family of ligand-activated transcription factors, including the steroid and peroxisome proliferator activated receptors that changes the expression of genes involved in lipid metabolism and xenobiotic detoxification. More importantly, evidence regarding the metabolic degradation of pesticides and their accumulation in tissues is presented. Potential non-cholinergic mechanisms after long-term low-dose organophosphate exposure resulting in neurodevelopmental outcomes and neurodegeneration are also addressed. We conclude that the mechanism of pesticide-mediated toxicity is a combination of various enzyme-inhibitory, metabolic and transcriptional events acting at the cellular and molecular level

  4. Specific accumulation of polychlorinated biphenyls and organochlorine pesticides in Japanese common squid as a bioindicator

    International Nuclear Information System (INIS)

    Ueno, D.; Inoue, S.; Ikeda, K.; Tanaka, H.; Yamada, H.; Tanabe, S.

    2003-01-01

    Japanese common squid is a suitable bioindicator for monitoring organochlorines pollution in waters around Japan. - Organochlorines (OCs) representing Persistent Organic Pollutants (POPs) such as PCBs (polychlorinated biphenyls), DDTs (DDT and its metabolites), CHLs (chlordane compounds), HCHs (hexachlorocyclohexane isomers) and HCB (hexachlorobenzene) were determined in the liver of Japanese common squid (Todarodes pacificus) collected from the waters around Japan (Japan Sea and western North Pacific Ocean). Among OCs concentrations, PCBs (upto 5600 ng/g lipid wt.) were the highest, and those of other OCs were in the order of DDT> CHLs > HCHs > HCB. Studies on growth trend and seasonal variation of OCs in this species suggest a rapid reflection of the pollution levels in seawater where and when they were collected, regardless of body-length and time of collection. These results indicate that Japanese common squid is a suitable bioindicator for monitoring OCs pollution in waters around Japan. With regard to the geographical distribution of OCs in this species collected from waters around Japan, OCs concentrations in specimens from Japan Sea were higher than those from the Pacific Ocean. This result might reflect some existing of local pollution sources of OCs around Japan Sea, and slower water exchange between Japan Sea and open ocean

  5. Organophosphorus and Organochlorine Pesticides Bioaccumulation by Eichhornia crassipes in Irrigation Canals in an Urban Agricultural System.

    Science.gov (United States)

    Mercado-Borrayo, B M; Cram Heydrich, Silke; Pérez, Irma Rosas; Hernández Quiroz, Manuel; De León Hill, Claudia Ponce

    2015-01-01

    A natural wetland in Mexico City Metropolitan Area is one of the main suppliers of crops and flowers, and in consequence its canals hold a high concentration of organochlorine (OC) and organophosphorus (OP) pesticides. There is also an extensive population of water hyacinth (Eichhornia crassipes), which is considered a plague; but literature suggests water hyacinth may be used as a phytoremediator. This study demonstrates bioaccumulation difference for the OC in vivo suggesting their bioaccumulation is ruled by their log K(ow), while all the OP showed bioaccumulation regardless of their log K(ow). The higher bioaccumulation factors (BAF) of the accumulated OC pesticides cannot be explained by their log K(ow), suggesting that the OC pesticides may also be transported passively into the plant. Translocation ratios showed that water hyacinth is an accumulating plant with phytoremediation potential for all organophosphorus pesticides studied and some organochlorine pesticides. An equation for free water surface wetlands with floating macrophytes, commonly used for the construction of water-cleaning wetlands, showed removal of the pesticides by the wetland with room for improvement with appropriate management.

  6. Distribution of organochlorine pesticides (OCPs) in conifer needles in the southeast Tibetan Plateau

    International Nuclear Information System (INIS)

    Yang Ruiqiang; Yao Tandong; Xu Baiqing; Jiang Guibin; Zheng Xiaoyan

    2008-01-01

    Twenty-nine conifer needles in mountain-valley areas from the southeastern Tibet were collected with altitude span from 1520 to 4340 m above sea level (m.a.s.l.). They were analyzed for organochlorine pesticides (OCPs), including hexachlorocyclohexanes (α-, β-, γ- and δ-HCH), dichlorodiphenyltrichloroethane (p,p'-DDE, p,p'-DDD, o,p'-DDT and p,p'-DDT) and hexachlorobenzene (HCB). Concentrations of OCPs in samples ranged from 0.69 to 4.3 ng/g, from 0.39 to 4.9 ng/g and from 1.9 to 20.5 ng/g (dry weight) for HCB, total HCHs and DDTs, respectively. The levels of DDTs found here were noticeably higher than those from other high mountainous regions. Composition of HCH isomers and DDTs was analyzed, and it was found that the high ratio of o,p'-DDT/p,p'-DDT might be caused by the application of dicofol in adjacent regions. A number of environmental factors controlling the distribution of OCPs in regional scale were also discussed in this paper. - Conifer needles in southeastern Tibet indicate several organochlorine pesticides are transported from the Indian continent by the southern Asian monsoon

  7. Influence of Breastfeeding Time on Levels of Organochlorine Pesticides in Human Milk of a Mexican Population.

    Science.gov (United States)

    Chávez-Almazán, Luis A; Diaz-Ortiz, Jesús; Alarcón-Romero, Mario; Davila-Vazquez, Gustavo; Saldarriaga-Noreña, Hugo; Sampedro-Rosas, Laura; López-Silva, Saúl; Santiago-Moreno, Agustín; Rosas-Acevedo, José L; Waliszewski, Stefan M

    2016-02-01

    This study was conducted with the objective of determining whether there is a depuration of organochlorine pesticides in breast milk according to breastfeeding time. In total, 171 samples from mothers that lived in the State of Guerrero, Mexico were analyzed. There was a weak negative relationship between pp'DDE (r = -0.216) and Σ-DDT (r = -0.222) concentrations with the days of lactation. In a comparison analysis, a statistically significant decrease of pp'DDT and pp'DDE levels was observed, as well as the Σ-DDT from the first to the fifth week of lactation. A reduction of 0.188 mg/kg lipid of pp'DDE and 0.181 mg/kg lipid of Σ-DDT per week was obtained. HCB, β-HCH and op'DDT concentrations were low and had no major fluctuations between subgroups. The low levels found and the observed reduction in time involve less exposure to the infant to these pollutants. Through this methodology changes in levels of certain organochlorine pesticides in various stages of human milk production may be shown.

  8. Organochlorine pesticides in soils of Mexico and the potential for soil-air exchange

    Energy Technology Data Exchange (ETDEWEB)

    Wong, Fiona [Centre for Atmospheric Research Experiments, Science and Technology Branch, Environment Canada, 6248 Eighth Line, Egbert, Ontario L01 1N0 (Canada); Department of Chemistry, University of Toronto Scarborough, 1265 Military Trail, Toronto, Ontario M1C 1A4 (Canada); Alegria, Henry A. [Department of Environmental Science, Policy and Geography, University of South Florida St. Petersburg, 140 7th Ave. S., St. Petersburg, FL 33701 (United States); Bidleman, Terry F., E-mail: terry.bidleman@ec.gc.c [Centre for Atmospheric Research Experiments, Science and Technology Branch, Environment Canada, 6248 Eighth Line, Egbert, Ontario L01 1N0 (Canada)

    2010-03-15

    The spatial distribution of organochlorine pesticides (OCs) in soils and their potential for soil-air exchange was examined. The most prominent OCs were the DDTs (Geometric Mean, GM = 1.6 ng g{sup -1}), endosulfans (0.16 ng g{sup -1}), and toxaphenes (0.64 ng g{sup -1}). DDTs in soils of southern Mexico showed fresher signatures with higher F{sub DDTe} = p,p'-DDT/(p,p'-DDT + p,p'-DDE) and more racemic o,p'-DDT, while the signatures in the central and northern part of Mexico were more indicative of aged residues. Soil-air fugacity fractions showed that some soils are net recipients of DDTs from the atmosphere, while other soils are net sources. Toxaphene profiles in soils and air showed depletion of Parlar 39 and 42 which suggests that soil is the source to the atmosphere. Endosulfan was undergoing net deposition at most sites as it is a currently used pesticide. Other OCs showed wide variability in fugacity, suggesting a mix of net deposition and volatilization. - Chemical profiles of residues and soil-air fugacities are used to assess the potential of soil as a source of organochlorine pesticides to the air of Mexico.

  9. Levels of organochlorine pesticides residues in human adipose tissue, data from Tabasco, Mexico.

    Science.gov (United States)

    Waliszewski, Stefan M; Caba, M; Rodríguez Díaz, S S; Saldarriaga-Noreña, H; Meza, E; Zepeda, R; Infanzón, R

    2012-11-01

    The objective of this study was to determine the levels of organochlorine pesticides HCB, α-β-γ-HCH, p,p'-DDE, o,p'-DDT and p,p'-DDT in 150 adipose tissue of inhabitants of Tabasco, Mexico. The following pesticides were detected: p,p'-DDE in 100% of samples at mean 1.034 mg/kg; p,p'-DDT in 96.7% at mean 0.116 mg/kg; o,p'-DDT in 78.7% at mean 0.022 mg/kg and β-HCH in 58.0% at mean 0.049 mg/kg. The pooled sample was divided according to sex of donors (75 female and 75 male). Significantly higher levels of all organochlorine pesticides in females were found. The sample was divided into three age's ranges (15-28, 29-45 and 46-84 years). The mean and median levels of β-HCH, p,p'-DDE and Σ-DDT increase significantly (p pesticide residues in Tabasco inhabitants is still observed, indicating sources of exposure to the pesticides.

  10. Organochlorine pesticides in soils of Mexico and the potential for soil-air exchange

    International Nuclear Information System (INIS)

    Wong, Fiona; Alegria, Henry A.; Bidleman, Terry F.

    2010-01-01

    The spatial distribution of organochlorine pesticides (OCs) in soils and their potential for soil-air exchange was examined. The most prominent OCs were the DDTs (Geometric Mean, GM = 1.6 ng g -1 ), endosulfans (0.16 ng g -1 ), and toxaphenes (0.64 ng g -1 ). DDTs in soils of southern Mexico showed fresher signatures with higher F DDTe = p,p'-DDT/(p,p'-DDT + p,p'-DDE) and more racemic o,p'-DDT, while the signatures in the central and northern part of Mexico were more indicative of aged residues. Soil-air fugacity fractions showed that some soils are net recipients of DDTs from the atmosphere, while other soils are net sources. Toxaphene profiles in soils and air showed depletion of Parlar 39 and 42 which suggests that soil is the source to the atmosphere. Endosulfan was undergoing net deposition at most sites as it is a currently used pesticide. Other OCs showed wide variability in fugacity, suggesting a mix of net deposition and volatilization. - Chemical profiles of residues and soil-air fugacities are used to assess the potential of soil as a source of organochlorine pesticides to the air of Mexico.

  11. Characteristic trend of persistent organochlorine contamination in wildlife from a tropical agricultural watershed, south India.

    Science.gov (United States)

    Ramesh, A; Tanabe, S; Kannan, K; Subramanian, A N; Kumaran, P; Tatsukawa, R

    1992-07-01

    The residue levels of persistent organochlorines, such as HCH (BHC: 1,2,3,4,5,6-hexachlorocyclohexane) isomers, DDT [1,1,1-trichloro-2,2-bis (p-chlorophenyl) ethane] compounds, PCBs (polychlorobiphenyls) and HCB (hexachlorobenzene), were measured in wildlife. The wildlife were sampled from terrestrial and aquatic habitats in and around the agricultural watershed of Parangipettai, South India. On the basis of overall concentrations sigma HCH ranked first followed by sigma DDT, sigma PCB and HCB, reflecting the increasing usage of HCH in recent years in India. The residue levels of organochlorines in birds varied according to their feeding habits and showed the following pattern: inland piscivores and scavengers greater than coastal piscivores greater than insectivores greater than omnivores greater than granivores. High levels of HCH and DDT residues were recorded in Pond heron and Cattle egret which feed in the agricultural fields. Comparison of HCH concentrations in fish and birds in the study area to other locations was made to further understand the dynamics of contaminant accumulation in tropical wildlife. Regarding birds, a wide variation in residue levels could be seen among various countries, with tropical regions registering high levels. In contrast, the variation is not prominent in the case of fish. The residue levels in fish measured in the present study were generally comparable to values reported from other locations. This suggests that the bioavailability of contaminants to the aquatic fauna is less due to the smaller flux and shorter residence time of these chemicals in the tropics.

  12. Northern Alabama colonies of the endangered grey bat Myotis grisescens: Organochlorine contamination and mortality

    Science.gov (United States)

    Clark, D.R.; Bagley, F.M.; Johnson, W.W.

    1988-01-01

    From 1976 to 1986, dead and dying grey bats Myotis grisescens and grey bat guano were collected from caves along the Tennessee River in northern Alabama to determine the possible role of organochlorine chemicals.sbd.in particular wastes from a former DDT manufacturing plant near Huntsville.sbd.in the mortalities. Concentrations of chemical residues in brains were less than known lethal levels: certain observations and analyses did indicate the possibility of past organochlorine-induced bat deaths. Levels of contaminants in bats declined slowly during the 10-year sampling period, but heavy residue burdens persist. The high ratio of DDD to DDE in residue from the former DDT plant made them identifiable as far as 140 km downriver. Grey bats concentrated chemical rsidues to higher levels and demonstrated the presence of these residues over much greater distances than did red-winged blackbirds Agelaius phoeniceus. Grey bats may be the most sensitive indicator available for monitoring the contamination from this former DDT manufacturing site.

  13. Organochlorine contaminants in complete clutches of Morelet's crocodile (Crocodylus moreletii) eggs from Belize

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Ted H. [Department of Chemistry and Biochemistry, University of Alaska Fairbanks, Fairbanks, AK 99775-6160 (United States); Canas, Jaclyn E. [Institute of Environmental and Human Health, Texas Tech University, Box 41163, Lubbock, TX 79409 (United States); Rainwater, Thomas R. [Institute of Environmental and Human Health, PO Box 764, Jefferson, TX 75657 (United States); Platt, Steven G. [Department of Math and Science, Oglala Lakota College, 490 Piya Wiconi Road, Kyle, SD, 57752 (United States); McMurry, Scott T. [Institute of Environmental and Human Health, Texas Tech University, Box 41163, Lubbock, TX 79409 (United States); Anderson, Todd A. [Institute of Environmental and Human Health, Texas Tech University, Box 41163, Lubbock, TX 79409 (United States)]. E-mail: todd.anderson@ttu.edu

    2006-11-15

    Seven complete clutches of Morelet's crocodile (Crocodylus moreletii) eggs were collected in northern Belize and examined for organochlorine (OC) pesticide residues. The primary OC detected, p,p-DDE, was found in every egg analyzed (n = 175). Other OCs detected included p,p-DDT, p,p-DDD, methoxychlor, aldrin, and endosulfan I. Concentrations of individual OCs ranged from 4 ppb (ng chemical/g egg wet weight) to greater than 500 ppb. A statistical evaluation of p,p-DDE levels in three complete clutches was used to derive the minimum number of eggs needed from a clutch to precisely determine the mean p,p-DDE concentration representative of that clutch. Sample sizes of 8 (80% confidence level) and 11 (90% confidence level) were determined to yield an accurate estimate of contaminant levels in a full clutch of eggs. The statistically recommended sample size of 11 eggs (at 90% confidence level) was successfully tested on the four additional clutches. -- Sampling the non-viable eggs of a clutch can provide a statistically reasonable estimation of both the organochlorine contaminant distribution and concentrations in that clutch.

  14. [Influence of organochlorine pesticides in wastewater on the soil along the channel].

    Science.gov (United States)

    Xu, Liang; Zhang, Cai-Xiang; Liu, Min; Liao, Xiao-Ping; Yao, Lin-Lin; Li, Jia-Le; Xiang, Qing-Qing

    2013-08-01

    Nine profile soil samples and two sewage water samples were collected from Xiaodian sewage irrigation area in Taiyuan city, concentrations of organochlorine pesticides (OCPs) were determined by the gas chromatography coupled with electron capture detector (GC-ECD) to analyze the influence of the leakage of sewage water. The result shows that OCPs in sewage water were mainly composed of HCHs. Concentrations of DDTs and other organochlorine pesticides were very low or out of the detection limit. Concentrations of sigmaOCPs and HCHs in eight profiles near irrigation channels to some extend decreased with the increasing of the linear distance off the channel, which shows influences of the leakage of sewage water on the soil nearby. Concentrations of HCHs clearly decreased with the increasing of soil depth in most profile soils. For the horizontal direction, concentrations of HCHs also decreased with the increasing of the linear distance off the channel. The correlation between HCHs and TOC was positive, but no correlation between pH and HCHs was found.

  15. Relationships between reproductive performance and organochlorine contaminants in great black-backed gulls (Larus marinus)

    International Nuclear Information System (INIS)

    Helberg, Morten; Bustnes, Jan Ove; Erikstad, Kjell Einar; Kristiansen, Kai Ove; Skaare, Janneche Utne

    2005-01-01

    The great black-backed gull Larus marinus is a top predator in subarctic and temperate marine ecosystems, and the aim of this study was to investigate if organochlorines (OCs) were related to reproductive performance in this species at the subarctic parts of the Norwegian Coast. We measured blood levels of various OCs in 53 breeding birds. The OC levels were relatively low compared to levels found in nearby arctic areas. In females, however, there was a significant positive relationship between blood concentrations of OCs, especially hexachlorobenzene (HCB) and, p,p'-dichlorodiphenyldichloroethylene (DDE), and egg laying date, and a positive relationship between the probability of nest predation and blood concentration of β-hexachlorocyclohexane (β-HCH), oxychlordane, and DDE. In females with high levels of OCs, especially persistent polychlorinated biphenyls (PCBs), there was also a decline in egg volume as egg laying progressed; i.e. the second and third laid egg were relatively smaller, compared to females with low OC levels. No relationships between reproductive parameters and OC levels were found in males. - Elevated blood concentrations of organochlorine contaminants correlate with poor reproductive performance in female great black-backed gulls

  16. Uptake of polychlorinated biphenyls and organochlorine pesticides from soil and air into radishes (Raphanus sativus)

    Energy Technology Data Exchange (ETDEWEB)

    Mikes, Ondrej; Cupr, Pavel [RECETOX, Research Centre for Environmental Chemistry and Ecotoxicology, Masaryk University, Kamenice 126/3, 625 00 Brno (Czech Republic); Trapp, Stefan [Department of Environmental Engineering, Technical University of Denmark, Miljoevej 113, DK-2800 Kgs. Lyngby (Denmark); Klanova, Jana [RECETOX, Research Centre for Environmental Chemistry and Ecotoxicology, Masaryk University, Kamenice 126/3, 625 00 Brno (Czech Republic)], E-mail: klanova@recetox.muni.cz

    2009-02-15

    Uptake of organochlorine pesticides and polychlorinated biphenyls from soil and air into radishes was measured at a heavily contaminated field site. The highest contaminant concentrations were found for DDT and its metabolites, and for {beta}-hexachlorocyclohexane. Bioconcentration factor (BCF, defined as a ratio between the contaminant concentration in the plant tissue and concentration in soil) was determined for roots, edible bulbs and shoots. Root BCF values were constant and not correlated to log K{sub OW}. A negative correlation between BCF and log K{sub OW} was found for edible bulbs. Shoot BCF values were rather constant and varied between 0.01 and 0.22. Resuspended soil particles may facilitate the transport of chemicals from soil to shoots. Elevated POP concentrations found in shoots of radishes grown in the control plot support the hypothesis that the uptake from air was more significant for shoots than the one from soil. The uptake of POPs from air was within the range of theoretical values predicted from log K{sub OA}. - Uptake from air represented for majority of persistent organochlorines a dominant pathway into shoots while uptake from soil was dominant for roots.

  17. Organochlorine pesticides in follicular fluid of women undergoing assisted reproductive technologies from central China

    International Nuclear Information System (INIS)

    Zhu, Yindi; Huang, Bo; Li, Qing X.; Wang, Jun

    2015-01-01

    Female infertility rates have increased by approximately 4% since the 1980s. There is evidence of adverse effects on female fertility in relation to exposure of chemical pollution in recent years. Follicular fluid samples were collected from 127 woman patients (aged 20–35) who underwent assisted reproductive technologies (ART) and had no records indicating occupational exposure to OCPs. Seventeen OCPs were analyzed in this study. The results showed that methoxychlor was dominant, accounted for 13.4% of total OCPs with a mean concentration of 167.9 ± 33.9 ng/g lipid weight (lw), followed by heptachlor-epoxide, hexachlorocyclohexanes, endrin and DDT. The concentrations of OCPs in the follicular fluid samples in the present study were moderate in comparison with those reported from developed or industrialized countries. All these pollutants can accumulate in different tissues of human body through diet, drinking water and respiration. No correlation between patient age and OCP concentrations was observed in this study. - Highlights: • 17 OCPs in follicular fluid samples from 127 woman patients were analyzed. • Methoxychlor was the most dominant, constituting 13.4% of total OCPs with a mean concentration of 168 ng/g lw. • The concentrations of DDT and HCHs were lower than those in human breast milk from Russia and Iran and blood from India. • DDTs and HCHs in the samples would be mainly from historical usage. • The correlation between patient ages and concentrations of OCPs was weak. - OCPs at median concentrations of 460.0–2927.2 ng/g lipid weight in follicular fluids of central China have physiological effects.

  18. Plant compounds insecticide activity against Coleoptera pests of stored products

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal]. E-mail: marcio.dionizio@gmail.com; picanco@ufv.br; guedes@ufv.br; mateusc3@yahoo.com.br; agronomiasilva@yahoo.com.br

    2007-07-15

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD{sub 50} from 2.72 to 39.71 mg g{sup -1} a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  19. Insecticide mixtures for mosquito net impregnation against malaria vectors

    Directory of Open Access Journals (Sweden)

    Corbel V.

    2002-09-01

    Full Text Available Insecticides belonging to the pyrethroid family are the only compounds currently available for the treatment of mosquito nets. Unfortunately, some malaria vector species have developed resistance to pyrethroids and the lack of alternative chemical categories is a great concern. One strategy for resistance management would be to treat mosquito nets with a mixture associating two insecticides having different modes of action. This study presents the results obtained with insecticide mixtures containing several proportions of bifenthrin (a pyrethroid insecticide and carbosulfan (a carbamate insecticide. The mixtures were sprayed on mosquito net samples and their efficacy were tested against a susceptible strain of Anopheles gambiae, the major malaria vector in Africa. A significant synergism was observed with a mixture containing 25 mg/m2 of bifenthrin (half the recommended dosage for treated nets and 6.25 mg/m2 of carbosulfan (about 2 % of the recommended dosage. The observed mortality was significantly more than expected in the absence of any interaction (80 % vs 41 % and the knock-down effect was maintained, providing an effective barrier against susceptible mosquitoes.

  20. Mass spectrometric analyses of organophosphate insecticide oxon protein adducts.

    Science.gov (United States)

    Thompson, Charles M; Prins, John M; George, Kathleen M

    2010-01-01

    Organophosphate (OP) insecticides continue to be used to control insect pests. Acute and chronic exposures to OP insecticides have been documented to cause adverse health effects, but few OP-adducted proteins have been correlated with these illnesses at the molecular level. Our aim was to review the literature covering the current state of the art in mass spectrometry (MS) used to identify OP protein biomarkers. We identified general and specific research reports related to OP insecticides, OP toxicity, OP structure, and protein MS by searching PubMed and Chemical Abstracts for articles published before December 2008. A number of OP-based insecticides share common structural elements that result in predictable OP-protein adducts. The resultant OP-protein adducts show an increase in molecular mass that can be identified by MS and correlated with the OP agent. Customized OP-containing probes have also been used to tag and identify protein targets that can be identified by MS. MS is a useful and emerging tool for the identification of proteins that are modified by activated organophosphate insecticides. MS can characterize the structure of the OP adduct and also the specific amino acid residue that forms the key bond with the OP. Each protein that is modified in a unique way by an OP represents a unique molecular biomarker that with further research can lead to new correlations with exposure.

  1. Insecticides promote viral outbreaks by altering herbivore competition.

    Science.gov (United States)

    Pan, Huipeng; Preisser, Evan L; Chu, Dong; Wang, Shaoli; Wu, Qingjun; Carriére, Yves; Zhou, Xuguo; Zhang, Youjun

    2015-09-01

    While the management of biological invasions is often characterized by a series of single-specieg decisions, invasive species exist within larger food webs. These biotic interactions can alter the impact of control/eradication programs and may cause suppression efforts to inadvertently facilitate invasion spread and impact. We document the rapid replacement of the invasive Bemisia Middle East-Asia Minor I (MEAM1) cryptic biotype by the cryptic Mediterranean (MED) biotype throughout China and demonstrate that MED is more tolerant of insecticides and a better vector of tomato yellow leaf curl virus (TYLCV) than MEAMJ. While MEAM1 usually excludes MED under natural conditions, insecticide application reverses the MEAM1-MED competitive hierarchy and allows MED to exclude MEAMI. The insecticide-mediated success of MED has led to TYLCV outbreaks throughout China. Our work strongly supports the hypothesis that insecticide use in China reverses the MEAMl-MED competitive hierarchy and allows MED to displace MEAM1 in managed landscapes. By promoting the dominance of a Bemisia species that is a competent viral vector, insecticides thus increase the spread and impact of TYLCV in heterogeneous agroecosystems.

  2. The global status of insect resistance to neonicotinoid insecticides.

    Science.gov (United States)

    Bass, Chris; Denholm, Ian; Williamson, Martin S; Nauen, Ralf

    2015-06-01

    The first neonicotinoid insecticide, imidacloprid, was launched in 1991. Today this class of insecticides comprises at least seven major compounds with a market share of more than 25% of total global insecticide sales. Neonicotinoid insecticides are highly selective agonists of insect nicotinic acetylcholine receptors and provide farmers with invaluable, highly effective tools against some of the world's most destructive crop pests. These include sucking pests such as aphids, whiteflies, and planthoppers, and also some coleopteran, dipteran and lepidopteran species. Although many insect species are still successfully controlled by neonicotinoids, their popularity has imposed a mounting selection pressure for resistance, and in several species resistance has now reached levels that compromise the efficacy of these insecticides. Research to understand the molecular basis of neonicotinoid resistance has revealed both target-site and metabolic mechanisms conferring resistance. For target-site resistance, field-evolved mutations have only been characterized in two aphid species. Metabolic resistance appears much more common, with the enhanced expression of one or more cytochrome P450s frequently reported in resistant strains. Despite the current scale of resistance, neonicotinoids remain a major component of many pest control programmes, and resistance management strategies, based on mode of action rotation, are of crucial importance in preventing resistance becoming more widespread. In this review we summarize the current status of neonicotinoid resistance, the biochemical and molecular mechanisms involved, and the implications for resistance management. Copyright © 2015 Elsevier Inc. All rights reserved.

  3. Insecticidal and Nematicidal Activities of Novel Mimosine Derivatives

    Directory of Open Access Journals (Sweden)

    Binh Cao Quan Nguyen

    2015-09-01

    Full Text Available Mimosine, a non-protein amino acid, is found in several tropical and subtropical plants, which has high value for medicine and agricultural chemicals. Here, in continuation of works aimed to development of natural product-based pesticidal agents, we present the first significant findings for insecticidal and nematicidal activities of novel mimosine derivatives. Interestingly, mimosinol and deuterated mimosinol (D-mimosinol from mimosine had strong insecticidal activity which could be a result of tyrosinase inhibition (IC50 = 31.4 and 46.1 μM, respectively. Of synthesized phosphoramidothionate derivatives from two these amino alcohols, two compounds (1a and 1b showed high insecticidal activity (LD50 = 0.5 and 0.7 μg/insect, respectively with 50%–60% mortality at 50 μg/mL which may be attributed to acetylcholinesterase inhibition. Compounds 1a and 1b also had strong nematicidal activity with IC50 = 31.8 and 50.2 μM, respectively. Our results suggest that the length of the alkyl chain and the functional group at the C5-position of phosphoramidothionates derived from mimosinol and d-mimosinol are essential for the insecticidal and nematicidal activities. These results reveal an unexplored scaffold as new insecticide and nematicide.

  4. Plant compounds insecticide activity against Coleoptera pests of stored products

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal; br, picanco@ufv; br, guedes@ufv; br, mateusc3@yahoo com; br, agronomiasilva@yahoo com

    2007-07-15

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD{sub 50} from 2.72 to 39.71 mg g{sup -1} a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  5. Plant compounds insecticide activity against Coleoptera pests of stored products

    International Nuclear Information System (INIS)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio; julioufv@yahoo.com.br

    2007-01-01

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD 50 from 2.72 to 39.71 mg g -1 a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  6. An insecticidal toxin from Nephila clavata spider venom.

    Science.gov (United States)

    Jin, Lin; Fang, Mingqian; Chen, Mengrou; Zhou, Chunling; Ombati, Rose; Hakim, Md Abdul; Mo, Guoxiang; Lai, Ren; Yan, Xiuwen; Wang, Yumin; Yang, Shilong

    2017-07-01

    Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on Na V and K V channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.

  7. A SIMPLE AND FAST EXTRACTION METHOD FOR ORGANOCHLORINE PESTICIDES AND POLYCHLORINATED BIPHENYLS IN SMALL VOLUMES OF AVIAN SERUM

    Science.gov (United States)

    A solid-phase extraction (SPE) method was developed using 8 M urea to desorb and extract organochlorine pesticides (OCs) and polychlorinated biphenyls (PCBs) from avian serum for analysis by capillary gas chromatography with electron capture detection (GC-ECD). The analytes were ...

  8. Accumulation of organochlorines and brominated flame retardants in estuarine and marine food chains: Field measurements and model calculations

    NARCIS (Netherlands)

    Veltman, K.; Hendriks, J.; Huijbregts, M.; Leonards, P.E.G.; Heuvel-Greve, van den M.J.; Vethaak, D.

    2005-01-01

    Food chain accumulation of organochlorines and brominated flame retardants in estuarine and marine environments is compared to model estimations and fresh water field data. The food chain consists of herbivores, detritivores and primary and secondary carnivores i.e. fish, fish-eating birds and

  9. Body mass index in young school-age children in relation to organochlorine compounds in early life

    DEFF Research Database (Denmark)

    Høyer, B B; Ramlau-Hansen, C H; Henriksen, T B

    2014-01-01

    OBJECTIVE: To investigate the association between maternal pregnancy and estimated postnatal serum concentrations of the organochlorines 2,2',4,4',5,5'-hexachlorobiphenyl (CB-153) and 1,1-dichloro-2,2-bis(p-chlorophenyl)ethylene (p,p'-DDE) and body mass index (BMI) z-scores in 5- to 9-year-old ch...

  10. Concentrations of persistent organochlorine compounds in human milk and placenta are higher in Denmark than in Finland

    DEFF Research Database (Denmark)

    Shen, H.; Main, K.M.; Andersson, A.M.

    2008-01-01

    , oxychlordane (OXC), cis-heptachloroepoxide (c-HE) and 1,1,1-trichloro-2,2-bis(4-chlorophenyl)ethane (p,p'-DDT) were the other main organochlorines detected. Danish samples had significantly higher concentrations of p,p'-DDE, p,p'-DDT, beta-HCH, HCB, dieldrin, c-HE and OXC than did the Finnish samples. Levels...

  11. Levels of Organochlorine Pesticides in Blood Plasma from Residents of Malaria-Endemic Communities in Chiapas, Mexico

    NARCIS (Netherlands)

    Ruiz-Suarez, L.E.; Castro-Chan, R.A.; Rivero-Perez, N.E.; Trejo-Acevedo, A.; Guillen-Navarro, G.K.; Geissen, V.; Bello-Mendoza, R.

    2014-01-01

    Organochlorine (OC) pesticides have been extensively used for pest control in agriculture and against malaria vectors in the region of Soconusco, Chiapas, in southern Mexico. Our study aimed to identify whether the inhabitants of four Soconusco communities at different locations (i.e., altitudes)

  12. Organochlorine pesticides (OCPs) and polychlorinated biphenyls (PCBs) in sediments from the Gulf of Batabanó, Cuba.

    Science.gov (United States)

    Alonso-Hernandez, C M; Mesa-Albernas, M; Tolosa, I

    2014-01-01

    The spatial distribution of various organochlorinated compounds, e.g. PCBs, DDTs, HCB and HCHs, were investigated in sediments of the Gulf of Batabanó, Cuba. Among the target organochlorine compounds measured, ΣDDT isomers were the predominant contaminant with concentrations ranging from 0.019 to 1.27 ng g(-1)dry wt. Lindane was present at very low concentrations in the range n.d. to 0.05 ng g(-1), while PCBs and other organochlorine pesticide residues, such as HCB, Heptaclor, Aldrin and Mirex were lower than detection limits (∼0.010 ng g(-1)). According to established sediment quality guidelines, the OCPs concentrations encountered in the surface sediments are probably not having an adverse effect on sediment dwelling organisms. Compared to concentrations reported in coastal environments from other parts of the world, PCBs and OCs concentrations in surface sediments of Batabanó Gulf were low and similar to the reported for remote and pristine environments. These results contribute to the sparse regional database for organochlorinated compounds in the Caribbean marine environment. Copyright © 2013. Published by Elsevier Ltd.

  13. Intermediate Syndrome Following Organophosphate Insecticide Poisoning

    Directory of Open Access Journals (Sweden)

    Chen-Chang Yang

    2007-11-01

    Full Text Available Acute organophosphate insecticide poisoning can manifest 3 different phases of toxic effects, namely, acute cholinergic crisis, intermediate syndrome (IMS, and delayed neuropathy. Among them, IMS has been considered as a major contributing factor of organophosphate-related morbidity and mortality because of its frequent occurrence and probable consequence of respiratory failure. Despite a high incidence, the pathophysiology that underlies IMS remains unclear. Previously proposed mechanisms of IMS include different susceptibility of various cholinergic receptors, muscle necrosis, prolonged acetylcholinesterase inhibition, inadequate oxime therapy, downregulation or desensitization of postsynaptic acetylcholine receptors, failure of postsynaptic acetylcholine release, and oxidative stress-related myopathy. The clinical manifestations of IMS typically occur within 24 to 96 hours, affecting conscious patients without cholinergic signs, and involve the muscles of respiration, proximal limb muscles, neck flexors, and muscles innervated by motor cranial nerves. With appropriate therapy that commonly includes artificial respiration, complete recovery develops 5–18 days later. Patients with atypical manifestations of IMS, especially a relapse or a continuum of acute cholinergic crisis, however, were frequently reported in clinical studies of IMS. The treatment of IMS is mainly supportive. Nevertheless, because IMS generally concurs with severe organophosphate toxicity and persistent inhibition of acetylcholinesterase, early aggressive decontamination, appropriate antidotal therapy, and prompt institution of ventilatory support should be helpful in ameliorating the magnitude and/or the incidence of IMS. Although IMS is well recognized as a disorder of neuromuscular junctions, its exact etiology, incidence, and risk factors are not clearly defined because existing studies are largely small-scale case series and do not employ a consistent and rigorous

  14. Influence on sensitivity to insecticides: a case study of a settled area ...

    African Journals Online (AJOL)

    monitoring for successful alternative insecticides. There are currently two ... behaviour or modification avoid landing on insecticide .... aquarium fish food18. When they .... National Statistical Office (NSO) Malawi Government 1998 Census. 16.

  15. Mechanistic modeling of insecticide risks to breeding birds in North American agroecosystems

    Science.gov (United States)

    Insecticide usage in the United States is ubiquitous in urban, suburban, and rural environments. In evaluating data for an insecticide registration application and for registration review, scientists at the United States Environmental Protection Agency (USEPA) assess the fate of ...

  16. Influence of Pyrethroid Insecticides on Sodium and Calcium Influx in Neocortical Neurons

    Science.gov (United States)

    Pyrethroid insecticides bind to voltage-gated sodium channels and modify their gating kinetics, thereby disrupting neuronal function. Using murine neocortical neurons in primary culture, we have compared the ability of 11 structurally diverse pyrethroid insecticides to evoke Na+ ...

  17. Efficacy of an insecticide paint against insecticide-susceptible and resistant mosquitoes - Part 1: Laboratory evaluation

    Directory of Open Access Journals (Sweden)

    Carnevale Pierre

    2010-11-01

    Full Text Available Abstract Background The main malaria vector Anopheles gambiae and the urban pest nuisance Culex quinquefasciatus are increasingly resistant to pyrethroids in many African countries. There is a need for new products and strategies. Insecticide paint Inesfly 5A IGR™, containing two organophosphates (OPs, chlorpyrifos and diazinon, and insect growth regulator (IGR, pyriproxyfen, was tested under laboratory conditions for 12 months following WHOPES Phase I procedures. Methods Mosquitoes used were laboratory strains of Cx. quinquefasciatus susceptible and resistant to OPs. The paint was applied at two different doses (1 kg/6 m2 and 1 kg/12 m2 on different commonly used surfaces: porous (cement and stucco and non-porous (softwood and hard plastic. Insecticide efficacy was studied in terms of delayed mortality using 30-minute WHO bioassay cones. IGR efficacy on fecundity, fertility and larval development was studied on OP-resistant females exposed for 30 minutes to cement treated and control surfaces. Results After treatment, delayed mortality was high (87-100% even against OP-resistant females on all surfaces except cement treated at 1 kg/12 m2. Remarkably, one year after treatment delayed mortality was 93-100% against OP-resistant females on non-porous surfaces at both doses. On cement, death rates were low 12 months after treatment regardless of the dose and the resistance status. Fecundity, fertility and adult emergence were reduced after treatment even at the lower dose (p -3. A reduction in fecundity was still observed nine months after treatment at both doses (p -3 and adult emergence was reduced at the higher dose (p -3. Conclusions High mortality rates were observed against laboratory strains of the pest mosquito Cx. quinquefasciatus susceptible and resistant to insecticides. Long-term killing remained equally important on non-porous surfaces regardless the resistance status for over 12 months. The paint's effect on fecundity, fertility and

  18. Insecticide resistance in the western flower thrips, Frankliniella occidentalis

    DEFF Research Database (Denmark)

    Jensen, Sten Erik

    of acetylcholinesterase, the target site enzyme for methiocarb. The results from bioassays with synergists included indicated involvement of cytochrome P450- monooxygenases and esterases in methiocarb resistance in the most resistant populations. Selection with methiocarb on one of the populations to increase the level......The western flower thrips, Frankliniella occidentalis (Pergande) is a serious pest on a wide range of crops throughout the world. In Denmark F. occidentalis is a pest in greenhouses. F. occidentalis is difficult to control with insecticides because of its thigmokinetic behaviour and resistance...... to insecticides. Since F. occidentulis spread to become a worldwide pest in 1980’es, resistance to a number of different insecticides has been shown in many populations of F. occidentalis. This flower thrips has the potential of fast development of resistance owing to the short generation time, high fecundity...

  19. POTENTIATION OF COPAÍBA OIL-RESIN WITH SYNTHETIC INSECTICIDES TO CONTROL OF FALL ARMYWORM

    OpenAIRE

    ALMEIDA, WALDIANE ARAÚJO DE; SILVA, IGOR HONORATO LEDUÍNO DA; SANTOS, ANA CLÁUDIA VIEIRA DOS; BARROS JÚNIOR, AURÉLIO PAES; SOUSA, ADALBERTO HIPÓLITO DE

    2017-01-01

    ABSTRACT The control of Spodoptera frugiperda (J. E. SMITH) (Lepidoptera: Noctuidae) has been carried out mainly with pyrethroids and organophosphates insecticides. The continuous and indiscriminate use of synthetic insecticides, for decades, has led to the selection of resistant populations and has caused concerns for human health and the environment. An alternative is the use of botanical insecticides, including through the mixtures with synthetic insecticides. This study aimed to investiga...

  20. Optimal Cotton Insecticide Application Termination Timing: A Meta-Analysis.

    Science.gov (United States)

    Griffin, T W; Zapata, S D

    2016-08-01

    The concept of insecticide termination timing is generally accepted among cotton (Gossypium hirsutum) researchers; however, exact timings are often disputed. Specifically, there is uncertainty regarding the last economic insecticide application to control fruit-feeding pests including tarnished plant bug (Lygus lineolaris (Palisot de Beauvois)), boll weevil (Anthonomus grandis), bollworm (Helicoverpa zea), tobacco budworm (Heliothis virescens), and cotton fleahopper (Pseudatomoscelis seriatus). A systematic review of prior studies was conducted within a meta-analytic framework. Nine publicly available articles were amalgamated to develop an optimal timing principle. These prior studies reported 53 independent multiple means comparison field experiments for a total of 247 trial observations. Stochastic plateau theory integrated with econometric meta-analysis methodology was applied to the meta-database to determine the shape of the functional form of both the agronomic optimal insecticide termination timing and corresponding yield potential. Results indicated that current university insecticide termination timing recommendations are later than overall estimated timing suggested. The estimated 159 heat units (HU) after the fifth position above white flower (NAWF5) was found to be statistically different than the 194 HU termination used as the status quo recommended termination timing. Insecticides applied after 159 HU may have been applied in excess, resulting in unnecessary economic and environmental costs. Empirical results also suggested that extending the insecticide termination time by one unit resulted in a cotton lint yield increase of 0.27 kilograms per hectare up to the timing where the plateau began. Based on economic analyses, profit-maximizing producers may cease application as soon as 124 HU after NAWF5. These results provided insights useful to improve production systems by applying inputs only when benefits were expected to be in excess of the

  1. Insecticide resistance in vector Chagas disease: evolution, mechanisms and management.

    Science.gov (United States)

    Mougabure-Cueto, Gastón; Picollo, María Inés

    2015-09-01

    Chagas disease is a chronic parasitic infection restricted to America. The disease is caused by the protozoa Trypanosoma cruzi, which is transmitted to human through the feces of infected triatomine insects. Because no treatment is available for the chronic forms of the disease, vector chemical control represents the best way to reduce the incidence of the disease. Chemical control has been based principally on spraying dwellings with insecticide formulations and led to the reduction of triatomine distribution and consequent interruption of disease transmission in several areas from endemic region. However, in the last decade it has been repeatedly reported the presence triatomnes, mainly Triatoma infestans, after spraying with pyrethroid insecticides, which was associated to evolution to insecticide resistance. In this paper the evolution of insecticide resistance in triatomines is reviewed. The insecticide resistance was detected in 1970s in Rhodnius prolixus and 1990s in R. prolixus and T. infestans, but not until the 2000s resistance to pyrthroids in T. infestans associated to control failures was described in Argentina and Bolivia. The main resistance mechanisms (i.e. enhanced metabolism, altered site of action and reduced penetration) were described in the T. infestans resistant to pyrethrods. Different resistant profiles were demonstrated suggesting independent origin of the different resistant foci of Argentina and Bolivia. The deltamethrin resistance in T. infestans was showed to be controlled by semi-dominant, autosomally inherited factors. Reproductive and developmental costs were also demonstrated for the resistant T. infestans. A discussion about resistance and tolerance concepts and the persistence of T. infestans in Gran Chaco region are presented. In addition, theoretical concepts related to toxicological, evolutionary and ecological aspects of insecticide resistance are discussed in order to understand the particular scenario of pyrethroid

  2. Field and Laboratory Evaluations of Insecticides for Southern Pine Beetle Control

    Science.gov (United States)

    Felton L. Hastings; Jack E. Coster; [Editors

    1981-01-01

    Reports results of laboratory screenings and field studies of insecticides for use against the southern pine beetle. Preventive as webas remedial efficacywere observed, along with phytotoxicity to pine and understory hardwood species, effects of insecticides on soil microbial and mesofaunal populations, and degradation of insecticides by selected soil microbes.

  3. Insecticide applications to soil contribute to the development of Burkholderia mediating insecticide resistance in stinkbugs.

    Science.gov (United States)

    Tago, Kanako; Kikuchi, Yoshitomo; Nakaoka, Sinji; Katsuyama, Chie; Hayatsu, Masahito

    2015-07-01

    Some soil Burkholderia strains are capable of degrading the organophosphorus insecticide, fenitrothion, and establish symbiosis with stinkbugs, making the host insects fenitrothion-resistant. However, the ecology of the symbiotic degrading Burkholderia adapting to fenitrothion in the free-living environment is unknown. We hypothesized that fenitrothion applications affect the dynamics of fenitrothion-degrading Burkholderia, thereby controlling the transmission of symbiotic degrading Burkholderia from the soil to stinkbugs. We investigated changes in the density and diversity of culturable Burkholderia (i.e. symbiotic and nonsymbiotic fenitrothion degraders and nondegraders) in fenitrothion-treated soil using microcosms. During the incubation with five applications of pesticide, the density of the degraders increased from less than the detection limit to around 10(6)/g of soil. The number of dominant species among the degraders declined with the increasing density of degraders; eventually, one species predominated. This process can be explained according to the competitive exclusion principle using V(max) and K(m) values for fenitrothion metabolism by the degraders. We performed a phylogenetic analysis of representative strains isolated from the microcosms and evaluated their ability to establish symbiosis with the stinkbug Riptortus pedestris. The strains that established symbiosis with R. pedestris were assigned to a cluster including symbionts commonly isolated from stinkbugs. The strains outside the cluster could not necessarily associate with the host. The degraders in the cluster predominated during the initial phase of degrader dynamics in the soil. Therefore, only a few applications of fenitrothion could allow symbiotic degraders to associate with their hosts and may cause the emergence of symbiont-mediated insecticide resistance. © 2015 John Wiley & Sons Ltd.

  4. Assessment of organochlorine hydrocarbons transformation in contaminated agricultural products and foodstuffs under gamma-radiation

    Science.gov (United States)

    Mel'nikova, T. V.; Polyakova, L. P.; Oudalova, A. A.

    2017-01-01

    The problem of an estimation of organochlorinated pollutants transformation (particularly organochlorinated pesticides (OCP) and polychlorinated biphenyls (PCB)) under gamma-irradiation has become important in connection with radiation technologies application in the food industry. According to earlier researches, small doses of OCP lead to serious damages of an organism, comparable with damages from high doses. Among radiolysis products of OCP in model solutions various substances on a structure have been found out. Though of trace concentration of each of them, in sum with the initial pesticides residue they make up significant of mass contamination (as shown earlier up to 90% from initial OCP). In this work fish samples (bream) containing OCPs (15.20 ng/g of hexachlorocyclohexane isomers and 87.10 ng/g of DDT and its metabolites), as well as PCB (18.51 ng/g) were studied. The minced fish was irradiated at dose of 10 kGy with dose rate of 1.35 Gy/sec. Then, by methods of gas-liquid chromatography (GLC) and gas chromatography-mass spectrometry (GC-MS), it was found that the OCPs degradation varied from 3 up to 61% and the PCB degradation - 24-52%. Significant complication of chemical composition was shown comparing to the primary biological sample contamination. As a result of fish irradiation, secondary pollution appeared that included residues of primary organochlorine hydrocarbons and their radiation-induced metabolites. Among the investigated OCPs the most stable proved to be alfa-hexachlorocyclohexane (alfa-HCH), the least stable - DDT which corresponds to the previous findings about the radiation stability of OCPs in model solutions. Mass spectra of the irradiated samples of minced bream showed the presence of radiation metabolites of OCPs, that had also been found at irradiation of model solutions of 2,2-di(4-chlorophenyl)-1-chlorethylene (DDMU), DDD and 1a, 2e, 3e, 4e, 5e-pentahlorcyclohexane. There was revealed a decomposition product formed during the

  5. Assessment of organochlorine hydrocarbons transformation in contaminated agricultural products and foodstuffs under gamma-radiation

    International Nuclear Information System (INIS)

    Mel’nikova, T V; Polyakova, L P; Oudalova, A A

    2017-01-01

    The problem of an estimation of organochlorinated pollutants transformation (particularly organochlorinated pesticides (OCP) and polychlorinated biphenyls (PCB)) under gamma-irradiation has become important in connection with radiation technologies application in the food industry. According to earlier researches, small doses of OCP lead to serious damages of an organism, comparable with damages from high doses. Among radiolysis products of OCP in model solutions various substances on a structure have been found out. Though of trace concentration of each of them, in sum with the initial pesticides residue they make up significant of mass contamination (as shown earlier up to 90% from initial OCP). In this work fish samples (bream) containing OCPs (15.20 ng/g of hexachlorocyclohexane isomers and 87.10 ng/g of DDT and its metabolites), as well as PCB (18.51 ng/g) were studied. The minced fish was irradiated at dose of 10 kGy with dose rate of 1.35 Gy/sec. Then, by methods of gas-liquid chromatography (GLC) and gas chromatography-mass spectrometry (GC-MS), it was found that the OCPs degradation varied from 3 up to 61% and the PCB degradation – 24-52%. Significant complication of chemical composition was shown comparing to the primary biological sample contamination. As a result of fish irradiation, secondary pollution appeared that included residues of primary organochlorine hydrocarbons and their radiation-induced metabolites. Among the investigated OCPs the most stable proved to be alfa-hexachlorocyclohexane (alfa-HCH), the least stable – DDT which corresponds to the previous findings about the radiation stability of OCPs in model solutions. Mass spectra of the irradiated samples of minced bream showed the presence of radiation metabolites of OCPs, that had also been found at irradiation of model solutions of 2,2-di(4-chlorophenyl)-1-chlorethylene (DDMU), DDD and 1a, 2e, 3e, 4e, 5e-pentahlorcyclohexane. There was revealed a decomposition product formed during

  6. Data on Occurrence of Selected Trace Metals, Organochlorines, and Semivolatile Organic Compounds in Edible Fish Tissues From Lake Worth, Fort Worth, Texas 1999

    National Research Council Canada - National Science Library

    Moring, J. B

    2002-01-01

    .... Air Force and in collaboration with the Texas Department of Health, collected samples of edible fish tissues from Lake Worth for analysis of selected trace metals, organochlorines, and semivolatile...

  7. Residues of organochlorine pesticides in fish, crab and sediment from El Temsah Lake, Suez Canal, Egypt and their effect on mitochondrial ATPase of the New Zealand white rabbit.

    Science.gov (United States)

    Ahmed, M T; Ismail, S M

    1991-01-01

    Residues of organochlorine pesticides were monitored in the muscles of Bolti fish Tilapia zillii, the crab Lupa pelagicus and sediment samples collected from El Temsah lake around Ismailia using gas liquid chromatography. The beta isomer of hexachlorocyclohexane (beta.HCH) was the most dominant compound detected in all samples, followed by P, P-DDE and P, P-DDT. Results showed the crab to contain higher concentrations of organochlorine in comparison to concentrations detected in fish muscles. The In-vitro effect of the residues extracted from fish, and crab on the mitochondrial brain and liver ATPase of the New Zealand white rabbit Orcytolagus cuniculus was also studied. Residues of organochlorine pesticides have induced activation in the ATPase enzyme system of both brain and liver. The mixtures of organochlorine residues of both fish and crab were able to activate liver ATPase more than brain ATPase. The present study was conducted to extrapolate possible effects incurred on man if consumed such food.

  8. Persistent organochlorine compounds in peregrine falcon (Falco peregrinus) eggs from South Greenland: Levels and temporal changes between 1986 and 2003

    DEFF Research Database (Denmark)

    Vorkamp, Katrin; Thomsen, Marianne; Møller, Søren

    2009-01-01

    Thirty-seven addled peregrine falcon eggs collected in South Greenland between 1986 and 2003 wereanalysed for their content of the organochlorine compounds polychlorinated biphenyls (PCBs), dichlorodiphenyltricloroethane (DDT) and its degradation products, hexachlorocyclohexane (HCH) isomers andh...

  9. Role of cytochrome P450s in insecticide resistance: impact on the control of mosquito-borne diseases and use of insecticides on Earth.

    Science.gov (United States)

    David, Jean-Philippe; Ismail, Hanafy Mahmoud; Chandor-Proust, Alexia; Paine, Mark John Ingraham

    2013-02-19

    The fight against diseases spread by mosquitoes and other insects has enormous environmental, economic and social consequences. Chemical insecticides remain the first line of defence but the control of diseases, especially malaria and dengue fever, is being increasingly undermined by insecticide resistance. Mosquitoes have a large repertoire of P450s (over 100 genes). By pinpointing the key enzymes associated with insecticide resistance we can begin to develop new tools to aid the implementation of control interventions and reduce their environmental impact on Earth. Recent technological advances are helping us to build a functional profile of the P450 determinants of insecticide metabolic resistance in mosquitoes. Alongside, the cross-responses of mosquito P450s to insecticides and pollutants are also being investigated. Such research will provide the means to produce diagnostic tools for early detection of P450s linked to resistance. It will also enable the design of new insecticides with optimized efficacy in different environments.

  10. Organochlorines in benthic invertebrates and sediments from the Dutch Wadden Sea; identification of individual PCB components

    Science.gov (United States)

    Duinker, J. C.; Hillebrand, M. T. J.; Boon, J. P.

    Concentrations of organochlorines were determined in Macoma balthica, Arenicola marina, Crangon crangon and sediments from the Dutch Wadden Sea. Maximum concentrations of (total) PCB, γ-HCH and dieldrin were found in the western part; a pronounced maximum of HCB was found in the western part. Concentrations of PCB, p,p'-DDD and p,p'-DDE in sediment were correlated with the percentage of particles metabolism, were lower in Crangon. The patterns of pentachloro- and higher chlorinated biphenyls were equal in Macoma, Arenicola and sediments. Since these components are not found in solution, they must be taken up from sediment and food. The results are in agreement with partitioning between body lipids and water as the dominant mechanism determining concentrations of persistent lipophilic contaminants in the animals. Partitioning with the ambient water may also determine the concentrations in the sediment.

  11. Atmospheric concentrations of organochlorine pesticides, polybrominated diphenyl ethers and polychloronaphthalenes in Nuuk, South-West Greenland

    DEFF Research Database (Denmark)

    Bossi, Rossana; Skov, Henrik; Vorkamp, Katrin

    2008-01-01

    Atmospheric concentrations of organochlorine pesticides (OCs), polybrominated diphenyl ethers (PBDEs) and polychloronaphthalenes (PCNs) were measured for the first time in Nuuk, Greenland in 2004 and 2005. The annual mean concentrations af the measured OCs were: α-HCH 20.2 pg m-3, Υ-HCH (lindane) 5......-HCH, which had maximum concentration in August in both years. The average annual mean for ΣPBDEs was 1.14 ± 0.81 pg m-3. The predominant congeners measured in Nuuk were BDE-47 and BDE-99 followed by BDE-100, -153 and -28, indicating the use of penta-BDE technical products as the main source. A clear seasonal...

  12. Concentration of Organochlorine and Organophosphorus Pesticides in Different Molluscs from Tighra Reservoir, Gwalior, India.

    Science.gov (United States)

    Mamta; Rao, R J; Wani, Khursheed Ahmad

    2015-09-01

    Concentration of organochlorine and organophosphorus pesticides and their metabolites were determined in whole body homogenate of L. acuminata, I. exustus, V. dissimilis, V. bengalensis, from Tighra Reservoir during summer and post monsoon season using GC-MS technique. The different types of pesticides viz., HCB, heptachlor, aldrin, endosulfan, dieldrin, p,p-DDT, choloropyrifos, methyl parathion, dicholorovos, ethion, malathion, parathion were found in resident molluscs studied. Concentration of these pesticides varied independently during the summer and the post monsoon season at monitored sites. The study concluded that presence of pesticides in Tighra Reservoir is a major concern on public and ecosystem health and use of biopesticides in the adjacent area of Reservoir is highly recommended.

  13. Determination of organochlorine pesticides in water using dynamic hook-type liquid-phase microextraction

    International Nuclear Information System (INIS)

    Chen, Pai-Shan; Huang, Shih-Pin; Fuh, Ming-Ren; Huang, Shang-Da

    2009-01-01

    We developed a simple and efficient headspace liquid-phase microextraction (LPME) technique named dynamic hook-type liquid-phase microextraction (DHT-LPME) and used it in combination with gas chromatography-mass spectrometry (GC-MS) and an electron capture detector (ECD). Aqueous specimens of organochlorine pesticides (OCPs) were used as model compounds to demonstrate the effectiveness of the technique. In the present study, the calibration curves were linear over at least 2 orders of magnitude with R 2 values of 0.997. The method detection limits (MDLs) varied from 2 to 44.0 ng L -1 . The precision of DHT-LPME ranged from 6.5 to 14.4%. The relative recoveries of OCPs in rainwater were more than 84.2%. Enrichment factors (EF) in the range 275-1127 were obtained using DHT-LPME.

  14. Determination of organochlorine pesticides in water using dynamic hook-type liquid-phase microextraction

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Pai-Shan; Huang, Shih-Pin [Department of Chemistry, National Tsing Hua University, Hsinchu 30013, Taiwan (China); Fuh, Ming-Ren, E-mail: msfuh@mail.scu.edu.tw [Department of Chemistry, Soochow University, Taipei, Taiwan (China); Huang, Shang-Da, E-mail: sdhuang@mx.nthu.edu.tw [Department of Chemistry, National Tsing Hua University, Hsinchu 30013, Taiwan (China)

    2009-08-11

    We developed a simple and efficient headspace liquid-phase microextraction (LPME) technique named dynamic hook-type liquid-phase microextraction (DHT-LPME) and used it in combination with gas chromatography-mass spectrometry (GC-MS) and an electron capture detector (ECD). Aqueous specimens of organochlorine pesticides (OCPs) were used as model compounds to demonstrate the effectiveness of the technique. In the present study, the calibration curves were linear over at least 2 orders of magnitude with R{sup 2} values of 0.997. The method detection limits (MDLs) varied from 2 to 44.0 ng L{sup -1}. The precision of DHT-LPME ranged from 6.5 to 14.4%. The relative recoveries of OCPs in rainwater were more than 84.2%. Enrichment factors (EF) in the range 275-1127 were obtained using DHT-LPME.

  15. Organochlorine pesticides in lacustrine sediments and tilapias of Metztitlan, Hidalgo, Mexico

    Directory of Open Access Journals (Sweden)

    Laura M Fernández-Bringas

    2008-09-01

    Full Text Available The organochlorine pesticides (OP are very stable molecules, due to this stability; they are very resistant in the environment and highly related to fat tissues with a wide diffusion property and an average time life higher then 10 years. We studied sediments (November 2001, April and June 2002 and organisms collected in April and July (2002 from the lacustric zone of Metzitlán, Hidalgo, Mexico. The analysis was performed according to UNEP/IAEA (1982 (sediments and UNEP/FAO/IOC/IAEA (1986 (organisms methods. Three chemical families of organochlorine pesticides were identified and analyzed to determine posible toxicological risk. The principal organochlorine compounds found in sediments were g-HCH, d-HCH, p,p’-DDT and the endosulfan sulfate; these xenobiotics come from agriculture lands near the river and lake, used intensively, and most probably carried by the rain and rain flows into the main water body. In the tilapias tissue, p,p’-DDD y d-HCH were detected. The average concentrations of organochlorine pesticides in sediments were within the internacional limits for freshwater benthonic fauna, although lindane (g-HCH was near the limit. The fish were above the criteria established in the local legislation (NOM-027-SSA1-1993 y NOM-028-SSA1-1993. Rev. Biol. Trop. 56 (3: 1381-1390. Epub 2008 September 30.El presente trabajo se llevó a cabo en la cuenca lacustre de Metztitlán, Hgo. Se realizaron tres colectas de sedimentos recientes en noviembre (2001, abril y julio (2002 y dos colectas para organismos en abril y julio (2002. Los análisis se hicieron siguiendo la metodología para sedimentos propuesta por UNEP/IAEA (1982 y para tejido de organismos por UNEP/FAO/IOC/IAEA (1986. Se identificaron y cuantificaron tres familias químicas de plaguicidas organoclorados, para determinar el posible riesgo toxicológico de los sedimentos y de organismos en capturas comerciales. Los principales compuestos clorados en sedimentos fueron el g-HCH, d

  16. Organochlorine pesticides and PCBs in air of southern Mexico (2002-2004)

    Science.gov (United States)

    Alegria, Henry A.; Wong, Fiona; Jantunen, Liisa M.; Bidleman, Terry F.; Figueroa, Miguel Salvador; Bouchot, Gerardo Gold; Moreno, Victor Ceja; Waliszewski, Stefan M.; Infanzon, Raul

    Air samples were collected in southern Mexico in 2002-2004 to determine the extent of contamination with organochlorine (OC) pesticides and polychlorinated biphenyls (PCBs). The ΣDDTs ranged from 239 to 2360 pg m -3. Other prominent OC pesticides were endosulfans, toxaphene and lindane. Pesticides detected in lower concentrations include chlordanes, dieldrin, and heptachlor. Proportions of DDT compounds suggested fresh use of DDT in some locations and a mix of fresh and aged residues at others. Ratios of trans-chlordane/ cis-chlordane were consistent with fresh chlordane usage or emission of residues from former termiticide applications. The ΣPCBs was relatively low at all sites. Concentrations of OC pesticides measured with passive samplers agreed well with those measured using high-volume samplers. Air back trajectory analysis suggests a complex pattern of regional atmospheric transport.

  17. Role of cytochrome P450s in insecticide resistance: impact on the control of mosquito-borne diseases and use of insecticides on Earth

    OpenAIRE

    David, Jean-Philippe; Ismail, Hanafy Mahmoud; Chandor-Proust, Alexia; Paine, Mark John Ingraham

    2013-01-01

    The fight against diseases spread by mosquitoes and other insects has enormous environmental, economic and social consequences. Chemical insecticides remain the first line of defence but the control of diseases, especially malaria and dengue fever, is being increasingly undermined by insecticide resistance. Mosquitoes have a large repertoire of P450s (over 100 genes). By pinpointing the key enzymes associated with insecticide resistance we can begin to develop new tools to aid the implementat...

  18. Presence and importance of organochlorine solvents and other compounds in Germany's groundwater and drinking water.

    Science.gov (United States)

    Dieter, H H; Kerndorff, H

    1993-01-01

    Organochlorine compounds are widely used in Germany although the inland production of chlorinated solvents has greatly decreased since 1985. Data on groundwater contamination are incomplete, but there are some regional data sets from the States (Länder). Approximately 25% of the groundwater samples contain more than 1 microgram/l of a single solvent, the most prominent ones being tri- and tetrachloroethene, 1,1,1-trichloroethane and dichloromethane, but also chloroform. The most important causes for contaminations of the groundwater are unprotected storage and leaking sewage systems. Abandoned waste sites are, besides chlorinated compounds, also a source of many other contaminants. A ranking procedure according to their exposure potential (concentration, incidence, toxicology) is proposed. The compound of greatest concern is vinyl chloride, which is formed from tri- and tetrachloroethene under reducing conditions in the subsoil. The most important contaminant in drinking water is tetrachloroethene followed by 1,1,1-trichloroethane and trichloroethane. Chlorobenzene may also be present on occasion, while only about 20% of the finished drinking waters contain more chloroform after treatment than before. Only about 10% of all analyses of drinking water derived from groundwater shows the presence of organochlorine solvents and most of these show total concentrations less than 2 micrograms/l. The degradation product, vinyl chloride, was found up to now only in different groundwaters. To stabilize and to improve the situation, which still is much more favorable for drinking than for groundwater, precautions are going to be taken which should assure that these and other problematic substances which endanger water are used only in closed systems and rigid safety measures be imposed on their disposal and transport.

  19. Transboundary pollution: Persistent organochlorine pesticides in migrant birds of the Southwestern United States and Mexico

    Science.gov (United States)

    Mora, Miguel A.

    1997-01-01

    The hypothesis that migratory birds accumulate persistent organochlorine pesticides (POPs) during the winter in Latin America has been prevalent for many years, particularly since 1,1,1-trichloro-2,2–bis(p-chlorophenyl)ethane (DDT) was banned in the United States in 1972. It has been suggested that peregrine falcons (Falco peregrinus), black-crowned night herons (Nycticorax nycticorax), white-faced ibises (Plegadis chihi), various migratory waterfowl and shorebirds, and other avian species accumulate higher concentrations of POPs while on migration or on their wintering grounds in Latin America. Nonetheless, the data obtained thus far are limited, and there is no clear pattern to suggest that such accumulation occurs on a widespread basis. In this review wildlife contaminant studies conducted along the U.S.-Mexico border and throughout Mexico are discussed. The results for the most part seem to indicate that no major accumulation of 2,2-bis(p-chlorophenyl)-1,1-dichloroethylene) (DDE), the most persistent organochlorine compound, has occurred or been reported for most parts of Mexico. The majority of the DDE values in birds from Mexico were similar to those reported in birds from the southwestern United States during the same years. More work needs to be done, particularly in those cotton-producing areas of Mexico where DDT was applied heavily in the past (e.g., Chiapas and Michoacan). Because DDT is still used for malaria control and may still be used in agriculture in Chiapas, this state is probably the one where most migrant species would still be at a significant risk of increased accumulation of DDE and DDT.

  20. A comparative study on the uptake and translocation of organochlorines by Phragmites australis

    Energy Technology Data Exchange (ETDEWEB)

    San Miguel, Angélique; Ravanel, Patrick [Laboratoire d’Ecologie Alpine, UMR CNRS n°5553, Université Joseph Fourier, BP 53, 38041 Grenoble Cedex 09 (France); Raveton, Muriel, E-mail: muriel.raveton@ujf-grenoble.fr [Laboratoire d’Ecologie Alpine, UMR CNRS n°5553, Université Joseph Fourier, BP 53, 38041 Grenoble Cedex 09 (France)

    2013-01-15

    Highlights: ► This study compares uptake/translocation of organochlorine congeners in macrophytes. ► First, root OC uptake was strongly linked with the partitioning/diffusion process. ► With time exposure, bioconcentration increased with OC solubility and volatility. ► Translocation was linked to the combination of water flow and vapor flux transfers. ► The most volatile OCs might be phytovolatilized from foliar surfaces. -- Abstract: Organochlorines (OCs) are persistent chemicals found in various environmental compartments. The differences in the uptake of {sup 14}C-labeled 1,4-dichlorobenzene (DCB), 1,2,4-trichlorobenzene (TCB) and γ-hexachlorocyclohexane (γHCH) by Phragmites australis were investigated under hydroponic conditions. The first step in sorption appears to be correlated with the hydrophobic nature of the compounds, since log-linear correlations were obtained between root concentration factor and partition coefficient (LogK{sub ow}). After 7 days of exposure, plant uptake of DCB, TCB, γHCH was significant with bioconcentration factors reaching 14, 19 and 15, respectively. Afterwards, uptake and translocation were seen to be more complex, with a loss of the simple relationship between uptake and LogK{sub ow}. Linear correlations between the bioconcentration/translocation factors and the physico-chemical properties of OCs were shown, demonstrating that translocation from roots to shoots increases with solubility and volatility of the OCs. This suggests that OC-translocation inside plants might result from the combination of two processes, xylem sap flow and vapor fluxes. {sup 14}C-phytovolatilization was measured and was correlated with the volatility of the compounds; the more volatile OCs being most the likely to be phytovolatilized from foliar surfaces (p = 0.0008). Thus, OC-uptake/translocation appears to proceed at a rate that depends mostly on the OCs hydrophobicity, solubility and volatility.

  1. Marine mammal health: Organochlorines in blubber, blood and milk of Tursiops truncatus

    Energy Technology Data Exchange (ETDEWEB)

    Reddy, M.L.; Ridgway, S.H. [NCCOSC, San Diego, CA (United States). RDTE Division

    1995-12-31

    Marine mammals are potentially vulnerable organisms for the effects of hazardous man-made chemicals. Organochlorines (OCs) are suspected of causing reproductive failure and immunosuppression which may result in increased susceptibility to infectious disease. High levels of OCs have been found in victims of mass die offs of cetaceans world-wide. To determine baseline values of these organochlorine contaminants found in healthy reproductive dolphins, the authors collected samples of blood, blubber and milk from a population of Tursiops truncatus maintained by the US Navy. These animals are ideal for study because of the availability of relevant biological data which is often lacking in data from wild animals. The Navy dolphins are trained for medical behaviors like blood and milk collection. These behaviors allow them to collect data under controlled conditions preempting errors that occur when collecting similar data on dead and/or wild animals. Using gas chromatography and mass spectrometry (GC/MS) the authors have quantified 10 to 25 PCBs using congener-specific analysis and 19 chlorinated pesticides from microsamples of blubber, blood and milk collected from these animals. The authors also analyzed the fish in the diets of the dolphins. Serial sample collection of milk has allowed us to track the transfer of OCs over the course of lactation. They were also able to correlate OC levels found in blubber, blood and milk. This database should reveal baseline levels relating environmental toxins and marine mammal health to provide a potentially sensitive indicator of pollution and disease in the natural ocean environment and furnish an unparalleled historical pathway toward understanding the effects and consequences of these persistent contaminants and their impact on the marine ecosystem.

  2. Occurrence and exposure assessment of polychlorinated biphenyls and organochlorine pesticides from homemade baby food in Korea.

    Science.gov (United States)

    Jeong, Yunsun; Lee, Sunggyu; Kim, Sunmi; Choi, Sung-Deuk; Park, Jeongim; Kim, Hai-Joong; Lee, Jeong Jae; Choi, Gyuyeon; Choi, Sooran; Kim, Sungjoo; Kim, Su Young; Kim, Young Don; Cho, Geumjoon; Suh, Eunsook; Kim, Sung Koo; Eun, So-Hee; Eom, Soyong; Kim, Seunghyo; Kim, Gun-Ha; Choi, Kyungho; Kim, Sungkyoon; Moon, Hyo-Bang

    2014-02-01

    Data on the residue levels of persistent organic pollutants (POPs) in baby food samples are scarce. This is the first study to explore current contamination status and exposure assessment of organochlorines (OCs), including polychlorinated biphenyls (PCBs) and organochlorine pesticides (OCPs), in baby food from Korea. In this study, the concentrations of OCs were determined in homemade baby food samples (n=100) collected from 6-, 9-, 12- and 15-month-old infant groups. The average concentrations of PCBs, dichloro-diphenyl-trichloroethanes (DDTs), hexachlorocyclohexanes (HCHs) and chlordanes (CHLs) in baby food samples were 37.5, 96.6, 26.0, and 13.2 pg/g fresh weight, respectively. The major compounds were CBs 28, 153, 52, and 33 for PCBs and p,p'-DDE, p,p'-DDT and β-HCH for OCPs. The contribution of DDTs to the total OC concentrations increased from 30% (6-month-old infants) to 67% (15-month-old infants) with increasing infant age, while the concentrations of PCBs, HCHs and CHLs gradually decreased with increasing infant age, suggesting that highest priority for risk reduction of DDTs. The estimated daily intakes (EDIs) of OCs in Korean infants from baby food consumption were lower than the thresholds proposed by the United States Environmental Protection Agency and Health Canada, implying limited potential health risks. However, considering simultaneous exposure from baby food and breast milk consumption, chlordanes and heptachlor epoxide posed potential health risks. Considering the importance of early development and the vulnerability of infants, it is essential to perform systematic monitoring and management programs of OCs in baby food for risk reduction in Korean infants. © 2013 Elsevier B.V. All rights reserved.

  3. Insecticidal Potential of an Orally Administered Metabolic Extract of ...

    African Journals Online (AJOL)

    The insecticidal activity of Aspergillus niger IHCS-4 metabolic extract against Chrysomya chloropyga larvae was examined in vitro. The toxicity test revealed that 0.04 mg/g and 0.08 mg/g extract concentration significantly (P>0.05) affected the insect larvae, inducing 20% and 65% mortality respectively, within 24 hours.

  4. Effectiveness of plant based insecticides as a sustainable means of ...

    African Journals Online (AJOL)

    Cucumber (Cucumis sativus) is an important crop in Pakistan. It is affected by many biotic and abiotic factors. Among these, Cucumber mosaic virus is the important disease with economic losses. The purpose of this study was to evaluate the effectiveness of plant based insecticides as a sustainable means to control the ...

  5. Studies .on the efficacy of some biorational insecticides against the ...

    African Journals Online (AJOL)

    W. Tin znara*, C. Na11kinga, l Kashaija & W. Tu.vhemereirwe ... Biorat!onal insecticides obtained from tobacco, ash, urine, pepper and a concoction (mixture) were ... Cultural control ... single components were made by adding I 00 ml of tap.

  6. Risk of transmission of viral haemorrhagic fevers and the insecticide ...

    African Journals Online (AJOL)

    ... of transmission of viral haemorrhagic fevers and the insecticide susceptibility status of Ae. aegypti in some sites in Accra, Ghana. Design: Larval surveys were carried to inspect containers within households and estimate larval indices and adult Aedes mosquitoes were collected using human landing collection technique.

  7. The comparative insecticidal and residual efficacy of sniper and ...

    African Journals Online (AJOL)

    Otoigiakih

    Chemical control is still the main approach for urban pest control (Castle et al., 1999; Rozendaal, 1997; Marrs,. 1993; Lee and Yap, 2003; Tidwell et al., 1994). The use of insecticides is seen as the most effective tool in cockroach control program (WHO, 1996; Chavasse and. Yap, 1997; Lee and Yap, 2003; Tidwell et al., ...

  8. Susceptibility of Adult Mosquitoes to Insecticides in Aqueous Sucrose Baits

    Science.gov (United States)

    2011-06-01

    Lee, and A.H. Azahari. 2005. Adult and larval insecticide susceptibility status of Culex quinquefasciatus (Say) mosquitoes in Kuala Lumpur Malaysia ...Trop. Biomed. 22: 63-68. Nayar, J.K. and D.M. Sauerman, Jr. 1971. The effects of diet on life-span, fecundity and flight potential of Aedes

  9. Efficacy of some synthetic insecticides for control of cotton bollworms ...

    African Journals Online (AJOL)

    ... and Betsulfan at 3.2 l ha-1 recorded the highest and lowest yields, respectively. For effective control of cotton bollworms for maximum yield in the ecology, Thionex applied at 2.8 l ha-1 is recommended. Keywords: Control, cotton bollworms, efficacy, Ghana, synthetic insecticides. African Crop Science Journal, Vol. 20, No.

  10. Insecticide use and practices among cotton farmers in northern ...

    African Journals Online (AJOL)

    Cotton (Gossypium hirsutum L.) is an important cash crop in Uganda. Insecticide application practices among cotton growers in northern Uganda were examined to determine the pests targeted and the compliance of control measures with the standards recommended by the Uganda's Cotton Development Organization ...

  11. Pyrethroid insecticides in urban salmon streams of the Pacific Northwest

    Energy Technology Data Exchange (ETDEWEB)

    Weston, D.P., E-mail: dweston@berkeley.edu [Department of Integrative Biology, University of California, 3060 Valley Life Sciences Bldg., Berkeley, CA 94720-3140 (United States); Asbell, A.M., E-mail: aasbell@berkeley.edu [Department of Integrative Biology, University of California, 3060 Valley Life Sciences Bldg., Berkeley, CA 94720-3140 (United States); Hecht, S.A., E-mail: scott.hecht@noaa.gov [NOAA Fisheries, Office of Protected Resources, 510 Desmond Drive S.E., Lacey, WA 98503 (United States); Scholz, N.L., E-mail: nathaniel.scholz@noaa.gov [NOAA Fisheries, Northwest Fisheries Science Center, 2725 Montlake Blvd. E., Seattle, WA 98112 (United States); Lydy, M.J., E-mail: mlydy@siu.edu [Fisheries and Illinois Aquaculture Center and Department of Zoology, Southern Illinois University, 171 Life Sciences II, Carbondale, IL 62901 (United States)

    2011-10-15

    Urban streams of the Pacific Northwest provide spawning and rearing habitat for a variety of salmon species, and food availability for developing salmon could be adversely affected by pesticide residues in these waterbodies. Sediments from Oregon and Washington streams were sampled to determine if current-use pyrethroid insecticides from residential neighborhoods were reaching aquatic habitats, and if they were at concentrations acutely toxic to sensitive invertebrates. Approximately one-third of the 35 sediment samples contained measurable pyrethroids. Bifenthrin was the pyrethroid of greatest concern with regards to aquatic life toxicity, consistent with prior studies elsewhere. Toxicity to Hyalella azteca and/or Chironomus dilutus was found in two sediment samples at standard testing temperature (23 deg. C), and in one additional sample at a more environmentally realistic temperature (13 deg. C). Given the temperature dependency of pyrethroid toxicity, low temperatures typical of northwest streams can increase the potential for toxicity above that indicated by standard testing protocols. - Highlights: > Salmon-bearing creeks can be adversely impacted by insecticides from urban runoff. > Pyrethroid insecticides were found in one-third of the creeks in Washington and Oregon. > Two creeks contained concentrations acutely lethal to sensitive invertebrates. > Bifenthrin was of greatest concern, though less than in prior studies. > Standard toxicity testing underestimates the ecological risk of pyrethroids. - Pyrethroid insecticides are present in sediments of urban creeks of Oregon and Washington, though less commonly than in studies elsewhere in the U.S.

  12. Pyrethroid insecticides in urban salmon streams of the Pacific Northwest

    International Nuclear Information System (INIS)

    Weston, D.P.; Asbell, A.M.; Hecht, S.A.; Scholz, N.L.; Lydy, M.J.

    2011-01-01

    Urban streams of the Pacific Northwest provide spawning and rearing habitat for a variety of salmon species, and food availability for developing salmon could be adversely affected by pesticide residues in these waterbodies. Sediments from Oregon and Washington streams were sampled to determine if current-use pyrethroid insecticides from residential neighborhoods were reaching aquatic habitats, and if they were at concentrations acutely toxic to sensitive invertebrates. Approximately one-third of the 35 sediment samples contained measurable pyrethroids. Bifenthrin was the pyrethroid of greatest concern with regards to aquatic life toxicity, consistent with prior studies elsewhere. Toxicity to Hyalella azteca and/or Chironomus dilutus was found in two sediment samples at standard testing temperature (23 deg. C), and in one additional sample at a more environmentally realistic temperature (13 deg. C). Given the temperature dependency of pyrethroid toxicity, low temperatures typical of northwest streams can increase the potential for toxicity above that indicated by standard testing protocols. - Highlights: → Salmon-bearing creeks can be adversely impacted by insecticides from urban runoff. → Pyrethroid insecticides were found in one-third of the creeks in Washington and Oregon. → Two creeks contained concentrations acutely lethal to sensitive invertebrates. → Bifenthrin was of greatest concern, though less than in prior studies. → Standard toxicity testing underestimates the ecological risk of pyrethroids. - Pyrethroid insecticides are present in sediments of urban creeks of Oregon and Washington, though less commonly than in studies elsewhere in the U.S.

  13. Metaflumizone is a novel sodium channel blocker insecticide.

    Science.gov (United States)

    Salgado, V L; Hayashi, J H

    2007-12-15

    Metaflumizone is a novel semicarbazone insecticide, derived chemically from the pyrazoline sodium channel blocker insecticides (SCBIs) discovered at Philips-Duphar in the early 1970s, but with greatly improved mammalian safety. This paper describes studies confirming that the insecticidal action of metaflumizone is due to the state-dependent blockage of sodium channels. Larvae of the moth Spodoptera eridania injected with metaflumizone became paralyzed, concomitant with blockage of all nerve activity. Furthermore, tonic firing of abdominal stretch receptor organs from Spodoptera frugiperda was blocked by metaflumizone applied in the bath, consistent with the block of voltage-dependent sodium channels. Studies on native sodium channels, in primary-cultured neurons isolated from the CNS of the larvae of the moth Manduca sexta and on Para/TipE sodium channels heterologously expressed in Xenopus (African clawed frog) oocytes, confirmed that metaflumizone blocks sodium channels by binding selectively to the slow-inactivated state, which is characteristic of the SCBIs. The results confirm that metaflumizone is a novel sodium channel blocker insecticide.

  14. Insecticide resistance testing in malaria vectors in Tanzania ...

    African Journals Online (AJOL)

    mosquito survived much better and the scientists had a total of 467 mosquitoes to run the insecticide susceptibility tests. Innovative ways are necessary under field conditions for mosquito breeding in susceptibility studies. Key words: Malaria, Anopheles gambiae complex, larvae, fabric, resistance, susceptibility, Tanzania.

  15. Effective utilization period of long-lasting insecticide treated nets ...

    African Journals Online (AJOL)

    The study was conducted to evaluate the bioefficacy of long-lasting insecticide treated nets (LLITNs) (PermaNet®2.0) over time and the species composition of Anopheles mosquitoes around Bahir Dar. The space spray collection method was used to determine the species composition of indoor resting Anopheles ...

  16. Insecticide resistance and glutathione S-transferases in mosquitoes ...

    African Journals Online (AJOL)

    Mosquito glutathione S-transferases (GSTs) have received considerable attention in the last 20 years because of their role in insecticide metabolism producing resistance. Many different compounds, including toxic xenobiotics and reactive products of intracellular processes such as lipid peroxidation, act as GST substrates.

  17. Larvicidal, pupicidal and insecticidal activities of Cosmos bipinnatus ...

    African Journals Online (AJOL)

    Purpose: To evaluate the larvicidal, pupicidal and insecticidal activities of Cosmos bipinnatus, Foenuculum vulgare and Tagetes minuta leaf extracts against Culex quinquefasciatus mosquitoes. Methods: The leaves of the plants were extracted with distilled water, ethanol (95 %), and hexane and the extracts screened for ...

  18. Effect of natural and chemical insecticides on Hyalopterus pruni and ...

    African Journals Online (AJOL)

    Experiments were carried out to evaluate the effect of water extracts of Fagonia arabica, Salix alba and Anthmis pseudocotula and their mixtures with chemical insecticide (Malathion) on growth of. Hyalopterus pruni and characters of Armeniaca vulgaris plants and their soils. The data revealed that F.arabica extract at 20% ...

  19. Biological efficacy of the ecotoxically favourable insecticides and ...

    African Journals Online (AJOL)

    The high biologic efficacy, mechanism of action, resistance to water rinsing, high selectivity, and small quantities of application, anticipated a bright future for them. Since results of researches of biological efficacy of insecticides in laboratory and field conditions are statistically different, studies done in natural conditions ...

  20. Insecticide assays against the brown stink bug feeding on pecan

    Science.gov (United States)

    The brown stink bug, Euschistus servus (Say) (Hemiptera: Pentatomidae), is an economic pest of pecan, Carya illinoinensis (Wangenh) K. Koch (Juglandaceae), and other agronomic crops across the southeastern U.S. Management of this pest is mainly via insecticides. Many commercial products indicate o...

  1. Environmental insecticide residues from tsetse fly control measures in Uganda

    International Nuclear Information System (INIS)

    Sserunjoji-Sebalija, J.

    1976-01-01

    Up to June 1974 areas in Uganda totalling 8600km 2 have been successfully reclaimed from tsetse fly infestation by ground spray of 3% dieldrin water emulsions. A search for equally effective but less persistent and toxic compounds against tsetse flies has been unsuccessful. Fourteen insecticide formulations have been tested for their persistence on tree bark surfaces and, therefore, their availability and toxicity to the target tsetse flies. Only those compounds with a high immediate insecticidal activity (some higher than dieldrin) like endosulfan, Chlorfenvinphos and propoxur could merit further consideration in tsetse control. While some were toxic to tsetse as fresh deposits, they lacked sufficient persistence. A study of the environmental implication from the continued use of the highly persistent and toxic dieldrin has provided useful data on residues likely to be found both in terrestrial and aquatic fauna and flora. These are generally low. Moreover, there is evidence of degradation in some fish species (Protopterus aethiopicus and Clarias). Also, dilution factors and adsorption involving the muddy nature of water run-off, etc., and controlled burning of grasses after tsetse eradication would tend to inactivate the residual insecticide and protect aquatic systems. The general findings have indicated less risk than anticipated of the environmental contamination from tsetse control by application of persistent and toxic insecticides. (author)

  2. Ethnobotany of plants used as insecticides, repellents and ...

    African Journals Online (AJOL)

    An ethnobotanical study on plants used for the prevention and treatment of malaria was conducted to document the indigenous knowledge particularly associated with the use and conservation of anti-malarial, insecticide and insect repellent medicinal plants. In this study, five sampling sites were selected based on the ...

  3. Chemical Composition and Insecticidal Activity of the Essential Oil of ...

    African Journals Online (AJOL)

    Purpose: To investigate the chemical composition and insecticidal activity of the essential oil of the aerial parts of Ostericum grosseserratum against the maize weevil, Sitophilus zeamaisD. Methods: Steam distillation of the aerial parts of O. grosseserratum during the flowering stage was carried out using a Clavenger ...

  4. Chemical composition and insecticidal properties of essential oil ...

    African Journals Online (AJOL)

    Purpose: To determine the insecticidal properties of essential oil from Mosla soochowensis aerial parts against two insect pests, Sitophilus zeamais and Tribolium castaneum. Methods: Hydro-distillation of M. soochowensis was used to extract the essential oil. Gas chromatography/mass spectrometry (GC/MS) analysis was ...

  5. Bio-insecticides and mating disruption in cranberries

    Science.gov (United States)

    Surveys of native entomopathogenic nematodes in Wisconsin have produced a new bio-insecticide involving two particular nematode species (Oscheius onirici and Heterorhabditis georgiana). In field studies, these nematodes have shown high virulence against flea beetles; in the laboratory, these nematod...

  6. Insecticide Use Practices in Cocoa Production in Four Regions in ...

    African Journals Online (AJOL)

    Most of the insecticides used are classified as class II under WHO Hazard category, and the farmers used very minimal protective clothing during pesticides application. The results of this study show that there is the need to intensify education on safe handling and use of pesticides to reduce pesticide abuse, especially by ...

  7. Cytotoxic effects of delfin insecticide (Bacillus thuringiensis) on cell ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-08-04

    Aug 4, 2008 ... In acute exposure cells showed deformities such as swelling of cells, oval shaped deformity, and ... Commercial grade of delfin insecticide used in this study was manufactured by .... exposure to cigarette extracts. Antibiotics caused .... administration of a neem pesticide on rat metabolic enzymes. J. Environ.

  8. Material gain: bednets treated with insecticides improve the lives of ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2011-07-15

    ... 700 mosquito nets each day, marketed under brand names such as "Health Net" and ... Material gain: bednets treated with insecticides improve the lives of Tanzanians. July 15, 2011. Image ... The kit is one of the key elements of PSI's Social Marketing of ... The national strategy will work to change this by involving the full ...

  9. Flupyradifurone: a brief profile of a new butenolide insecticide

    Science.gov (United States)

    Nauen, Ralf; Jeschke, Peter; Velten, Robert; Beck, Michael E; Ebbinghaus-Kintscher, Ulrich; Thielert, Wolfgang; Wölfel, Katharina; Haas, Matthias; Kunz, Klaus; Raupach, Georg

    2015-01-01

    BACKGROUND The development and commercialisation of new chemical classes of insecticides for efficient crop protection measures against destructive invertebrate pests is of utmost importance to overcome resistance issues and to secure sustainable crop yields. Flupyradifurone introduced here is the first representative of the novel butenolide class of insecticides active against various sucking pests and showing an excellent safety profile. RESULTS The discovery of flupyradifurone was inspired by the butenolide scaffold in naturally occurring stemofoline. Flupyradifurone acts reversibly as an agonist on insect nicotinic acetylcholine receptors but is structurally different from known agonists, as shown by chemical similarity analysis. It shows a fast action on a broad range of sucking pests, as demonstrated in laboratory bioassays, and exhibits excellent field efficacy on a number of crops with different application methods, including foliar, soil, seed treatment and drip irrigation. It is readily taken up by plants and translocated in the xylem, as demonstrated by phosphor imaging analysis. Flupyradifurone is active on resistant pests, including cotton whiteflies, and is not metabolised by recombinantly expressed CYP6CM1, a cytochrome P450 conferring metabolic resistance to neonicotinoids and pymetrozine. CONCLUSION The novel butenolide insecticide flupyradifurone shows unique properties and will become a new tool for integrated pest management around the globe, as demonstrated by its insecticidal, ecotoxicological and safety profile. © 2014 The Authors. Pest Management Science published by John Wiley & Sons Ltd on behalf of Society of Chemical Industry. PMID:25351824

  10. Seed coating with a neonicotinoid insecticide negatively affects wild bees.

    Science.gov (United States)

    Rundlöf, Maj; Andersson, Georg K S; Bommarco, Riccardo; Fries, Ingemar; Hederström, Veronica; Herbertsson, Lina; Jonsson, Ove; Klatt, Björn K; Pedersen, Thorsten R; Yourstone, Johanna; Smith, Henrik G

    2015-05-07

    Understanding the effects of neonicotinoid insecticides on bees is vital because of reported declines in bee diversity and distribution and the crucial role bees have as pollinators in ecosystems and agriculture. Neonicotinoids are suspected to pose an unacceptable risk to bees, partly because of their systemic uptake in plants, and the European Union has therefore introduced a moratorium on three neonicotinoids as seed coatings in flowering crops that attract bees. The moratorium has been criticized for being based on weak evidence, particularly because effects have mostly been measured on bees that have been artificially fed neonicotinoids. Thus, the key question is how neonicotinoids influence bees, and wild bees in particular, in real-world agricultural landscapes. Here we show that a commonly used insecticide seed coating in a flowering crop can have serious consequences for wild bees. In a study with replicated and matched landscapes, we found that seed coating with Elado, an insecticide containing a combination of the neonicotinoid clothianidin and the non-systemic pyrethroid β-cyfluthrin, applied to oilseed rape seeds, reduced wild bee density, solitary bee nesting, and bumblebee colony growth and reproduction under field conditions. Hence, such insecticidal use can pose a substantial risk to wild bees in agricultural landscapes, and the contribution of pesticides to the global decline of wild bees may have been underestimated. The lack of a significant response in honeybee colonies suggests that reported pesticide effects on honeybees cannot always be extrapolated to wild bees.

  11. Novel and viable acetylcholinesterase target site for developing effective and environmentally safe insecticides.

    Science.gov (United States)

    Pang, Yuan-Ping; Brimijoin, Stephen; Ragsdale, David W; Zhu, Kun Yan; Suranyi, Robert

    2012-04-01

    Insect pests are responsible for human suffering and financial losses worldwide. New and environmentally safe insecticides are urgently needed to cope with these serious problems. Resistance to current insecticides has resulted in a resurgence of insect pests, and growing concerns about insecticide toxicity to humans discourage the use of insecticides for pest control. The small market for insecticides has hampered insecticide development; however, advances in genomics and structural genomics offer new opportunities to develop insecticides that are less dependent on the insecticide market. This review summarizes the literature data that support the hypothesis that an insect-specific cysteine residue located at the opening of the acetylcholinesterase active site is a promising target site for developing new insecticides with reduced off-target toxicity and low propensity for insect resistance. These data are used to discuss the differences between targeting the insect-specific cysteine residue and targeting the ubiquitous catalytic serine residue of acetylcholinesterase from the perspective of reducing off-target toxicity and insect resistance. Also discussed is the prospect of developing cysteine-targeting anticholinesterases as effective and environmentally safe insecticides for control of disease vectors, crop damage, and residential insect pests within the financial confines of the present insecticide market.

  12. Biological alterations and self-reported symptoms among insecticides-exposed workers in Burkina Faso.

    Science.gov (United States)

    Toe, Adama M; Ilboudo, Sylvain; Ouedraogo, Moustapha; Guissou, Pierre I

    2012-03-01

    Occupationally exposed workers, farm workers and plant protection agents in the Sahel region of Burkina Faso were interviewed to assess adverse health effects of insecticides. The subjects were also examined for changes in both hematological and biochemical parameters. The prevalence of liver and kidney dysfunction was found to be quite high among insecticide applicators, especially among plant protection agents. The prevalence of biochemical alterations seems to be correlated to the frequency of insecticide use. However, no significant differences were found between the hematological parameters among farm workers and plant protection agents. The hematological parameters of all the insecticide applicators were normal. The great majority of insecticide applicators (85%) reported symptoms related to insecticide exposure. The use of insecticides in the agriculture of Burkina Faso is threatening to human health.

  13. Toxicity of some insecticides to the haemocytes of giant honeybee, Apis dorsata F. under laboratory conditions

    Directory of Open Access Journals (Sweden)

    Nighat Perveen

    2017-07-01

    Full Text Available Quantitative studies concerning total and differential haemocyte counts and abnormalities were performed under laboratory conditions for larvae, pupae and adults collected from a wild Apis dorsata colony. Haemolymph samples were observed immediately, thirty and sixty minutes after field recommended concentration exposure of five different insecticides. Total haemocyte counts were significantly higher for larvae and pupae but less for adult bees, however, differential haemocyte counts insignificantly different. Exposure of insecticides showed variable response for tested insecticides with immediate increased change with ethofenprox, diafenthiuron and imidacloprid but decreased for all tested insecticides after sixty minutes. For differential haemocyte counts, plasmatocytes and granulocytes increased with exposure of insecticides. Immune response of haemocytes against insecticides showed different degrees of abnormalities like agglutination, denucleation and cell shape distortion. Such studies may help in possible identification of insect defense mechanisms against their exposure to external hazards for instance insecticide exposure.

  14. Radiation fixation of vinyl chloride in an insecticide aerosol container

    International Nuclear Information System (INIS)

    Kagiya, V.T.; Takemoto, K.

    1975-01-01

    Recently, a large quantity of vinyl chloride has been used as spraying additive for insecticide aerosols. Since January 1974 when the Food and Drug Administration of the United States of America announced that vinyl chloride causes liver cancer, it has been forbidden in Japan and the United States of America to market insecticide aerosol containers containing vinyl chloride. In Japan, following a government order, about 20 million insecticide aerosol containers have been collected and put into storage. A report is given on the radiation fixation of vinyl chloride as polyvinylchloride powder by gamma-ray-induced polymerization in the aerosol container. Insecticide aerosol containers containing vinyl chloride were irradiated by gamma rays from 60 Co at room temperature. Vinyl chloride polymerized to form powdered polymer in the container. Polymerization conversion increased with the irradiation dose, and after 10 Mrad irradiation, vinyl chloride was not found in the sprayed gas. This establishes that vinyl chloride can be fixed by gamma-ray irradiation in the aerosol container. To accelerate the reaction rate, the effect of various additives on the reaction was investigated. It was found that halogenated hydrocarbons, such as chloroform and carbon tetrachloride, accelerated the initiation of the polymerization, and that a vinyl monomer such as vinyl acetate accelerated the reaction rate due to the promotion of the initiation and the high reactivity of the polyvinylacetate radical to vinyl chloride. Consequently, the required irradiation dose for the fixation of vinyl chloride was decreased to less than 5 Mrad by the addition of various kinds of additives. Following the request of the Ministry of Public Welfare, various technical problems for large-scale treatment are being studied with the co-operation of the Federation of Insecticide Aerosols. (author)

  15. Agricultural insecticides threaten surface waters at the global scale.

    Science.gov (United States)

    Stehle, Sebastian; Schulz, Ralf

    2015-05-05

    Compared with nutrient levels and habitat degradation, the importance of agricultural pesticides in surface water may have been underestimated due to a lack of comprehensive quantitative analysis. Increasing pesticide contamination results in decreasing regional aquatic biodiversity, i.e., macroinvertebrate family richness is reduced by ∼30% at pesticide concentrations equaling the legally accepted regulatory threshold levels (RTLs). This study provides a comprehensive metaanalysis of 838 peer-reviewed studies (>2,500 sites in 73 countries) that evaluates, for the first time to our knowledge on a global scale, the exposure of surface waters to particularly toxic agricultural insecticides. We tested whether measured insecticide concentrations (MICs; i.e., quantified insecticide concentrations) exceed their RTLs and how risks depend on insecticide development over time and stringency of environmental regulation. Our analysis reveals that MICs occur rarely (i.e., an estimated 97.4% of analyses conducted found no MICs) and there is a complete lack of scientific monitoring data for ∼90% of global cropland. Most importantly, of the 11,300 MICs, 52.4% (5,915 cases; 68.5% of the sites) exceeded the RTL for either surface water (RTLSW) or sediments. Thus, the biological integrity of global water resources is at a substantial risk. RTLSW exceedances depend on the catchment size, sampling regime, and sampling date; are significantly higher for newer-generation insecticides (i.e., pyrethroids); and are high even in countries with stringent environmental regulations. These results suggest the need for worldwide improvements to current pesticide regulations and agricultural pesticide application practices and for intensified research efforts on the presence and effects of pesticides under real-world conditions.

  16. Insecticide resistance status of Aedes aegypti (L.) from Colombia.

    Science.gov (United States)

    Fonseca-González, Idalyd; Quiñones, Martha L; Lenhart, Audrey; Brogdon, William G

    2011-04-01

    To evaluate the insecticide susceptibility status of Aedes aegypti (L.) in Colombia, and as part of the National Network of Insecticide Resistance Surveillance, 12 mosquito populations were assessed for resistance to pyrethroids, organophosphates and DDT. Bioassays were performed using WHO and CDC methodologies. The underlying resistance mechanisms were investigated through biochemical assays and RT-PCR. All mosquito populations were susceptible to malathion, deltamethrin and cyfluthrin, and highly resistant to DDT and etofenprox. Resistance to lambda-cyhalothrin, permethrin and fenitrothion ranged from moderate to high in some populations from Chocó and Putumayo states. In Antioquia state, the Santa Fe population was resistant to fenitrothion. Biochemical assays showed high levels of both cytochrome P450 monooxygenases (CYP) and non-specific esterases (NSE) in some of the fenitrothion- and pyrethroid-resistant populations. All populations showed high levels of glutathione-S-transferase (GST) activity. GSTe2 gene was found overexpressed in DDT-resistant populations compared with Rockefeller susceptible strain. Differences in insecticide resistance status were observed between insecticides and localities. Although the biochemical assay results suggest that CYP and NSE could play an important role in the pyrethroid and fenitrothion resistance detected, other mechanisms remain to be investigated, including knockdown resistance. Resistance to DDT was high in all populations, and GST activity is probably the main enzymatic mechanism associated with this resistance. The results of this study provide baseline data on insecticide resistance in Colombian A. aegypti populations, and will allow comparison of changes in susceptibility status in this vector over time. Copyright © 2011 Society of Chemical Industry.

  17. Underpinning sustainable vector control through informed insecticide resistance management.

    Directory of Open Access Journals (Sweden)

    Edward K Thomsen

    Full Text Available There has been rapid scale-up of malaria vector control in the last ten years. Both of the primary control strategies, long-lasting pyrethroid treated nets and indoor residual spraying, rely on the use of a limited number of insecticides. Insecticide resistance, as measured by bioassay, has rapidly increased in prevalence and has come to the forefront as an issue that needs to be addressed to maintain the sustainability of malaria control and the drive to elimination. Zambia's programme reported high levels of resistance to the insecticides it used in 2010, and, as a result, increased its investment in resistance monitoring to support informed resistance management decisions.A country-wide survey on insecticide resistance in Zambian malaria vectors was performed using WHO bioassays to detect resistant phenotypes. Molecular techniques were used to detect target-site mutations and microarray to detect metabolic resistance mechanisms. Anopheles gambiae s.s. was resistant to pyrethroids, DDT and carbamates, with potential organophosphate resistance in one population. The resistant phenotypes were conferred by both target-site and metabolic mechanisms. Anopheles funestus s.s. was largely resistant to pyrethroids and carbamates, with potential resistance to DDT in two locations. The resistant phenotypes were conferred by elevated levels of cytochrome p450s.Currently, the Zambia National Malaria Control Centre is using these results to inform their vector control strategy. The methods employed here can serve as a template to all malaria-endemic countries striving to create a sustainable insecticide resistance management plan.

  18. Preliminary Study Contamination of Organochlorine Pesticide (Heptachlor) and Heavy Metal (Arsenic) in Shallow Groundwater Aquifer of Semarang Coastal Areas

    Science.gov (United States)

    Rochaddi, Baskoro; Adhi Suryono, Chrisna; Atmodjo, Warsito; Satriadi, Alfi

    2018-02-01

    The present study was conducted to assess the level of pesticide and heavy metal contamination in shallow aquifer of Semarang coastal areas. Results indicated that Heptachlor and Arsenic were detected in the water samples in the range 0.023-0.055 μg L-1 and 0,03-1,63 μg L-1, respectively. Compared to the standard limits of the organochlorine contents in the water sample by World Health Organization (WHO) limits and Indonesian Drinking and Domestic Water Quality Standard for Ground Water (IWQS), groundwater of Semarang Coastal Areas was contaminated with pesticide and heavy metal. This study has proven the presence of organochlorine and heavy metal contamination of some shallow aquifer supplies in the coastal areas of Semarang.

  19. Organochlorine compounds and trace elements in fish tissue and bed sediments in the lower Snake River basin, Idaho and Oregon

    Science.gov (United States)

    Clark, Gregory M.; Maret, Terry R.

    1998-01-01

    Fish-tissue and bed-sediment samples were collected to determine the occurrence and distribution of organochlorine compounds and trace elements in the lower Snake River Basin. Whole-body composite samples of suckers and carp from seven sites were analyzed for organochlorine compounds; liver samples were analyzed for trace elements. Fillets from selected sportfish were analyzed for organochlorine compounds and trace elements. Bed-sediment samples from three sites were analyzed for organochlorine compounds and trace elements. Twelve different organochlorine compounds were detected in 14 fish-tissue samples. All fish-tissue samples contained DDT or its metabolites. Concentrations of total DDT ranged from 11 micrograms per kilogram wet weight in fillets of yellow perch from C.J. Strike Reservoir to 3,633 micrograms per kilogram wet weight in a whole-body sample of carp from Brownlee Reservoir at Burnt River. Total DDT concentrations in whole-body samples of sucker and carp from the Snake River at C.J. Strike Reservoir, Snake River at Swan Falls, Snake River at Nyssa, and Brownlee Reservoir at Burnt River exceeded criteria established for the protection of fish-eating wildlife. Total PCB concentrations in a whole-body sample of carp from Brownlee Reservoir at Burnt River also exceeded fish-eating wildlife criteria. Concentrations of organochlorine compounds in whole-body samples, in general, were larger than concentrations in sportfish fillets. However, concentrations of dieldrin and total DDT in fillets of channel catfish from the Snake River at Nyssa and Brownlee Reservoir at Burnt River, and concentrations of total DDT in fillets of smallmouth bass and white crappie from Brownlee Reservoir at Burnt River exceeded a cancer risk screening value of 10-6 established by the U.S. Environmental Protection Agency. Concentrations of organochlorine compounds in bed sediment were smaller than concentrations in fish tissue. Concentrations of p,p'DDE, the only compound detected

  20. Organochlorine pollutants in grey seal (Halichoerus grypus) pups and their impact on plasma thyroid hormone and vitamin A concentrations

    OpenAIRE

    Sørmo, Eugen Gravningen

    2005-01-01

    Studies on laboratory animals suggest that developing and newborn mammals are more vulnerable than the adults with respect to the harmful effects of organochlorine (OC) pollutants such polychlorinated biphenyls (PCBs) and OC pesticides (Brouwer et al. 1995; 1998a; Colborn 2004). These effects include neurobiological and neurochemical effects, reproductive effects, reduced brain and circulatory thyroid hormone levels, impaired immune functions and vitamin A homeostasis (Brouwer et al. 1995; Co...

  1. Levels of Organochlorine Pesticides in Blood Plasma from Residents of Malaria-Endemic Communities in Chiapas, Mexico

    OpenAIRE

    Ruiz-Suárez, Luz E.; Castro-Chan, Ricardo A.; Rivero-Pérez, Norma E.; Trejo-Acevedo, Antonio; Guillén-Navarro, Griselda K.; Geissen, Violette; Bello-Mendoza, Ricardo

    2014-01-01

    Organochlorine (OC) pesticides have been extensively used for pest control in agriculture and against malaria vectors in the region of Soconusco, Chiapas, in southern Mexico. Our study aimed to identify whether the inhabitants of four Soconusco communities at different locations (i.e., altitudes) and with different history of use of OC pesticides, have been similarly exposed to residues of these pesticides. In particular, we analyzed the potential relationship between levels of OC pesticides ...

  2. Biochar in Co-Contaminated Soil Manipulates Arsenic Solubility and Microbiological Community Structure, and Promotes Organochlorine Degradation

    Science.gov (United States)

    Gregory, Samuel J.; Anderson, Christopher W. N.; Camps-Arbestain, Marta; Biggs, Patrick J.; Ganley, Austen R. D.; O’Sullivan, Justin M.; McManus, Michael T.

    2015-01-01

    We examined the effect of biochar on the water-soluble arsenic (As) concentration and the extent of organochlorine degradation in a co-contaminated historic sheep-dip soil during a 180-d glasshouse incubation experiment. Soil microbial activity, bacterial community and structure diversity were also investigated. Biochar made from willow feedstock (Salix sp) was pyrolysed at 350 or 550°C and added to soil at rates of 10 g kg-1 and 20 g kg-1 (representing 30 t ha-1 and 60 t ha-1). The isomers of hexachlorocyclohexane (HCH) alpha-HCH and gamma-HCH (lindane), underwent 10-fold and 4-fold reductions in concentration as a function of biochar treatment. Biochar also resulted in a significant reduction in soil DDT levels (P biochar treatments after 60 days of treatment compared to the control. 16S amplicon sequencing revealed that biochar-amended soil contained more members of the Chryseobacterium, Flavobacterium, Dyadobacter and Pseudomonadaceae which are known bioremediators of hydrocarbons. We hypothesise that a recorded short-term reduction in the soluble As concentration due to biochar amendment allowed native soil microbial communities to overcome As-related stress. We propose that increased microbiological activity (dehydrogenase activity) due to biochar amendment was responsible for enhanced degradation of organochlorines in the soil. Biochar therefore partially overcame the co-contaminant effect of As, allowing for enhanced natural attenuation of organochlorines in soil. PMID:25923541

  3. Sources and characteristics of organochlorine pesticides in the soil and sediment along the Kaidu-Peacock River, Northwest of China

    Science.gov (United States)

    Chen, Wei; Qi, Shihua; Peng, Fei; Qu, Chengkai; Zhang, Yuan; Xing, Xinli; Zhang, Jiaquan

    2016-04-01

    Organochlorine pesticides (OCPs) are a sub-group of persistent organic pollutants (POPs), which have raised the concerns from researchers all around the world for several decades. But very little research has been conducted on POPs in the arid zone of Northwest China. More than 100 soil and sediment samples were collected from Kaidu-Peacock River of Xinjiang, Northwest of China, to investigate the organochlorine pesticides (OCPs) in this region analysed by the gas chromatograph equipped with a mass selective detector (GC-MSD). Our pre-study in 2006 (Chen et al. 2011) in the same region, showed that OCPs except o,p'-DDT were detected in sediments from the Peacock River. Similar results were found in the whole river catchment in this investigation. DDTs, HCHs, chlordanes and endosulfans were the dominant OCPs residual in the soil and sediments. This study confirmed that POPs, such as OCPs in this region were contributed to by both local emissions and long-term atmospheric transport and may pose risks to human health and the ecosystem. Chen, W., Jing, M., Bu, J., Ellis Burnet, J., Qi, S., Song, Q., Ke, Y., Miao, J., Liu, M. & Yang, C. (2011) Organochlorine pesticides in the surface water and sediments from the Peacock River Drainage Basin in Xinjiang, China: a study of an arid zone in Central Asia. Environmental Monitoring and Assessment, 177, 1-21.

  4. Probabilistic risk assessment of insecticide concentrations in agricultural surface waters: a critical appraisal.

    Science.gov (United States)

    Stehle, Sebastian; Knäbel, Anja; Schulz, Ralf

    2013-08-01

    Due to the specific modes of action and application patterns of agricultural insecticides, the insecticide exposure of agricultural surface waters is characterized by infrequent and short-term insecticide concentration peaks of high ecotoxicological relevance with implications for both monitoring and risk assessment. Here, we apply several fixed-interval strategies and an event-based sampling strategy to two generalized and two realistic insecticide exposure patterns for typical agricultural streams derived from FOCUS exposure modeling using Monte Carlo simulations. Sampling based on regular intervals was found to be inadequate for the detection of transient insecticide concentrations, whereas event-triggered sampling successfully detected all exposure incidences at substantially lower analytical costs. Our study proves that probabilistic risk assessment (PRA) concepts in their present forms are not appropriate for a thorough evaluation of insecticide exposure. Despite claims that the PRA approach uses all available data to assess exposure and enhances risk assessment realism, we demonstrate that this concept is severely biased by the amount of insecticide concentrations below detection limits and therefore by the sampling designs. Moreover, actual insecticide exposure is of almost no relevance for PRA threshold level exceedance frequencies and consequential risk assessment outcomes. Therefore, we propose a concept that features a field-relevant ecological risk analysis of agricultural insecticide surface water exposure. Our study quantifies for the first time the environmental and economic consequences of inappropriate monitoring and risk assessment concepts used for the evaluation of short-term peak surface water pollutants such as insecticides.

  5. Comparative organochlorine accumulation in two ecologically similar shark species (Carcharodon carcharias and Carcharhinus obscurus) with divergent uptake based on different life history.

    Science.gov (United States)

    Beaudry, Marina C; Hussey, Nigel E; McMeans, Bailey C; McLeod, Anne M; Wintner, Sabine P; Cliff, Geremy; Dudley, Sheldon F J; Fisk, Aaron T

    2015-09-01

    Trophic position and body mass are traits commonly used to predict organochlorine burdens. Sharks, however, have a variety of feeding and life history strategies and metabolize lipid uniquely. Because of this diversity, and the lipid-association of organochlorines, the dynamics of organochlorine accumulation in sharks may be predicted ineffectively by stable isotope-derived trophic position and body mass, as is typical for other taxa. The present study compared ontogenetic organochlorine profiles in the dusky shark (Carcharhinus obscurus) and white shark (Carcharodon carcharias), which differ in metabolic thermoregulation and trophic position throughout their ontogeny. Although greater organochlorine concentrations were observed in the larger bodied and higher trophic position white shark (e.g., p,p'-dichlorodiphenyldichloroethylene: 20.2 ± 2.7 ng/g vs 9.3 ± 2.2 ng/g in the dusky shark), slopes of growth-dilution corrected concentrations with age were equal to those of the dusky shark. Similar ontogenetic trophic position increases in both species, less frequent white shark seal predation than previously assumed, or inaccurate species-specific growth parameters are possible explanations. Inshore habitat use (indicated by δ(13)C values) and mass were important predictors in white and dusky sharks, respectively, of both overall compound profiles and select organochlorine concentrations. The present study clarified understanding of trophic position and body mass as reliable predictors of interspecific organochlorine accumulation in sharks, whereas regional endothermy and diet shifting were shown to have less impact on overall rates of accumulation. © 2015 SETAC.

  6. A potential target for organophosphate insecticides leading to spermatotoxicity.

    Science.gov (United States)

    Suzuki, Himiko; Tomizawa, Motohiro; Ito, Yuki; Abe, Keisuke; Noro, Yuki; Kamijima, Michihiro

    2013-10-16

    Organophosphate (OP) insecticides as an anticholinesterase also act on the diverse serine hydrolase targets, thereby revealing secondary or unexpected toxic effects including male reproductive toxicity. The present investigation detects a possible target molecule(s) for OP-induced spermatotoxicity (sperm deformity, underdevelopment, and reduced motility) from a chemical standpoint. The activity-based protein profiling (ABPP) approach with a phosphonofluoridate fluorescent probe pinpointed the molecular target for fenitrothion (FNT, a major OP insecticide) oxon (bioactive metabolite of FNT) in the mouse testicular membrane proteome, i.e., FNT oxon phosphorylates the fatty acid amide hydrolase (FAAH), which plays pivotal roles in spermatogenesis and sperm motility acquirement. Subsequently, mice were treated orally with vehicle or FNT for 10 days, and FAAH activity in testis or epididymis cauda was markedly reduced by the subacute exposure. ABPP analysis revealed that FAAH was selectively inhibited among the FNT-treated testicular membrane proteome. Accordingly, FAAH is a potential target for OP-elicited spermatotoxicity.

  7. Voltage-gated sodium channels as targets for pyrethroid insecticides.

    Science.gov (United States)

    Field, Linda M; Emyr Davies, T G; O'Reilly, Andrias O; Williamson, Martin S; Wallace, B A

    2017-10-01

    The pyrethroid insecticides are a very successful group of compounds that have been used extensively for the control of arthropod pests of agricultural crops and vectors of animal and human disease. Unfortunately, this has led to the development of resistance to the compounds in many species. The mode of action of pyrethroids is known to be via interactions with the voltage-gated sodium channel. Understanding how binding to the channel is affected by amino acid substitutions that give rise to resistance has helped to elucidate the mode of action of the compounds and the molecular basis of their selectivity for insects vs mammals and between insects and other arthropods. Modelling of the channel/pyrethroid interactions, coupled with the ability to express mutant channels in oocytes and study function, has led to knowledge of both how the channels function and potentially how to design novel insecticides with greater species selectivity.

  8. Synthesis and Insecticidal Activities of Novel Phthalic Acid Diamides

    Institute of Scientific and Technical Information of China (English)

    闫涛; 李玉新; 李永强; 王多义; 陈伟; 刘卓; 李正名

    2012-01-01

    In order to discover novel insecticides with the new action mode on ryanodine receptor (RyR), a series of novel phthalic acid diamide derivatives were designed and synthesized. All compounds were characterized by 1H NMR spectra and HRMS. The preliminary results of biological activity assessment indicated that some title compounds exhibited excellent insecticidal activities against Mythimna separata, Spodoptera exigua, and Plutella xylostella. The title compound 3-nitro-N-cyclopropyl-N'-[2-methyl-4-(perfluoropropan-2-yl)phenyl]phthalamidte (4a) was more efficient against diamondback moths than the control (chlorantraniliprole). The effects of some title compounds on intracellular calcium of neurons from the Spodoptera exigua proved that the title compounds were RyR activators.

  9. Fipronil insecticide: novel photochemical desulfinylation with retention of neurotoxicity

    International Nuclear Information System (INIS)

    Hainzl, D.; Casida, J.E.

    1996-01-01

    Fipronil is an outstanding new insecticide for crop protection with good selectivity between insects and mammals. The insecticidal action involves blocking the gamma-aminobutyric acid-gated chloride channel with much greater sensitivity of this target in insects than in mammals. Fipronil contains a trifluoromethylsulfinyl moiety that is unique among the agrochemicals and therefore presumably important in its outstanding performance. We find that this substituent unexpectedly undergoes a novel and facile photoextrusion reaction on plants upon exposure to sunlight, yielding the corresponding trifluoromethylpyrazole, i.e., the desulfinyl derivative. The persistence of this photoproduct and its high neuroactivity, resulting from blocking the gamma-aminobutyric acid-gated chloride channel, suggest that it may be a significant contributor to the effectiveness of fipronil. In addition, desulfinylfipronil is not a metabolite in mammals, so the safety evaluations must take into account not only the parent compound but also this completely new environmental product

  10. Fish consumption and plasma levels of organochlorines in a female population in Northern Norway.

    Science.gov (United States)

    Furberg, Anne-Sofie; Sandanger, Torkjel; Thune, Inger; Burkow, Ivan C; Lun, Eiliv

    2002-02-01

    Increased cancer incidence and mortality have been found among humans exposed to high levels of organochlorines (OCs), either accidentally or as industrial workers. In order to assess levels of OCs in Norwegian women north of the Arctic Circle and validate self-reported fish consumption as a surrogate measure of organochlorine body burden, concentrations of seven polychlorinated biphenyl (PCB) congeners [IUPAC Nos. CB-105, CB-118, CB-138 (+ CB-163), CB-153, CB-180, CB-183, CB-187], beta-hexachlorocyclohexane (beta-HCH), 2,2'-bis(p-chlorophenyl)-1,1-dichloroethylene (p,p'-DDE) and cis- and trains-chlordane (c-CD and t-CD) were examined in plasma samples of middle-aged women attending for health screening. Altogether, 47 of those invited (81%) completed a questionnaire and donated a suitable blood sample. The ability of questionnaire data to predict plasma levels of OCs was tested in linear and logistic regression analyses. Measured plasma concentrations were in the range reported for the general female population of other Western countries and the relative amounts of PCBs were similar to the circumpolar pattern. Intake of seagulls' eggs was a predictor of PCB congeners CB-138 (+CB-163) (p<0.05) and CB-153 (p<0.01). No other food category was positively associated with any compound. In contrast, duration of residence in the study municipality, body mass index (BMI) and lifetime lactation (months) were the best univariate predictors. There was an increase in beta-HCH, p,p'-DDE and most of the PCBs (p<0.05 for all) with increasing length of time a subject had lived in the municipality. BMI was a positive predictor for beta-HCH (OR=3.10, 95% CI 1.50-6.43, per 5 kgm(-2)), chlordane (OR=2.13, 95% CI 1.12-4.05, per 5 kgm(-2)) and CB-105 and CB-153 (p<0.05 for both). Lactation was negatively associated with all OCs (p<0.05), except chlordane and two of the PCB congeners. Time living in the municipality and lactation explained 34%, of the variance in concentration of total

  11. Differential effects of a complex organochlorine mixture on the proliferation of breast cancer cell lines

    Energy Technology Data Exchange (ETDEWEB)

    Aube, Michel, E-mail: 4aubem@videotron.ca [Axe de recherche en sante des populations et environnementale, Centre de recherche du Centre hospitalier universitaire de Quebec and Universite Laval, 2875 Boulevard Laurier, Edifice Delta 2, bureau 600, Quebec, QC, Canada G1V 2M2 (Canada); Larochelle, Christian, E-mail: christian.larochelle@inspq.qc.ca [Axe de recherche en sante des populations et environnementale, Centre de recherche du Centre hospitalier universitaire de Quebec and Universite Laval, 2875 Boulevard Laurier, Edifice Delta 2, bureau 600, Quebec, QC, Canada G1V 2M2 (Canada); Ayotte, Pierre, E-mail: pierre.ayotte@inspq.qc.ca [Axe de recherche en sante des populations et environnementale, Centre de recherche du Centre hospitalier universitaire de Quebec and Universite Laval, 2875 Boulevard Laurier, Edifice Delta 2, bureau 600, Quebec, QC, Canada G1V 2M2 (Canada); Laboratoire de Toxicologie, Institut national de sante publique du Quebec, 945 avenue Wolfe, Quebec, QC, Canada G1V 5B3 (Canada)

    2011-04-15

    Organochlorine compounds (OCs) are a group of persistent chemicals that accumulate in fatty tissues with age. Although OCs has been tested individually for their capacity to induce breast cancer cell proliferation, few studies examined the effect of complex mixtures that comprise compounds frequently detected in the serum of women. We constituted such an OC mixture containing 15 different components in environmentally relevant proportions and assessed its proliferative effects in four breast cancer cell lines (MCF-7, T47D, CAMA-1, MDAMB231) and in non-cancerous CV-1 cells. We also determined the capacity of the mixture to modulate cell cycle stage of breast cancer cells and to induce estrogenic and antiandrogenic effects using gene reporter assays. We observed that low concentrations of the mixture (100x10{sup 3} and 50x10{sup 3} dilutions) stimulated the proliferation of MCF-7 cells while higher concentrations (10x10{sup 3} and 5x10{sup 3} dilutions) had the opposite effect. In contrast, the mixture inhibited the proliferation of non-hormone-dependent cell lines. The mixture significantly increased the number of MCF-7 cells entering the S phase, an effect that was blocked by the antiestrogen ICI 182,780. Low concentrations of the mixture also caused an increase in CAMA-1 cell proliferation but only in the presence estradiol and dihydrotestosterone (p<0.05 at the 50x10{sup 3} dilution). DDT analogs and polychlorinated biphenyls all had the capacity to stimulate the proliferation of CAMA-1 cells in the presence of sex steroids. Reporter gene assays further revealed that the mixture and several of its constituents (DDT analogs, aldrin, dieldrin, {beta}-hexachlorocyclohexane, toxaphene) induced estrogenic effects, whereas the mixture and several components (DDT analogs, aldrin, dieldrin and PCBs) inhibited the androgen signaling pathway. Our results indicate that the complex OC mixture increases the proliferation of MCF-7 cells due to its estrogenic potential. The

  12. The impact of insecticides to local honey bee colony Apis cerana indica in laboratory condition

    Science.gov (United States)

    Putra, Ramadhani E.; Permana, Agus D.; Nuriyah, Syayidah

    2014-03-01

    Heavy use of insecticides considered as one of common practice at local farming systems. Even though many Indonesian researchers had stated the possible detrimental effect of insecticide on agriculture environment and biodiversity, researches on this subject had been neglected. Therefore, our purpose in this research is observing the impact of insecticides usage by farmer to non target organisme like local honey bee (Apis cerana indica), which commonly kept in area near agriculture system. This research consisted of field observations out at Ciburial, Dago Pakar, Bandung and laboratory tests at School of Life Sciences and Technology, Institut Teknologi Bandung. The field observations recorded visited agriculture corps and types of pollen carried by bees to the nest while laboratory test recorderd the effect of common insecticide to mortality and behavior of honey bees. Three types of insecticides used in this research were insecticides A with active agent Chlorantraniliprol 50 g/l, insecticide B with active agent Profenofos 500 g/l, and insecticides C with active agent Chlorantraniliprol 100 g/l and λ-cyhalotrin 50g/l. The results show that during one week visit, wild flower, Wedelia montana, visited by most honey bees with average visit 60 honey bees followed by corn, Zea mays, with 21 honey bees. The most pollen carried by foragers was Wedelia montana, Calliandra callothyrsus, and Zea mays. Preference test show that honeybees tend move to flowers without insecticides as the preference to insecticides A was 12.5%, insecticides B was 0%, and insecticides was C 4.2%. Mortality test showed that insecticides A has LD50 value 0.01 μg/μl, insecticide B 0.31 μg/μl, and insecticides C 0.09 μg/μl which much lower than suggested dosage recommended by insecticides producer. This research conclude that the use of insecticide could lower the pollination service provide by honey bee due to low visitation rate to flowers and mortality of foraging bees.

  13. Insecticide susceptibility status of human biting mosquitoes in ...

    African Journals Online (AJOL)

    Matowo Pc

    91.5% (n=483) and An. funestus group was 8.5% (n=45). ..... Chitnis, N., Churcher, T., Donnelly, M.J., Ghani, A.C., Godfray, H.C.J., Gould, F., Hastings, ... Efficacy, persistence and vector susceptibility to pirimiphos-methyl (Actellic® 300CS) insecticide ... Macoris, M.L., Andrighetti, M.T.M., Wanderley, D.M.V. & Ribolla, P.E.M. ...

  14. A critical review of neonicotinoid insecticides for developmental neurotoxicity

    Science.gov (United States)

    Sheets, Larry P.; Li, Abby A.; Minnema, Daniel J.; Collier, Richard H.; Creek, Moire R.; Peffer, Richard C.

    2016-01-01

    Abstract A comprehensive review of published and previously unpublished studies was performed to evaluate the neonicotinoid insecticides for evidence of developmental neurotoxicity (DNT). These insecticides have favorable safety profiles, due to their preferential affinity for nicotinic receptor (nAChR) subtypes in insects, poor penetration of the mammalian blood–brain barrier, and low application rates. Nevertheless, examination of this issue is warranted, due to their insecticidal mode of action and potential exposure with agricultural and residential uses. This review identified in vitro, in vivo, and epidemiology studies in the literature and studies performed in rats in accordance with GLP standards and EPA guidelines with imidacloprid, acetamiprid, thiacloprid, clothianidin, thiamethoxam, and dinotefuran, which are all the neonicotinoids currently registered in major markets. For the guideline-based studies, treatment was administered via the diet or gavage to primiparous female rats at three dose levels, plus a vehicle control (≥20/dose level), from gestation day 0 or 6 to lactation day 21. F1 males and females were evaluated using measures of motor activity, acoustic startle response, cognition, brain morphometry, and neuropathology. The principal effects in F1 animals were associated with decreased body weight (delayed sexual maturation, decreased brain weight, and morphometric measurements) and acute toxicity (decreased activity during exposure) at high doses, without neuropathology or impaired cognition. No common effects were identified among the neonicotinoids that were consistent with DNT or the neurodevelopmental effects associated with nicotine. Findings at high doses were associated with evidence of systemic toxicity, which indicates that these insecticides do not selectively affect the developing nervous system. PMID:26513508

  15. Usage Possibilities of Insecticide Effective Biocidals in Organic Agriculture

    OpenAIRE

    Şimşek, Muharrem; Yağcı, Mürşide; Yaşarer, Haluk

    2016-01-01

    In conventional agriculture it is aimed that mainly increase in the amount of products, synthetic chemicals and fertilizers are used extensively to provide it. Today, terms such as safe food, human and environment health have become more important. Therefore, it is necessary to increase the share of organic agriculture which have less negative impacts to human health and environment, and sustainable use of natural resources. Herein environmentally insecticide effective biocidals to pest contr...

  16. Chemical Composition, Antifungal and Insecticidal Activities of Hedychium Essential Oils

    Science.gov (United States)

    2013-04-11

    Hedychiums have been reported to possess antibacterial, antifungal, and insecticidal activities [4,5]. Strawberry anthracnose, caused by the plant...pathogens Colletotrichum species is one of the most important diseases affecting strawberries worldwide [6]. Colletotrichum fragariae Brooks is most...often associated with anthracnose crown rot of strawberries grown in hot, humid areas such as the southeastern United States [7]. The azalea lace bug

  17. Cytochrome P450 monooxygenases and insecticide resistance in insects.

    OpenAIRE

    Bergé, J B; Feyereisen, R; Amichot, M

    1998-01-01

    Cytochrome P450 monooxygenases are involved in many cases of resistance of insects to insecticides. Resistance has long been associated with an increase in monooxygenase activities and with an increase in cytochrome P450 content. However, this increase does not always account for all of the resistance. In Drosophila melanogaster, we have shown that the overproduction of cytochrome P450 can be lost by the fly without a corresponding complete loss of resistance. These results prompted the seque...

  18. Culminating anti-malaria efforts at long lasting insecticidal net?

    Directory of Open Access Journals (Sweden)

    Sunil Dhiman

    2014-11-01

    Full Text Available Summary: Background: Long-lasting insecticidal nets (LLINs are a primary method in malaria control efforts. However, a decline in the biological efficacy and physical integrity over a period of comparatively lesser time than claimed, waning of naturally acquired immunity among regular users and misuse of LLINs are serious concerns. Search and selection of literature: The literature for the current review was searched in PubMed, SCOPUS Database and Google using combined search strings of related key-words. Literature with sufficient data and information on the current subject was selected to reach a valid conclusion. Findings: The World Health Organization (WHO has emphasized that LLINs should be considered a public good for people inhabiting malaria endemic settings. LLINs exhibited a cumulative effect on the vector density and may force anthropophilic mosquito vectors to find alternative animal hosts for blood meal. However, the physical integrity and biological activity of LLINs declines faster than the anticipated time due to different operational conditions and the spread of insecticide resistance. LLINs have been successful in reducing malaria incidences by either reducing or not allowing human exposure to the vector mosquitoes, but at the same time, LLINs debilitate the natural protective immunity against malaria parasite. Misuse of LLINs for deviant purposes is common and is a serious environmental concern, as people believe that traditional methods of prevention against malaria that have enabled them to survive through a long time are effective and sufficient. Moreover, people are often ill-informed regarding the toxic effects of LLINs. Conclusions: Specific criteria for determining the serviceable life and guidelines on the safe washing and disposal of LLINs need to be developed, kept well-informed and closely monitored. Malaria case management, environment management and community awareness to reduce the misuse of LLINs are crucial

  19. Chloride channels as tools for developing selective insecticides.

    Science.gov (United States)

    Bloomquist, Jeffrey R

    2003-12-01

    Ligand-gated chloride channels underlie inhibition in excitable membranes and are proven target sites for insecticides. The gamma-aminobutyric acid (GABA(1)) receptor/chloride ionophore complex is the primary site of action for a number of currently used insecticides, such as lindane, endosulfan, and fipronil. These compounds act as antagonists by stabilizing nonconducting conformations of the chloride channel. Blockage of the GABA-gated chloride channel reduces neuronal inhibition, which leads to hyperexcitation of the central nervous system, convulsions, and death. We recently investigated the mode of action of the silphinenes, plant-derived natural compounds that structurally resemble picrotoxinin. These materials antagonize the action of GABA on insect neurons and block GABA-mediated chloride uptake into mouse brain synaptoneurosomes in a noncompetitive manner. In mammals, avermectins have a blocking action on the GABA-gated chloride channel consistent with a coarse tremor, whereas at longer times and higher concentrations, activation of the channel suppresses neuronal activity. Invertebrates display ataxia, paralysis, and death as the predominant signs of poisoning, with a glutamate-gated chloride channel playing a major role. Additional target sites for the avermectins or other chloride channel-directed compounds might include receptors gated by histamine, serotonin, or acetylcholine.The voltage-sensitive chloride channels form another large gene family of chloride channels. Voltage-dependent chloride channels are involved in a number of physiological processes including: maintenance of electrical excitability, chloride ion secretion and resorption, intravesicular acidification, and cell volume regulation. A subset of these channels is affected by convulsants and insecticides in mammals, although the role they play in acute lethality in insects is unclear. Given the wide range of functions that they mediate, these channels are also potential targets for

  20. Sucrose Improves Insecticide Activity Against Drosophila suzukii (Diptera: Drosophilidae).

    Science.gov (United States)

    Cowles, Richard S; Rodriguez-Saona, Cesar; Holdcraft, Robert; Loeb, Gregory M; Elsensohn, Johanna E; Hesler, Steven P

    2015-04-01

    The addition of sucrose to insecticides targeting spotted wing drosophila, Drosophila suzukii (Matsumura), enhanced lethality in laboratory, semifield, and field tests. In the laboratory, 0.1% sucrose added to a spray solution enhanced spotted wing drosophila feeding. Flies died 120 min earlier when exposed to spinosad residues at label rates enhanced with sucrose. Added sucrose reduced the LC50 for dried acetamiprid residues from 82 to 41 ppm in the spray solution. Laboratory bioassays of spotted wing drosophila mortality followed exposure to grape and blueberry foliage and/or fruit sprayed and aged in the field. On grape foliage, the addition of 2.4 g/liter of sugar with insecticide sprays resulted in an 11 and 6% increase of spotted wing drosophila mortality at 1 and 2 d exposures to residues, respectively, averaged over seven insecticides with three concentrations. In a separate experiment, spinetoram and cyantraniliprole reduced by 95-100% the larval infestation of blueberries, relative to the untreated control, 7 d after application at labeled rates when applied with 1.2 g/liter sucrose in a spray mixture, irrespective of rainfall; without sucrose infestation was reduced by 46-91%. Adding sugar to the organically acceptable spinosyn, Entrust, reduced larval infestation of strawberries by >50% relative to without sugar for five of the six sample dates during a season-long field trial. In a small-plot field test with blueberries, weekly applications in alternating sprays of sucrose plus reduced-risk insecticides, spinetoram or acetamiprid, reduced larval infestation relative to the untreated control by 76%; alternating bifenthrin and phosmet (without sucrose) reduced infestation by 65%. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  1. A critical review of neonicotinoid insecticides for developmental neurotoxicity.

    Science.gov (United States)

    Sheets, Larry P; Li, Abby A; Minnema, Daniel J; Collier, Richard H; Creek, Moire R; Peffer, Richard C

    2016-02-01

    A comprehensive review of published and previously unpublished studies was performed to evaluate the neonicotinoid insecticides for evidence of developmental neurotoxicity (DNT). These insecticides have favorable safety profiles, due to their preferential affinity for nicotinic receptor (nAChR) subtypes in insects, poor penetration of the mammalian blood-brain barrier, and low application rates. Nevertheless, examination of this issue is warranted, due to their insecticidal mode of action and potential exposure with agricultural and residential uses. This review identified in vitro, in vivo, and epidemiology studies in the literature and studies performed in rats in accordance with GLP standards and EPA guidelines with imidacloprid, acetamiprid, thiacloprid, clothianidin, thiamethoxam, and dinotefuran, which are all the neonicotinoids currently registered in major markets. For the guideline-based studies, treatment was administered via the diet or gavage to primiparous female rats at three dose levels, plus a vehicle control (≥20/dose level), from gestation day 0 or 6 to lactation day 21. F1 males and females were evaluated using measures of motor activity, acoustic startle response, cognition, brain morphometry, and neuropathology. The principal effects in F1 animals were associated with decreased body weight (delayed sexual maturation, decreased brain weight, and morphometric measurements) and acute toxicity (decreased activity during exposure) at high doses, without neuropathology or impaired cognition. No common effects were identified among the neonicotinoids that were consistent with DNT or the neurodevelopmental effects associated with nicotine. Findings at high doses were associated with evidence of systemic toxicity, which indicates that these insecticides do not selectively affect the developing nervous system.

  2. Blended Refuge and Insect Resistance Management for Insecticidal Corn

    Science.gov (United States)

    Crespo, Andre L B; Pan, Zaiqi; Crain, Philip R; Thompson, Stephen D; Pilcher, Clinton D; Sethi, Amit

    2018-01-01

    Abstract In this review, we evaluate the intentional mixing or blending of insecticidal seed with refuge seed for managing resistance by insects to insecticidal corn (Zea mays). We first describe the pest biology and farming practices that will contribute to weighing trade-offs between using block refuges and blended refuges. Case studies are presented to demonstrate how the trade-offs will differ in different systems. We compare biological aspects of several abstract models to guide the reader through the history of modeling, which has played a key role in the promotion or denigration of blending in various scientific debates about insect resistance management for insecticidal crops. We conclude that the use of blended refuge should be considered on a case-by-case basis after evaluation of insect biology, environment, and farmer behavior. For Diabrotica virgifera virgifera, Ostrinia nubilalis, and Helicoverpa zea in the United States, blended refuge provides similar, if not longer, delays in the evolution of resistance compared to separate block refuges. PMID:29220481

  3. Efficacy of Selected Insecticides Applied to Hybrid Rice Seed

    Science.gov (United States)

    Adams, A.; Gore, J.; Musser, F.; Cook, D.; Walker, T.; Dobbins, C.

    2016-01-01

    Hybrid rice and insecticide seed treatments targeting rice water weevil, Lissorhoptrus oryzophilus Kuschel, have altered the landscape of rice production. The effect of reduced seeding rates on seed treatment efficacy in hybrid rice has not been studied. During 2011 and 2012, an experiment was conducted at seven locations to determine the relationship between low seeding rates used in hybrid rice and efficacy of selected insecticidal seed treatments as measured by rice water weevil densities and yield. Labeled rates of thiamethoxam, chlorantraniliprole, and clothianidin were compared with higher rates of these products to determine if labeled rates provide an acceptable level of control of the rice water weevil. Study locations were divided into low, moderate, and high groups based on rice water weevil larval densities. All seed treatments and seed treatment rates reduced rice water weevil densities. However, there was no observed yield or economic benefit from the use of an insecticidal seed treatment in areas of low pressure. Differences in yield were observed among seed treatments and seed treatment rates in moderate and high pressure locations, and all seed treatments yielded better than the untreated plots, but these differences were not always economical. All seed treatments showed an economic advantage in areas of high weevil pressure, and there were no differences among seed treatment products or rates, suggesting that currently labeled seed treatment rates in hybrid rice are effective for rice water weevil management. PMID:26537671

  4. Neonicotinoid insecticides can serve as inadvertent insect contraceptives

    Science.gov (United States)

    Villamar-Bouza, Laura; Bruckner, Selina; Chantawannakul, Panuwan; Gauthier, Laurent; Khongphinitbunjong, Kitiphong; Retschnig, Gina; Troxler, Aline; Vidondo, Beatriz; Neumann, Peter; Williams, Geoffrey R.

    2016-01-01

    There is clear evidence for sublethal effects of neonicotinoid insecticides on non-target ecosystem service-providing insects. However, their possible impact on male insect reproduction is currently unknown, despite the key role of sex. Here, we show that two neonicotinoids (4.5 ppb thiamethoxam and 1.5 ppb clothianidin) significantly reduce the reproductive capacity of male honeybees (drones), Apis mellifera. Drones were obtained from colonies exposed to the neonicotinoid insecticides or controls, and subsequently maintained in laboratory cages until they reached sexual maturity. While no significant effects were observed for male teneral (newly emerged adult) body mass and sperm quantity, the data clearly showed reduced drone lifespan, as well as reduced sperm viability (percentage living versus dead) and living sperm quantity by 39%. Our results demonstrate for the first time that neonicotinoid insecticides can negatively affect male insect reproductive capacity, and provide a possible mechanistic explanation for managed honeybee queen failure and wild insect pollinator decline. The widespread prophylactic use of neonicotinoids may have previously overlooked inadvertent contraceptive effects on non-target insects, thereby limiting conservation efforts. PMID:27466446

  5. Photodegradation of neonicotinoid insecticides in water by semiconductor oxides.

    Science.gov (United States)

    Fenoll, José; Garrido, Isabel; Hellín, Pilar; Flores, Pilar; Navarro, Simón

    2015-10-01

    The photocatalytic degradation of three neonicotinoid insecticides (NIs), thiamethoxam (TH), imidacloprid (IM) and acetamiprid (AC), in pure water has been studied using zinc oxide (ZnO) and titanium dioxide (TiO2) as photocatalysts under natural sunlight and artificial light irradiation. Photocatalytic experiments showed that the addition of these chalcogenide oxides in tandem with the electron acceptor (Na2S2O8) strongly enhances the degradation rate of these compounds in comparison with those carried out with ZnO and TiO2 alone and photolytic tests. Comparison of catalysts showed that ZnO is the most efficient for the removal of such insecticides in optimal conditions and at constant volumetric rate of photon absorption. Thus, the complete disappearance of all the studied compounds was achieved after 10 and 30 min of artificial light irradiation, in the ZnO/Na2S2O8 and TiO2/Na2S2O8 systems, respectively. The highest degradation rate was noticed for IM, while the lowest rate constant was obtained for AC under artificial light irradiation. In addition, solar irradiation was more efficient compared to artificial light for the removal of these insecticides from water. The main photocatalytic intermediates detected during the degradation of NIs were identified.

  6. Dermal insecticide residues from birds inhabiting an orchard

    Science.gov (United States)

    Vyas, N.B.; Spann, J.W.; Hulse, C.S.; Gentry, S.; Borges, S.L.

    2007-01-01

    The US Environmental Protection Agency conducts risk assessments of insecticide applications to wild birds using a model that is limited to the dietary route of exposure. However, free-flying birds are also exposed to insecticides via the inhalation and dermal routes. We measured azinphos-methyl residues on the skin plus feathers and the feet of brown-headed cowbirds (Molothrus ater) in order to quantify dermal exposure to songbirds that entered and inhabited an apple (Malus x domestica) orchard following an insecticide application. Exposure to azinphos-methyl was measured by sampling birds from an aviary that was built around an apple tree. Birds sampled at 36 h and 7-day post-application were placed in the aviary within 1 h after the application whereas birds exposed for 3 days were released into the aviary 4-day post-application. Residues on vegetation and soil were also measured. Azinphos-methyl residues were detected from the skin plus feathers and the feet from all exposure periods. Our results underscore the importance of incorporating dermal exposure into avian pesticide risk assessments.

  7. Evolution of resistance to pyrethroid insecticides in Musca domestica.

    Science.gov (United States)

    Scott, Jeffrey G

    2017-04-01

    Houseflies, Musca domestica L., are a significant pest because of the numerous diseases they transmit. Control of housefly populations, particularly at animal production facilities, is frequently done using pyrethroid insecticides which kill insects by prolonging the open time of the voltage-sensitive sodium channel (VSSC). Houseflies have evolved resistance to pyrethroids owing to mutations in Vssc and by cytochrome-P450-mediated detoxification. Three Vssc mutations are known: kdr (L1014F), kdr-his (L1014H) and super-kdr (M918T + L1014F). Generally, the levels of resistance conferred by these mutations are kdr-his resistance than kdr. P450-mediated resistance can result from overexpression of CYP6D1 or another P450 (unidentified) whose overexpression is linked to autosomes II or V. The initial use of field-stable pyrethroids resulted in different patterns of evolution across the globe, but with time these mutations have become more widespread in their distribution. What is known about the fitness costs of the resistance alleles in the absence of insecticide is discussed, particularly with respect to the current and future utility of pyrethroid insecticides. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  8. Mdr65 decreases toxicity of multiple insecticides in Drosophila melanogaster.

    Science.gov (United States)

    Sun, Haina; Buchon, Nicolas; Scott, Jeffrey G

    2017-10-01

    ABC transporters are ubiquitous membrane-bound proteins, present in both prokaryotes and eukaryotes. The major function of eukaryotic ABC transporters is to mediate the efflux of a variety of substrates (including xenobiotics) out of cells. ABC transporters have been widely investigated in humans, particularly for their involvement in multidrug resistance (MDR). Considerably less is known about their roles in transport and/or excretion in insects. ABC transporters are only known to function as exporters in insects. Drosophila melanogaster has 56 ABC transporter genes, including eight which are phylogenetically most similar to the human Mdr genes (ABCB1 clade). We investigated the role of ABC transporters in the ABCB1 clade in modulating the susceptibility to insecticides. We took advantage of the GAL4/UAS system in D. melanogaster to knockdown the expression levels of Mdr65, Mdr50, Mdr49 and ABCB6 using transgenic UAS-RNAi lines and conditional driver lines. The most notable effects were increased sensitivities to nine different insecticides by silencing of Mdr65. Furthermore, a null mutation of Mdr65 decreased the malathion, malaoxon and fipronil LC 50 values by a factor of 1.9, 2.1 and 3.9, respectively. Altogether, this data demonstrates the critical role of ABC transporters, particularly Mdr65, in altering the toxicity of specific, structurally diverse, insecticides in D. melanogaster. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. Effects of fish oil replacement and re-feeding on the bioaccumulation of organochlorine compounds in gilthead sea bream (Sparus aurata L.) of market size.

    Science.gov (United States)

    Nácher-Mestre, Jaime; Serrano, Roque; Benedito-Palos, Laura; Navarro, Juan C; López, Francisco J; Pérez-Sánchez, Jaume

    2009-08-01

    Organochlorine pesticide residues and polychlorinated biphenyls were determined in raw materials, fish feeds and fillets from fish exposed through the productive cycle (14 months) to experimental diets with different percentages of fish oil replacement with vegetable oils. Detectable amounts of organochlorine compounds were found in raw materials derived from fish sources with none being detected in vegetable ingredients. Fish feeds presented trace concentrations of contaminants at the ng/g level, which varied according to the contribution of the different resources used in their manufacture. Contaminants did not accumulate during the first 11 months of exposure, and low concentrations of organochlorine compounds were found both at the start and at the end of this feeding period. Fillets from fish fed the fish oil diet presented the highest concentrations of organochlorine compounds, with these decreasing in proportion to fish oil replacement. Three months of fish oil re-feeding during the finishing phase only produced significant bioaccumulation over the course of the first month. By optimizing fish meal and fish oil replacement with vegetable oils alternative feeds can contribute to significantly reduce the risk of organochlorine uptake by consumers.

  10. Substances inertes et plantes à effet insecticide utilisées dans la ...

    African Journals Online (AJOL)

    Les insecticides naturels tels que les plantes à effet insecticide et les substances inertes (sable, cendre, terres à diatomées,…) méritent d'être valorisées afin de réduire l'utilisation des insecticides chimiques et protéger l'environnement. Ce travail basé sur une revue documentaire fouillée et actualisée vise à faire la genèse ...

  11. Determination of insecticides malathion and lambda-cyhalothrin residues in zucchini by gas chromatography

    OpenAIRE

    Lofty, Hayam M.; Abd El-Aleem, Abd El-Aziz A.; Monir, Hany H.

    2013-01-01

    A sensitive gas chromatographic method has been developed for the determination of malathion and lambda-cyhalothrin (λ-cyhalothrin) insecticide residues in zucchini. The developed method consists of extraction with acetone, purification and partitioning with methylene chloride, column chromatographic clean-up, and finally capillary gas chromatographic determination of the insecticides. The recoveries of method were greater than 90% and limit of determination was 0.001 ppm for both insecticide...

  12. Organochlorine contaminants in seven species of Arctic seabirds from northern Baffin Bay

    International Nuclear Information System (INIS)

    Buckman, Andrea H.; Norstrom, Ross J.; Hobson, Keith A.; Karnovsky, Nina J.; Duffe, Jason; Fisk, Aaron T.

    2004-01-01

    Organochlorine contaminants (OCs) were determined in liver and fat of seven species of seabirds (Alle alle, Uria lomvia, Cepphus grylle, Rissa tridactyla, Pagophila eburnea, Larus hyperboreus, and Fulmaris glacialis) collected in May/June 1998 from the Northwater Polynya in northern Baffin Bay. OC concentrations ranged over an order of magnitude between seabird species and OC groups, with PCBs having the highest concentrations followed by DDT, chlordane, HCH and ClBz. Positive relationships between δ 15 N (estimator of trophic level) and OC concentrations (lipid basis) were found for all OC groups, showing that trophic position and biomagnification significantly influence OC concentrations in Arctic seabirds. Concentrations of a number of OCs in particular species (e.g., HCH in P. eburnean) were lower than expected based on δ 15 N and was attributed to biotransformation. P. eburnea and F. glacialis, which scavenge, and R. tridactyla, which migrate from the south, were consistently above the δ 15 N-OC regression providing evidence that these variables can elevate OC concentrations. Stable isotope measurements in muscle may not be suitable for identifying past scavenging events by seabirds. OC relative proportions were related to trophic position and phylogeny, showing that OC biotransformation varies between seabird groups. Trophic level, migration, scavenging and biotransformation all play important roles in the OCs found in Arctic seabirds. - Concentrations of organochlorides in high Arctic seabirds are influenced by trophic level, migration, scavenging and biotransformation

  13. Leaf-air transfer of organochlorine pesticides from three selected vegetables

    International Nuclear Information System (INIS)

    Yang Xinglun; Jiang Xin; Yu Guifen; Yao Fenxia; Bian Yongrong; Wang Fang

    2007-01-01

    The leaf-air transfer of organochlorine pesticides (OCPs) in three kinds of vegetables, namely lettuce, romaine and garlic leaves was investigated. It was found that although the uptake of OCPs by the three selected vegetables was similar under controlled conditions, the depuration varied significantly among chemicals and plant species in terms of elimination rate, final residue of each OCPs, as well as the effect of temperature on the residue of OCPs in the vegetables. The results indicated that neither QCB nor HCB could be trapped tightly by any of the three selected vegetables, in contrast, p,p'-DDT could be retained effectively by all of them; the retainment of α-HCH, γ-HCH, p,p'-DDE, was dependent on the vegetable species, of which the garlic leaf had the biggest ability to trap them. Our work provided insight into the behavior of OCPs in the agroecosystem. - The leaf-air transfer of OCPs varied significantly among chemicals and the three selected vegetables

  14. Dioxins, dioxin-like PCBs and organochlorine pesticides in farmed salmon of various origin

    Energy Technology Data Exchange (ETDEWEB)

    Karl, H. [Bundesforschungszentrum fuer Ernaehrung und Nahrung, Hamburg (Germany); Ruoff, U. [Bundesforschungszentrum fuer Ernaehrung und Nahrung, Kiel (Germany); Schwind, K.H.; Jira, W. [Bundesforschungszentrum fuer Ernaehrung und Nahrung, Kulmbach (Germany)

    2004-09-15

    With a market share of 8.4% in 2001 (approx. 100,000 t) farmed salmon is one of the most important fish species on the German market. The world wide production of salmon in 2001 was approximately 1.2 Mio t. Norway has produced around 450,000 t of Atlantic salmon of which 60,000 t has been exported to Germany. Other important suppliers of salmon to the German market are Scotland, Denmark, Chile and Ireland. The annual amount from Ireland is relatively small, being approximately 2,000 t. Most salmon is raised under conventional farming conditions. During the last years also high priced organically grown salmon is available on the German market, mainly produced in Ireland. With 800 t per year the market share of organically farmed salmon is less than 1%. Within the context of a study to develop methods for the detection of organically produced products taking salmon as example it was checked if the contaminant levels and/or the contaminant patterns are suitable to differentiate between organically and conventionally farmed salmon. Conventionally farmed salmon, referred as to farmed salmon, was collected from different European farms; organically farmed salmon, referred as to organic salmon, came from Ireland as well as wild Atlantic salmon, which was included into the study. In the present study dioxins, dioxin-like PCBs, marker PCBs and a range of organochlorine pesticides (toxaphene, chlordane, DDT, HCB etc.) in the muscle meat of salmon were investigated.

  15. Boiaccumulation of selected organochlorines in bats and tits: influence of chemistry and biology

    Energy Technology Data Exchange (ETDEWEB)

    Streit, B. [Frankfurt Univ. (Germany). Dept. of Ecology and Evolution; Winter, S. [Frankfurt Univ. (Germany). Dept. of Ecology and Evolution; Nagel, A. [Frankfurt Univ. (Germany). Dept. of Ecology and Evolution

    1995-12-01

    We analyzed six organochlorine compounds (HCB, lindane, p,p`-DDE, PCB nr. 138, nr. 153, and nr. 180) from populations of the European great tit (Parus major) and from five species of bats (Pipistrellus pipistrellus, Nyctalus noctula, Plecotus auritus, Plecotus austriacus, Myotis myotis). A weak positive correlation between K{sub ow} (n-octanol/water partition coefficient) and bioaccumulation (measured as residue values) was found within each species. However, the ratio of the concentrations in bats compared to titmice increased significantly with increasing K{sub ow}. We argue that this is explained by the intensive juvenile feeding through long-term lactation and thus by the more intensive transfer of strongly lipophilic xenobiotics from mother to juvenile in mammals compared to birds. Further, there were clear variations between bat species with ranges of up to 11 times the lowest value for a single compound. These differences are related to different feeding habits of the adults and to different species-specific life history traits, such as age at maturity and number of offspring. (orig.)

  16. Organochlorines in urban soils from Central India: probabilistic health hazard and risk implications to human population.

    Science.gov (United States)

    Kumar, Bhupander; Mishra, Meenu; Verma, V K; Rai, Premanjali; Kumar, Sanjay

    2018-04-21

    This study presents distribution of organochlorines (OCs) including HCH, DDT and PCBs in urban soils, and their environmental and human health risk. Forty-eight soil samples were extracted using ultrasonication, cleaned with modified silica gel chromatography and analyzed by GC-ECD. The observed concentrations of ∑HCH, ∑DDT and ∑PCBs in soils ranged between < 0.01-2.54, 1.30-27.41 and < 0.01-62.8 µg kg -1 , respectively, which were lower than the recommended soil quality guidelines. Human health risk was estimated following recommended guidelines. Lifetime average daily dose (LADD), non-cancer risk or hazard quotient (HQ) and incremental lifetime cancer risk (ILCR) for humans due to individual and total OCs were estimated and presented. Estimated LADD were lower than acceptable daily intake and reference dose. Human health risk estimates were lower than safe limit of non-cancer risk (HQ < 1.0) and the acceptable distribution range of ILCR (10 -6 -10 -4 ). Therefore, this study concluded that present levels of OCs (HCH, DDT and PCBs) in studied soils were low, and subsequently posed low health risk to human population in the study area.

  17. Organochlorine chemical residues in Northern Cardinal (Cardinalis cardinalis) eggs from Greater Washington, DC USA

    Science.gov (United States)

    Schmitt, Christopher J.; Echols, Kathy R.; Peterman, Paul; Orazio, Carl; Grimm, Christiana; Tan, Shirlee; Diggs, Nora E.; Marra, Peter P.

    2018-01-01

    Northern Cardinal eggs from six neighborhoods near Washington DC were analyzed for organochlorine pesticides and PCBs. All compounds were detected more frequently and at higher concentrations in more heavily urbanized neighborhoods. DDT (mostly as p,pʹ-DDE) was detected in all neighborhoods. p,pʹ-DDT was typically 0.5‒16 ng/g (ww) in most suburban neighborhoods but was not detected (< 0.1 ng/g) in more rural areas; however, p,pʹ-DDT was 127‒1130 ng/g in eggs from two suburban Maryland nests and comprised 65.7% of total p,pʹ-DDT isomers in the most contaminated sample, indicating recent exposure to un-weathered DDT. Total chlordane (sum of 5 compounds) was 2‒70 ng/g; concentrations were greatest in older suburban neighborhoods. Total PCB (sum of detected congeners) was < 5‒21 ng/g. Congener patterns were similar in all neighborhoods and resembled those typical of weathered mixtures. Results indicate that wildlife remains exposed to low concentrations of legacy contaminants in suburban neighborhoods and that cardinal eggs can be used to monitor localized contamination.

  18. Assessment of herbicides and organochlorine pesticides contamination in agricultural soils using gas chromatography-mass spectrometry.

    Science.gov (United States)

    Wang, Wan-Hong; Wang, Shi-Cheng; Wang, Yan-Hong

    2008-01-01

    A rapid multi-residue method for the simultaneous analysis of 3 herbicides and 8 organochlorine pesticides (OCPs) in agricultural soils has been developed, using ultrasonic solvent extraction coupled with gas chromatography-mass spectrometry (GC-MS). The recoveries ranged from 81% to 117% with a relative standard deviation (R.S.D) lower than 15%. The limits of quantification (LOQs) ranged from 0.03 to 1.06 microg x kg(-1) dry weight for different pesticides studied. The proposed method has been applied to investigate the 11 pesticide residues in agricultural soils collected from Liaoning Province, northeast of China. 3 OCPs and 3 herbicides were identified. Acetochlor, atrazine, butachtor were measured in the relatively high level with values ranging from 0.53 to 203.18 microg x kg(-1), 0.14 to 21.20 microg x kg(-1), pesticides in this study was compared with the date of other countries reported and the corresponding limiting values used in Netherland, USA, Canada, Vietnam and Thailand. Among the herbicide residues, there was a significant relativity between soil utilizing types and their residue concentration. It seems that the monitoring action for soil contamination caused by commonly-used herbicides should be enhanced according to soil utilizing types, especially acetochlor in maize field.

  19. SPME GC/MS determination of organochlorine pesticides in water samples

    Directory of Open Access Journals (Sweden)

    Yerbolat Sailaukhanuly

    2013-05-01

    Full Text Available Headspace solid phase microextraction (HS-SPME in combination with gas chromatography and mass-spectrometry (GC/MS was studied for analysis of water samples. The organochlorine pesticides (OCPs, p,p'-DDT, p,p'-DDD, and p,p'-DDE were collected and analyzed by GC/MS. To select of effective fiber coatings four types of SPME fibers were examined and compared. The parameters effecting the efficiency of HS-SPME such as extraction and pre-incubation time and extraction temperature, effect of solvent nature, ionic strength were studied to obtain optimal parameters. The method was developed using spiked water samples in a concentration range  10 - 500 ng/L. The calibration curve was linear over the studied concentration range with r≥0.9925. The detection limits varied from 1.57 to 2.08 ng/L. An authentic water samples from contaminated lake with OCPs were analyzed by developed method.

  20. Bioindicators of Organochlorine Pesticides in the Sea of Okhotsk and the Western Bering Sea.

    Science.gov (United States)

    Tsygankov, Vasiliy Yu; Boyarova, Margarita D; Lukyanova, Olga N; Khristoforova, Nadezhda K

    2017-08-01

    Organochlorine pesticides (OCPs), such as HCHs and DDTs, are still used as pesticides in the Southern Hemisphere and can reach the North Pacific due to long range atmospheric transfer. Marine mammals (Pacific walrus Odobenus rosmarus divergens, gray whale Eschrichtius robustus), the seabirds (Pacific gull Larus schistisagus, crested auklet Aethia cristatella, auklet crumb Aethia pusilla, northern fulmar Fulmarus glacialis, and grey petrel Oceanodroma furcata) and Pacific salmon (pink Oncorhynchus gorbuscha, chum O. keta, chinook O. tshawytscha, and sockeye O. nerka) were collected near the Kuril Islands (the northern-western part of the Pacific Ocean), in the Sea of Okhotsk and the Bering Sea. The total OCPs concentration (HCHs + DDTs) was found in each organism, including the Pacific walrus (70-90,263 ng/g lipid), the seabirds (29-16,095 ng/g lipid), and the Pacific salmon (41-7103 ng/g lipid). The concentrations and possible sources of OCPs in marine organisms as biological indicators are discussed.

  1. Organochlorine and organophosphorus pesticide residues in fodder and milk samples along Musi river belt, India

    Directory of Open Access Journals (Sweden)

    Korrapati Kotinagu

    2015-04-01

    Full Text Available Aim: The present study was conducted to find the organochlorine pesticide (OCP and organophosphorus pesticide (OPP residues in fodder and milk samples along Musi river belt, India. Materials and Methods: Fodder and milk samples collected from the six zones of Musi river belt, Hyderabad India were analyzed by gas chromatography with electron capture detector for OCP residues and pulsated flame photometric detector for the presence of OPP residues. Results: The gas chromatographic analysis of fodder samples of Zone 5 of Musi river showed the residues of dicofol at concentration of 0.07±0.0007 (0.071-0.077. Among organophosphorus compounds, dimetheoate was present in milk samples collected from Zone 6 at a level of 0.13±0.006 (0.111-0.167. The residues of OCPs, OPPs and cyclodies were below the detection limit in the remaining fodder and milk samples collected from Musi river belt in the present study. Conclusion: The results indicate that the pesticide residues in fodder and milk samples were well below the maximum residue level (MRL values, whereas dicofol in fodder and dimethoate in milk were slightly above the MRL values specified by EU and CODEX.

  2. Organochlorine and organophosphorus pesticide residues in fodder and milk samples along Musi river belt, India.

    Science.gov (United States)

    Kotinagu, Korrapati; Krishnaiah, Nelapati

    2015-04-01

    The present study was conducted to find the organochlorine pesticide (OCP) and organophosphorus pesticide (OPP) residues in fodder and milk samples along Musi river belt, India. Fodder and milk samples collected from the six zones of Musi river belt, Hyderabad India were analyzed by gas chromatography with electron capture detector for OCP residues and pulsated flame photometric detector for the presence of OPP residues. The gas chromatographic analysis of fodder samples of Zone 5 of Musi river showed the residues of dicofol at concentration of 0.07±0.0007 (0.071-0.077). Among organophosphorus compounds, dimetheoate was present in milk samples collected from Zone 6 at a level of 0.13±0.006 (0.111-0.167). The residues of OCPs, OPPs and cyclodies were below the detection limit in the remaining fodder and milk samples collected from Musi river belt in the present study. The results indicate that the pesticide residues in fodder and milk samples were well below the maximum residue level (MRL) values, whereas dicofol in fodder and dimethoate in milk were slightly above the MRL values specified by EU and CODEX.

  3. Leaf-air transfer of organochlorine pesticides from three selected vegetables

    Energy Technology Data Exchange (ETDEWEB)

    Yang Xinglun [State Key Laboratory of Soil and Sustainable Agriculture, Institute of Soil Science, Chinese Academy of Sciences, 71 East Beijing Road, Nanjing 210008 (China); Jiang Xin [State Key Laboratory of Soil and Sustainable Agriculture, Institute of Soil Science, Chinese Academy of Sciences, 71 East Beijing Road, Nanjing 210008 (China)]. E-mail: jiangxin@issas.ac.cn; Yu Guifen [State Key Laboratory of Soil and Sustainable Agriculture, Institute of Soil Science, Chinese Academy of Sciences, 71 East Beijing Road, Nanjing 210008 (China); Yao Fenxia [State Key Laboratory of Soil and Sustainable Agriculture, Institute of Soil Science, Chinese Academy of Sciences, 71 East Beijing Road, Nanjing 210008 (China); Bian Yongrong [State Key Laboratory of Soil and Sustainable Agriculture, Institute of Soil Science, Chinese Academy of Sciences, 71 East Beijing Road, Nanjing 210008 (China); Wang Fang [State Key Laboratory of Soil and Sustainable Agriculture, Institute of Soil Science, Chinese Academy of Sciences, 71 East Beijing Road, Nanjing 210008 (China)

    2007-07-15

    The leaf-air transfer of organochlorine pesticides (OCPs) in three kinds of vegetables, namely lettuce, romaine and garlic leaves was investigated. It was found that although the uptake of OCPs by the three selected vegetables was similar under controlled conditions, the depuration varied significantly among chemicals and plant species in terms of elimination rate, final residue of each OCPs, as well as the effect of temperature on the residue of OCPs in the vegetables. The results indicated that neither QCB nor HCB could be trapped tightly by any of the three selected vegetables, in contrast, p,p'-DDT could be retained effectively by all of them; the retainment of {alpha}-HCH, {gamma}-HCH, p,p'-DDE, was dependent on the vegetable species, of which the garlic leaf had the biggest ability to trap them. Our work provided insight into the behavior of OCPs in the agroecosystem. - The leaf-air transfer of OCPs varied significantly among chemicals and the three selected vegetables.

  4. Historical trends of organochlorine pesticides (OCPs) recorded in sediments across the Tibetan Plateau.

    Science.gov (United States)

    Yang, Ruiqiang; Xie, Ting; Yang, Handong; Turner, Simon; Wu, Guangjian

    2018-02-01

    Sediment cores from four lakes across the Tibetan Plateau were used as natural archives to study the time trends of organochlorine pesticides (OCPs). The total concentrations of dichlorodiphenyltrichloroethane (ΣDDT) and hexachlorocyclohexane isomers (ΣHCH) were in the range of 0.04-1.61 and 0.08-1.88 ng/g based on dry weight (dw), while the input fluxes were in the range of 0.3-236 and 0.7-295 pg/cm 2 /y in the core sediments, respectively. The input fluxes of ΣDDT and ΣHCH generally peaked in sediment layers corresponding to the 1970s-1990s and peaked in top sediment layers. The ratio of α/γ-HCH decreased in the top layer sediments, implying that the contribution of lindane (pure γ-HCH) has been increasing in recent years. In addition, the ratio of o,p'-DDT/p,p'-DDT increased significantly over the last 15-20 years, suggesting that dicofol (characterized by high ratio of o,p'-DDT/p,p'-DDT about 7.0) has recently become a relatively more important source of DDT compared to technical DDT itself. The time trends of OCPs recorded in lake sediments examined the impact on such remote alpine regions by human activities.

  5. Organochlorine pesticides in soils of Mexico and the potential for soil-air exchange.

    Science.gov (United States)

    Wong, Fiona; Alegria, Henry A; Bidleman, Terry F

    2010-03-01

    The spatial distribution of organochlorine pesticides (OCs) in soils and their potential for soil-air exchange was examined. The most prominent OCs were the DDTs (Geometric Mean, GM=1.6 ng g(-1)), endosulfans (0.16 ng g(-1)), and toxaphenes (0.64 ng g(-1)). DDTs in soils of southern Mexico showed fresher signatures with higher FDDTe=p,p'-DDT/(p,p'-DDT+p,p'-DDE) and more racemic o,p'-DDT, while the signatures in the central and northern part of Mexico were more indicative of aged residues. Soil-air fugacity fractions showed that some soils are net recipients of DDTs from the atmosphere, while other soils are net sources. Toxaphene profiles in soils and air showed depletion of Parlar 39 and 42 which suggests that soil is the source to the atmosphere. Endosulfan was undergoing net deposition at most sites as it is a currently used pesticide. Other OCs showed wide variability in fugacity, suggesting a mix of net deposition and volatilization. Copyright (c) 2009 Elsevier Ltd. All rights reserved.

  6. Organochlorine pesticide levels in adipose tissue of pregnant women in Veracruz, Mexico.

    Science.gov (United States)

    Herrero-Mercado, Margarita; Waliszewski, S M; Valencia-Quintana, R; Caba, M; Hernández-Chalate, F; García-Aguilar, E; Villalba, R

    2010-06-01

    DDT and Lindane (gamma-HCH) which were used until 1999 in Mexico, have provided great benefits in the combat of vectors that spread infection-borne diseases and in agriculture for crop protection. The persistence in the environment and their accumulative properties results in bioconcentration in lipid rich tissues of the human body that reflect the extent of environmental pollution. Human adipose tissue samples were taken during 2009 from abdominal cavities of 69 pregnant women by cesarean surgery and from 34 samples of control donors by autopsy in Veracruz State. The samples were analyzed by gas chromatography with ECD. The results of mean levels (mg/kg on fat basis) were higher in controls compared to pregnant women beta-HCH 0.064 vs 0.027; pp'DDE 1.187 vs. 0.745; op'DDT 0.016 vs. 0.011; pp'DDT 0.117 vs. 0.099 and Sigma-DDT 1.337 vs. 0.854. The pregnant women group was divided according to age: up to 20, 20-30, and more than 30 years, and presented an increase for the more persistent pesticides with age in terms of mean concentrations and a more pronounced higher correlation in medians levels. Pairing Body Mass Index to organochlorine pesticide mean levels revealed no correlation between these factors in pregnant women.

  7. Seasonal differences in organochlorine pesticide concentrations of zooplankton and fish in the Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Shailaja, M.S.; Nair, M.

    .44 *6.9l) < 0.4r(* c: 0.4x* Aidrin < 0.02* 4.53 (0.03) 2.81 (2.01) s 0.35 i/ (0.7) 2 0.09 (0.01) < 0.02* g % 0.16 s (0.05) q’ < 0.02* 0.52 * I .02 (0.46 i 0.73) 0.56 (0.06) 0.25 (0.62) Seasonal diferences in organochlorine... Demersal “Lipid-notmalised values in parentheses Fish: Plankton rufio” r-DDT Aldrin 0.05. 1.6 0.09. 2.7 (0.03--5.7) (0.04-l 2.9) 0.02-0.5 O-o.5 (0.20.~ 2.9) (W.0) 0.5 -4.1 Cl.6 (0.74.2) (63.9) 0.4-I .O O&l.2 (I .o -9.5) (O-35. I) Seasonal dif...

  8. Organochlorine pesticides and polychlorinated biphenyls in herring from the southern Baltic, 1983

    Energy Technology Data Exchange (ETDEWEB)

    Falandysz, J

    1986-02-01

    Hexachlorobenzene (HCB), alpha-, beta-, gamma- and delta-benzenehexachloride (BHC, HCH), p,p'-DDE, o,p'-DDD, o,p'-DDT, p,p'-DDD and p,p'-DDT (sigma DDT) and polychlorinated biphenyls (PCB) levels have been determined in muscle tissue of 187 herring (Clupea harengus) netted during 1983 in a different regions in the southern part of the Baltic Sea. The mean levels found for herring muscle tissue related to wet weight (microgram/kg) were: 14 HCB, 18 alpha-BHC, 23 beta-BHC, 14 gamma-BHC, delta-BHC remained undetected, 56 sigma BHC, 115 p,p'-DDE, o,p'-DDD and o,p'-DDT remained undetected, 84 p,p'-DDD, 51 p,p'-DDT, 250 sigma DDT and 530 PCB. The levels of organochlorine pesticides determined in wet muscles or extractable lipids of herring are nearly 2-3 times as high as those noted in fish sampled in the same area in two years before, while for PCBs the wet weight levels were comparable, and when based on a lipid weight are somewhat higher. The results are compared with levels found in herring collected in different regions of the Baltic Sea during 1965-1983, and reported previously by other authors.

  9. Passive air sampling of polychlorinated biphenyls, organochlorine compounds, and polybrominated diphenyl ethers across Asia.

    Science.gov (United States)

    Jaward, Foday M; Zhang, Gan; Nam, Jae Jak; Sweetman, Andrew J; Obbard, Jeffrey P; Kobara, Yuso; Jones, Kevin C

    2005-11-15

    Asia is of global importance economically, yet data on ambient persistent organic pollutant levels are still sparse for the region, despite international efforts under the Stockholm Convention to identify and reduce emissions. A large-scale passive air sampling survey was therefore conducted in Asia, specifically in China, Japan, South Korea, and Singapore. Polyurethane foam disks were deployed simultaneously at 77 sites, between Sept 21 and Nov 16, 2004, and analyzed for polychlorinated biphenyls (PCBs), organochlorine compounds (hexachlorobenzene (HCB), dichlorodiphenyltrichloroethanes (DDTs), chlordane), and polybrominated diphenyl ethers (PBDEs). The meteorological conditions prevailing in the region at this time facilitated the assessment of local/regional differences in atmospheric emissions, because large-scale advection effects due to monsoons or dust storms did not occur. Air concentrations estimated assuming an average sampler uptake rate of 3.5 m3/day ranged as follows (pg m(-3)): PCBs, 5-340; HCB, 10-460; DDTs, 0.4-1800; chlordanes, 1-660; PBDEs, < 0.13-340. South Korea and Singapore generally had regionally low concentrations. Elevated concentrations of PCBs, DDTs, and HCB occurred at sites in China, higher than reported in a similar recent sampling campaign in Europe. Chlordane was highest in samples from Japan (which also had elevated levels of PCBs and DDTs) and was also elevated in some Chinese locations. PBDE levels were generally low in the region.

  10. Organochlorines in harbor seal (Phoca vitulina) tissues from the northern Gulf of Alaska

    International Nuclear Information System (INIS)

    Wang Dongli; Atkinson, Shannon; Hoover-Miller, Anne; Lee, Sung-Eun; Li, Qing X.

    2007-01-01

    Polychlorinated biphenyls (PCBs), dichlorodiphenyltrichloroethane (DDT) and its metabolites, heptachlor and hexachlorocyclohexanes (HCHs) were analyzed in the harbor seal (Phoca vitulina) tissues collected from the Gulf of Alaska during 2000-2001. ΣPCBs (16-728 ng/g lw) and ΣDDTs (14-368 ng/g lw) were the predominant pollutants followed by ΣHCHs (0.56-93 ng/g lw) and heptachlor (≤0.068-6.0 ng/g lw). Concentrations of the above organochlorines (OCs) in the liver, kidney and blubber tissues correlated with ages, sex, body weight and blubber thickness of the harbor seals. The OC concentrations were similar between the samples collected from two different regions - Prince William Sound, and Kodiak Island and Southern Alaska Peninsula. Mean levels of OCs in nursing female adults were much lower than those in male adults, which indicate that lactation transfer OCs from mother seals to newborns. - Σ28 PCB congeners, p,p'-DDE, p,p'-DDD and p,p'-DDT, α-, β-, γ-, and δ-HCH and heptachlor in harbor seal tissues from the northern Gulf of Alaska are reported

  11. Organochlorine pesticide residues in strawberries from integrated pest management and organic farming.

    Science.gov (United States)

    Fernandes, Virginia C; Domingues, Valentina F; Mateus, Nuno; Delerue-Matos, Cristina

    2011-07-27

    A rapid, specific, and sensitive method based on the Quick Easy Cheap Effective Rugged and Safe (QuEChERS) method and a cleanup using dispersive solid-phase extraction with MgSO(4), PSA, and C18 sorbents has been developed for the routine analysis of 14 pesticides in strawberries. The analyses were performed by three different analytical methodologies: gas chromatography (GC) with electron capture detection (ECD), mass spectrometry (MS), and tandem mass spectrometry (MS/MS). The recoveries for all the pesticides studied were from 46 to 128%, with relative standard deviation of residue limits (MRL) accepted in Portugal for organochlorine pesticides (OCP). A survey study of strawberries produced in Portugal in the years 2009-2010 obtained from organic farming (OF) and integrated pest management (IPM) was developed. Lindane and β-endosulfan were detected above the MRL in OF and IPM. Other OCP (aldrin, o,p'-DDT and their metabolites, and methoxychlor) were found below the MRL. The OCP residues detected decreased from 2009 to 2010. The QuEChERS method was successfully applied to the analysis of strawberry samples.

  12. Dioxins, PCBs and organochlorine pesticides in human breast milk from Malaysia

    Energy Technology Data Exchange (ETDEWEB)

    Sudaryanto, A.; Kunisue, T.; Iwata, H.; Tanabe, S. [Center for Marine Environmental Studies, Ehime Univ., Matsuyama (Japan); Niida, M. [Japan Offspring Fund, Tokyo (Japan); Hashim, H. [Consumers Association of Penang, Pulau Pinang (Malaysia)

    2004-09-15

    Contaminations by persistent organic pollutants (POPs) such as polychlorinated dibenzo-p-dioxins (PCDDs), dibenzofurans (PCDFs), polychlorinated biphenyls (PCBs) and organochlorine pesticides in the environment have been of great concern due to their endocrine disrupting effects on humans and wildlife. Chemically stable and lipophilic properties of these contaminants led to their high contamination in higher trophic biota, including human. Despite the intensive monitoring efforts and anticipated results of decreasing trends of POPs in developed countries as a consequence of their regulation on use and waste treatment, little information are available on their contamination status in developing countries even though these chemicals are still being used and unintentionally produced in several parts of these countries. To ensure the reliability of exposure data and to delineate contamination status, fate and behavior in tropical developing countries, during last few years, our research groups conducted monitoring studies using various environmental matrices including air, water, sediment, soil, biota and human from several Asian developing countries. From these results, existing sources of OCs and formation of dioxins and related compounds could be predicted in this region. However, there is very little information addressing the accumulation of OCs pollution in Malaysia. Particularly available data are only on marine biota. To date no data are available on OCs contaminations in human milk samples from Malaysia. The present study aims at understanding recent contamination of POPs, including dioxins and related compounds, PCBs and OCs pesticides in human breast milk from the general population of Malaysia.

  13. Effect of home food processing on chlordecone (organochlorine) content in vegetables.

    Science.gov (United States)

    Clostre, Florence; Letourmy, Philippe; Thuriès, Laurent; Lesueur-Jannoyer, Magalie

    2014-08-15

    Decades after their use and their ban, organochlorine pesticides still pollute soil, water and food and lead to human and ecosystem exposure. In the case of chlordecone, human exposure is mainly due to the consumption of polluted food. We studied the effect of preparation and cooking in five vegetable products, three root vegetables (yam, dasheen and sweet potato) and two cucurbits (cucumber and pumpkin), among the main contributors to exposure to chlordecone in food in the French West Indies. Boiling the vegetables in water had no effect on chlordecone content of the vegetables and consequently on consumer exposure. The peel was three to 40-fold more contaminated than the pulp except cucumber, where the difference was less contrasted. The edible part is thus significantly less contaminated and peeling is recommended after rinsing to reduce consumer exposure, particularly for food grown in home gardens with contaminated soils. The type of soil had no consistent effect on CLD distribution but plot did. Peel and pulp composition (lipids and fibers) appear to partially account for CLD distribution in the product. Copyright © 2014 Elsevier B.V. All rights reserved.

  14. Extraction of Organochlorine Pesticides from Plastic Pellets and Plastic Type Analysis.

    Science.gov (United States)

    Pflieger, Marilyne; Makorič, Petra; Kovač Viršek, Manca; Koren, Špela

    2017-07-01

    Plastic resin pellets, categorized as microplastics (≤5 mm in diameter), are small granules that can be unintentionally released to the environment during manufacturing and transport. Because of their environmental persistence, they are widely distributed in the oceans and on beaches all over the world. They can act as a vector of potentially toxic organic compounds (e.g., polychlorinated biphenyls) and might consequently negatively affect marine organisms. Their possible impacts along the food chain are not yet well understood. In order to assess the hazards associated with the occurrence of plastic pellets in the marine environment, it is necessary to develop methodologies that allow for rapid determination of associated organic contaminant levels. The present protocol describes the different steps required for sampling resin pellets, analyzing adsorbed organochlorine pesticides (OCPs) and identifying the plastic type. The focus is on the extraction of OCPs from plastic pellets by means of a pressurized fluid extractor (PFE) and on the polymer chemical analysis applying Fourier Transform-InfraRed (FT-IR) spectroscopy. The developed methodology focuses on 11 OCPs and related compounds, including dichlorodiphenyltrichloroethane (DDT) and its two main metabolites, lindane and two production isomers, as well as the two biologically active isomers of technical endosulfan. This protocol constitutes a simple and rapid alternative to existing methodology for evaluating the concentration of organic contaminants adsorbed on plastic pieces.

  15. Air-soil exchange of organochlorine pesticides in a sealed chamber.

    Science.gov (United States)

    Yang, Bing; Han, Baolu; Xue, Nandong; Zhou, Lingli; Li, Fasheng

    2015-01-01

    So far little is known about air-soil exchange under any sealed circumstances (e.g., in plastic and glass sheds), which however has huge implications for the soil-air-plant pathways of persistent organic pollutants including organochlorine pesticides (OCPs). A newly designed passive air sampler was tested in a sealed chamber for measuring the vertical concentration profiles of gaseous phase OCPs (hexachlorocyclohexanes (HCHs) and dichlorodiphenyltrichloroethanes (DDTs)). Air was sampled at 5, 15, and 30 cm above ground level every 10th day during a 60-day period by deploying polyurethane foam cylinders housed in acrylonitrile butadiene styrene-covered cartridges. Concentrations and compositions of OCPs along the vertical sections indicated a clear relationship with proximity to the mixture of HCHs and DDTs which escapes from the soils. In addition, significant positive correlations were found between air temperatures and concentrations of HCHs and DDTs. These results indicated revolatilization and re-deposition being at or close to dynamic pseudo-equilibrium with the overlying air. The sampler used for addressing air-soil exchange of persistent organic pollutants in any sealed conditions is discussed. Copyright © 2014. Published by Elsevier B.V.

  16. Air-Seawater Exchange of Organochlorine Pesticides along the Sediment Plume of a Large Contaminated River.

    Science.gov (United States)

    Lin, Tian; Guo, Zhigang; Li, Yuanyuan; Nizzetto, Luca; Ma, Chuanliang; Chen, Yingjun

    2015-05-05

    Gaseous exchange fluxes of organochlorine pesticides (OCPs) across the air-water interface of the coastal East China Sea were determined in order to assess whether the contaminated plume of the Yangtze River could be an important regional source of OCPs to the atmosphere. Hexachlorocyclohexanes (HCHs), chlordane compounds (CHLs), and dichlorodiphenyltrichloroethanes (DDTs) were the most frequently detected OCPs in air and water. Air-water exchange was mainly characterized by net volatilization for all measured OCPs. The net gaseous exchange flux ranged 10-240 ng/(m2·day) for γ-HCH, 60-370 ng/(m2·day) for trans-CHL, 97-410 ng/(m2·day) for cis-CHL, and ∼0 (e.g., equilibrium) to 490 ng/(m2·day) for p,p'-DDE. We found that the plume of the large contaminated river can serve as a significant regional secondary atmospheric source of legacy contaminants released in the catchment. In particular, the sediment plume represented the relevant source of DDT compounds (especially p,p'-DDE) sustaining net degassing when clean air masses from the open ocean reached the plume area. In contrast, a mass balance showed that, for HCHs, contaminated river discharge (water and sediment) plumes were capable of sustaining volatilization throughout the year. These results demonstrate the inconsistencies in the fate of HCHs and DDTs in this large estuarine system with declining primary sources.

  17. Organic amendments for risk mitigation of organochlorine pesticide residues in old orchard soils

    Science.gov (United States)

    Centofantia, Tiziana; McConnell, Laura L.; Chaney, Rufus L.; Beyer, W. Nelson; Andradea, Natasha A.; Hapeman, Cathleen J.; Torrents, Alba; Nguyen, Anh; Anderson, Marya O.; Novak, J. M.; Jackson, Dana

    2015-01-01

    Performance of compost and biochar amendments for in situ risk mitigation of aged DDT, DDE and dieldrin residues in an old orchard soil was examined. The change in bioavailability of pesticide residues to Lumbricus terrestris L. relative to the unamended control soil was assessed using 4-L soil microcosms with and without plant cover in a 48-day experiment. The use of aged dairy manure compost and biosolids compost was found to be effective, especially in the planted treatments, at lowering the bioavailability factor (BAF) by 18–39%; however, BAF results for DDT in the unplanted soil treatments were unaffected or increased. The pine chip biochar utilized in this experiment was ineffective at lower the BAF of pesticides in the soil. The US EPA Soil Screening Level approach was used with our measured values. Addition of 10% of the aged dairy manure compost reduced the average hazard quotient values to below 1.0 for DDT + DDE and dieldrin. Results indicate this sustainable approach is appropriate to minimize risks to wildlife in areas of marginal organochlorine pesticide contamination. Application of this remediation approach has potential for use internationally in areas where historical pesticide contamination of soils remains a threat to wildlife populations.

  18. Sequestration of organochlorine pesticides in soils of distinct organic carbon content

    International Nuclear Information System (INIS)

    Zhang Na; Yang Yu; Tao Shu; Liu Yan; Shi Kelu

    2011-01-01

    In the present study, five soil samples with organic carbon contents ranging from 0.23% to 7.1% and aged with technical dichlorodiphenyltrichloroethane (DDT) and hexachlorocyclohexane (HCH) for 15 months were incubated in a sealed chamber to investigate the dynamic changes of the OCP residues. The residues in the soils decreased over the incubation period and finally reached a plateau. Regression analysis showed that degradable fractions of OCPs were negatively correlated with soil organic carbon (SOC) except for α-HCH, while no correlation was found between degradation rate and SOC, which demonstrated that SOC content determines the OCP sequestration fraction in soil. Analysis of the ratio of DDT and its primary metabolites showed that, since it depends on differential sequestration among them, magnitude of (p,p'-DDE + p,p'-DDD)/p,p'-DDT is not a reliable criterion for the identification of new DDT sources. - Research highlights: → Soil organic carbon content determines the OCP sequestration fraction in soil. → Magnitude of (p,p'-DDE + p,p'-DDD)/p,p'-DDT is not a reliable criterion for the identification of new DDT sources. → The more hydrophobic compounds have relatively higher sequestration fractions in soils with SOC contents >2%. → DDD may have higher sorption by soil organic matter than DDE. - The effect of soil organic matter on the sequestration of organochlorine pesticides (HCHs and DDTs) in soils was investigated in an innovative microcosm chamber.

  19. Characteristics and transport of organochlorine pesticides in urban environment: air, dust, rain, canopy throughfall, and runoff.

    Science.gov (United States)

    Zhang, Wei; Ye, Youbin; Hu, Dan; Ou, Langbo; Wang, Xuejun

    2010-11-01

    Characteristics and transport of organochlorine pesticides (OCPs) in urban multiple environments, including air, dust, rain, canopy throughfall, and runoff water, are explored in this study. Hexachlorocyclohexanes (HCHs) dominated in both air and rain water, and dichlorodiphenyltrichloroethane (DDT) related substances showed a higher affinity to dust. Relatively high concentrations of DDT and dichlorodiphenyldichloroethylene (DDE) in air, rain and dust imply that technical DDT in the environment has been degrading, and there may be unknown local or regional emission sources that contain DDTs in the study area. Source identification showed that DDTs in Beijing urban environments with a fresh signature may originate from the atmospheric transport from remote areas. The ratio of α-/γ-HCH in dust, rain, canopy throughfall and runoff were close to 1, indicating the possible use of lindane. OCPs in runoff were transported from various sources including rain, dust, and canopy throughfall. In runoff, DDTs and hexachlorobenzene (HCB) were mainly transported from dust, and HCHs were mainly from rain and canopy throughfall.

  20. Electrokinetic-Fenton remediation of organochlorine pesticides from historically polluted soil.

    Science.gov (United States)

    Ni, Maofei; Tian, Shulei; Huang, Qifei; Yang, Yanmei

    2018-04-01

    Soil contamination by persistent organic pollutants (POPs) poses a great threat to historically polluted soil worldwide. In this study, soils were characterized, and organochlorine pesticides contained in the soils were identified and quantified. Individual electrokinetic (IE), EK-Fenton-coupled technologies (EF), and enhanced EK-Fenton treatment (E-1, E-2, and E-3) were applied to remediate soils contaminated with hexachloro-cyclohexane soprocide (HCH) and dichloro-diphenyl-trichloroethane (DDT). Variation of pH, electrical conductivity, and electroosmotic flow was evaluated during the EK-Fenton process. The IE treatment showed low removal efficiency for HCHs (30.5%) and DDTs (25.9%). In the EF treatment, the highest removal level (60.9%) was obtained for α-HCH, whereas P,P-DDT was the lowest (40.0%). Low solubility of pollutants impeded the HCH and DDT removal. After enhanced EK-Fenton treatment, final removal of pollutants decreased as follows: β-HCH (82.6%) > γ-HCH (81.6%) > α-HCH (81.2%) > δ-HCH (80.0%) > P,P-DDD (73.8%) > P,P-DDE (73.1%) > P,P-DDT (72.6%) > O,P-DDT (71.5%). The results demonstrate that EK-Fenton is a promising technology for POP removal in historically polluted soil.

  1. Insecticide susceptibility of Anopheles mosquitoes changes in response to variations in the larval environment.

    Science.gov (United States)

    Owusu, Henry F; Chitnis, Nakul; Müller, Pie

    2017-06-16

    Insecticide resistance threatens the success achieved through vector control in reducing the burden of malaria. An understanding of insecticide resistance mechanisms would help to develop novel tools and strategies to restore the efficacy of insecticides. Although we have substantially improved our understanding of the genetic basis of insecticide resistance over the last decade, we still know little of how environmental variations influence the mosquito phenotype. Here, we measured how variations in larval rearing conditions change the insecticide susceptibility phenotype of adult Anopheles mosquitoes. Anopheles gambiae and A. stephensi larvae were bred under different combinations of temperature, population density and nutrition, and the emerging adults were exposed to permethrin. Mosquitoes bred under different conditions showed considerable changes in mortality rates and body weight, with nutrition being the major factor. Weight is a strong predictor of insecticide susceptibility and bigger mosquitoes are more likely to survive insecticide treatment. The changes can be substantial, such that the same mosquito colony may be considered fully susceptible or highly resistant when judged by World Health Organization discriminatory concentrations. The results shown here emphasise the importance of the environmental background in developing insecticide resistance phenotypes, and caution for the interpretation of data generated by insecticide susceptibility assays.

  2. Ecotoxicity of binary mixtures of Microcystis aeruginosa and insecticides to Daphnia pulex

    International Nuclear Information System (INIS)

    Asselman, J.; Janssen, C.R.; Smagghe, G.; De Schamphelaere, K.A.C.

    2014-01-01

    In aquatic ecosystems, mixtures of chemical and natural stressors can occur which may significantly complicate risk assessment approaches. Here, we show that effects of binary combinations of four different insecticides and Microcystis aeruginosa, a toxic cyanobacteria, on Daphnia pulex exhibited distinct interaction patterns. Combinations with chlorpyrifos and tetradifon caused non-interactive effects, tebufenpyrad caused an antagonistic interaction and fenoyxcarb yielded patterns that depended on the reference model used (i.e. synergistic with independent action, additive with concentration addition). Our results demonstrate that interactive effects cannot be generalised across different insecticides, not even for those targeting the same biological pathway (i.e. tebufenpyrad and tetradifon both target oxidative phosphorylation). Also, the concentration addition reference model provided conservative predictions of effects in all investigated combinations for risk assessment. These predictions could, in absence of a full mechanistic understanding, provide a meaningful solution for managing water quality in systems impacted by both insecticides and cyanobacterial blooms. - Highlights:: • 2 of 4 insecticide-Microcystis combinations showed no interactive effect on Daphnia. • One insecticide showed antagonistic deviation patterns. • For one other insecticide the results depended on the reference model used. • Interactive effects between insecticides and Microcystis cannot be generalized. • The concentration addition model provides conservative estimates of mixture effects. - Interactive effects between insecticides and cyanobacterial stressors cannot be generalized, not even for insecticides with closely related known modes of action

  3. Effects of irrigation levels on interactions among Lygus hesperus (Hemiptera: Miridae), insecticides, and predators in cotton.

    Science.gov (United States)

    Asiimwe, Peter; Naranjo, Steven E; Ellsworth, Peter C

    2014-04-01

    Variation in plant quality and natural enemy abundance plays an important role in insect population dynamics. In manipulative field studies, we evaluated the impact of varying irrigation levels and insecticide type on densities of Lygus hesperus Knight and the arthropod predator community in cotton. Three watering levels were established via irrigations timed according to three levels of percent soil water depletion (SWD): 20, 40, or 60, where 40% SWD is considered standard grower practice, 60% represents a deficit condition likely to impose plant productivity losses, and 20% represents surplus conditions with likely consequences on excessive vegetative plant production. The two key L. hesperus insecticides used were the broad-spectrum insecticide acephate and the selective insecticide flonicamid, along with an untreated check. We hypothesized that densities of L. hesperus and its associated predators would be elevated at higher irrigation levels and that insecticides would differentially impact L. hesperus and predator dynamics depending on their selectivity. L. hesperus were more abundant at the higher irrigation level (20% SWD) but the predator densities were unaffected by irrigation levels. Both L. hesperus and its predators were affected by the selectivity of the insecticide with highest L. hesperus densities and lowest predator abundance where the broad spectrum insecticide (acephate) was used. There were no direct interactions between irrigation level and insecticides, indicating that insecticide effects on L. hesperus and its predators were not influenced by the irrigation levels used here. The implications of these findings on the overall ecology of insect-plant dynamics and yield in cotton are discussed.

  4. Degradation of Organophosphorus and Pyrethroid Insecticides in Beverages: Implications for Risk Assessment

    Directory of Open Access Journals (Sweden)

    Samantha A. Radford

    2018-02-01

    Full Text Available Since urinary insecticide metabolites are commonly used as biomarkers of exposure, it is important that we quantify whether insecticides degrade in food and beverages in order to better perform risk assessment. This study was designed to quantify degradation of organophosphorus and pyrethroid insecticides in beverages. Purified water, white grape juice, orange juice, and red wine were fortified with 500 ng/mL diazinon, malathion, chlorpyrifos, permethrin, cyfluthrin, cypermethrin, and deltamethrin, and aliquots were extracted several times over a 15-day storage period at 2.5 °C. Overall, statistically significant loss of at least one insecticide was observed in each matrix, and at least five out of seven insecticides demonstrated a statistically significant loss in all matrices except orange juice. An investigation of an alternative mechanism of insecticide loss—adsorption onto the glass surface of the storage jars—was carried out, which indicated that this mechanism of loss is insignificant. Results of this work suggest that insecticides degrade in these beverages, and this degradation may lead to pre-existing insecticide degradates in the beverages, suggesting that caution should be exercised when using urinary insecticide metabolites to assess exposure and risk.

  5. Evaluation of the Insecticidal Efficacy of Wild Type and Recombinant Baculoviruses.

    Science.gov (United States)

    Popham, Holly J R; Ellersieck, Mark R; Li, Huarong; Bonning, Bryony C

    2016-01-01

    A considerable amount of work has been undertaken to genetically enhance the efficacy of baculovirus insecticides. Following construction of a genetically altered baculovirus, laboratory bioassays are used to quantify various parameters of insecticidal activity such as the median lethal concentration (or dose) required to kill 50 % of infected larvae (LC50 or LD50), median survival of larvae infected (ST50), and feeding damage incurred by infected larvae. In this chapter, protocols are described for a variety of bioassays and the corresponding data analyses for assessment of the insecticidal activity of baculovirus insecticides.

  6. Protective effect and economic impact of insecticide application methods on barley

    Directory of Open Access Journals (Sweden)

    Alfred Stoetzer

    2014-03-01

    Full Text Available The objective of this work was to evaluate the protective effect of different forms of insecticide application on the transmission of yellow dwarf disease in barley cultivars, as well as to determine the production costs and the net profit of these managements. The experiments were carried out during 2011 and 2012 growing seasons, using the following managements at main plots: T1, seed treatment with insecticide (ST + insecticide on shoots at 15-day interval; T2, just ST; T3, insecticide applied on shoots, when aphid control level (CL was reached; T4, without insecticide; and T5, ST + insecticide on shoots when CL was reached. Different barley cultivars - BRS Cauê, BRS Brau and MN 6021 - were arranged in the subplots. Insecticides lambda cyhalothrin (pyrethroid and thiamethoxam (neonicotinoid were used. There were differences on yellow dwarf disease index in both seasons for the different treatments, while damage to grain yield was influenced by year and aphid population. Production costs and net profit were different among treatments. Seed treatment with insecticide is sufficient to reduce the transmission of yellow dwarf disease in years with low aphid population pressure, while in years with larger populations, the application of insecticide on shoots is also required.

  7. Does multigenerational exposure to hormetic concentrations of imidacloprid precondition aphids for increased insecticide tolerance?

    Science.gov (United States)

    Rix, Rachel R; Cutler, G Christopher

    2018-02-01

    Hormetic preconditioning, whereby exposure to mild stress primes an organism to better tolerate subsequent stress, is well documented. It is unknown if exposure to hormetic concentrations of insecticide can trans-generationally prime insects to better tolerate insecticide exposure, or whether exposure to hormetic concentrations of insecticide can induce mutations in genes responsible for insecticide resistance. Using the aphid Myzus persicae (Sulzer) and the insecticide imidacloprid as a model, we examined if exposure to mildly toxic and hormetic concentrations of imidacloprid reduced aphid susceptibility to insecticides across four generations, and whether such exposures induced mutations in the imidacloprid binding site in post-synaptic nicotinic acetylcholine receptors. Chronic, multigenerational exposure of aphids to hormetic concentrations of imidacloprid primed offspring to better survive exposure to certain concentrations of imidacloprid, but not exposure to spirotetramat, an insecticide with a different mode of action. Exposure to hormetic and mildly toxic concentrations of imidacloprid did not result in mutations in any of the examined nicotinic acetylcholine receptor subunits. Our findings demonstrate that exposure to hormetic concentrations of insecticide can prime insects to better withstand subsequent chemical stress, but this is dependent upon the insecticide exposure scenario, and may be subtle over generations. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  8. Effects of persistent insecticides on beneficial soil arthropod in conventional fields compared to organic fields, puducherry.

    Science.gov (United States)

    Anbarashan, Padmavathy; Gopalswamy, Poyyamoli

    2013-07-15

    The usage of synthetic fertilizers/insecticides in conventional farming has dramatically increased over the past decades. The aim of the study was to compare the effects of bio-pesticides and insecticides/pesticides on selected beneficial non targeted arthropods. Orders Collembola, Arachinida/Opiliones, Oribatida and Coleoptera were the main groups of arthropods found in the organic fields and Coleoptera, Oribatida, Gamasida and Collembola in conventional fields. Pesticides/insecticides had a significant effect on non-targeted arthropods order- Collembola, Arachinida/Opiliones, Hymenoptera and Thysonoptera were suppressed after pesticides/insecticides spraying. Bio-insecticides in organic fields had a non-significant effect on non targeted species and they started to increase in abundance after 7 days of spraying, whereas insecticide treatment in conventional fields had a significant long-term effect on non targeted arthropods and short term effect on pests/insects, it started to increase after 21 days of the spraying. These results indicate that insecticide treatment kept non targeted arthropods at low abundance. In conclusion, organic farming does not significantly affected the beneficial-non targeted arthropods biodiversity, whereas preventive insecticide application in conventional fields had significant negative effects on beneficial non targeted arthropods. Therefore, conventional farmers should restrict insecticide applications, unless pest densities reach the thresholds and more desirably can switch to organic farming practices.

  9. Impact and Selectivity of Insecticides to Predators and Parasitoids

    Directory of Open Access Journals (Sweden)

    Flávio Lemes Fernandes

    2010-04-01

    Full Text Available Problems with the use of insecticides has brought losses, such as, negative impact on natural enemies. When these beneficial insects reduce cause the eruption of pests and resurgence it’s more common. Thus principles of conservation these arthropods are extremely important in the biological natural control of pests, so that these enemies may present a high performance. Because of the negative impacts caused by insecticides on agriculture and their harmful effects on natural enemies, the objective of this article is to approach two important subjects, divided into three parts. Part I relates to the description of the main crop pests and their natural enemies; Part II involves the impact of insecticides on predators and parasitoids and Part III focuses on the selectivity of several groups of insecticides to natural enemies. Before spraying insecticides, it is necessary to choose a product that is efficient to pests and selective to natural enemies. So, it is indispensable to identify correctly the groups and species of natural enemies, since insecticides have an impact on their survival, growth, development, reproduction (sexual ratio, fecundity, longevity and fertility, and behavior (motility, orientation, feeding, oviposition and learning of insects. The mechanisms of toxicity and selectivity of insecticides are related to the properties of higher or lower solubility and molecular weight. Besides, characteristics of the cuticular composition of the integument of natural enemies are extremely important in the selectivity of a product or the tolerance of a certain predator or parasitoid to this molecules.Impacto e Seletividade de Inseticidas para Predadores e ParasitóidesResumo.Dentre os problemas advindos do uso de inseticidas, a destruição de inimigos naturais é fator importante. Estes insetos benéficos podem reduzir problemas de erupção de pragas secundárias, ressurgência de pragas e manter a praga abaixo do nível de dano econ

  10. Sensitivity of Bemisia Tabaci (Hemiptera: Aleyrodidae) to Several New Insecticides in China: Effects of Insecticide Type and Whitefly Species, Strain, and Stage

    Science.gov (United States)

    Xie, Wen; Liu, Yang; Wang, Shaoli; Wu, Qingjun; Pan, Huipeng; Yang, Xin; Guo, Litao; Zhang, Youjun

    2014-01-01

    Abstract Whitefly biotypes B and Q are the two most damaging members of the Bemisia tabaci (Hemiptera: Aleyrodidae) species complex. Control of B. tabaci (and especially of Q) has been impaired by resistance to commonly used insecticides. To find new insecticides for B. tabaci management in China, we investigated the sensitivity of eggs, larvae, and adults of laboratory strains of B and Q (named Lab-B and Lab-Q) and field strains of Q to several insecticides. For eggs, larvae, and adults of B. tabaci and for six insecticides (cyantraniliprole, chlorantraniliprole, pyriproxyfen, buprofezin, acetamiprid, and thiamethoxam), LC 50 values were higher for Lab-Q than for Lab-B; avermectin LC 50 values, however, were low for adults of both Lab-Q and Lab-B. Based on the laboratory results, insecticides were selected to test against eggs, larvae, and adults of four field strains of B. tabaci Q. Although the field strains differed in their sensitivity to the insecticides, the eggs and larvae of all strains were highly sensitive to cyantraniliprole, and the adults of all strains were highly sensitive to avermectin. The eggs, larvae, and adults of B. tabaci Q were generally more resistant than those of B. tabaci B to the tested insecticides. B. tabaci Q eggs and larvae were sensitive to cyantraniliprole and pyriproxyfen, whereas B. tabaci Q adults were sensitive to avermectin. Field trials should be conducted with cyantraniliprole, pyriproxyfen, and avermectin for control of B. tabaci Q and B in China. PMID:25434040

  11. Insecticide Resistance and Metabolic Mechanisms Involved in Larval and Adult Stages of Aedes aegypti Insecticide-Resistant Reference Strains from Cuba.

    Science.gov (United States)

    Bisset, Juan Andrés; Rodríguez, María Magdalena; French, Leydis; Severson, David W; Gutiérrez, Gladys; Hurtado, Daymi; Fuentes, Ilario

    2014-12-01

    Studies were conducted to compare levels of insecticide resistance and to determine the metabolic resistance mechanisms in larval and adult stages of Aedes aegypti from Cuba. Three insecticide-resistant reference strains of Ae. aegypti from Cuba were examined. These strains were derived from a Santiago de Cuba strain isolated in 1997; it was previously subjected to a strong selection for resistance to temephos (SAN-F6), deltamethrin (SAN-F12), and propoxur (SAN-F13) and routinely maintained in the laboratory under selection pressure up to the present time, when the study was carried out. In addition, an insecticide-susceptible strain was used for comparison. The insecticide resistance in larvae and adults was determined using standard World Health Organization methodologies. Insecticide resistance mechanisms were determined by biochemical assays. The esterases (α EST and β EST) and mixed function oxidase (MFO) activities were significantly higher in adults than in the larvae of the three resistant strains studied. The association of resistance level with the biochemical mechanism for each insecticide was established for each stage. The observed differences between larval and adult stages of Ae. aegypti in their levels of insecticide resistance and the biochemical mechanisms involved should be included as part of monitoring and surveillance activities in Ae. aegypti vector control programs.

  12. Degradation of Insecticides in Poultry Manure: Determining the Insecticidal Treatment Interval for Managing House Fly (Diptera: Muscidae) Populations in Poultry Farms.

    Science.gov (United States)

    Ong, Song-Quan; Ab Majid, Abdul Hafiz; Ahmad, Hamdan

    2016-04-01

    It is crucial to understand the degradation pattern of insecticides when designing a sustainable control program for the house fly, Musca domestica (L.), on poultry farms. The aim of this study was to determine the half-life and degradation rates of cyromazine, chlorpyrifos, and cypermethrin by spiking these insecticides into poultry manure, and then quantitatively analyzing the insecticide residue using ultra-performance liquid chromatography. The insecticides were later tested in the field in order to study the appropriate insecticidal treatment intervals. Bio-assays on manure samples were later tested at 3, 7, 10, and 15 d for bio-efficacy on susceptible house fly larvae. Degradation analysis demonstrated that cyromazine has the shortest half-life (3.01 d) compared with chlorpyrifos (4.36 d) and cypermethrin (3.75 d). Cyromazine also had a significantly greater degradation rate compared with chlorpyrifos and cypermethrin. For the field insecticidal treatment interval study, 10 d was the interval that had been determined for cyromazine due to its significantly lower residue; for ChCy (a mixture of chlorpyrifos and cypermethrin), the suggested interval was 7 d. Future work should focus on the effects of insecticide metabolites on targeted pests and the poultry manure environment.

  13. The insecticide lindane. Identification of possible risks for human reproduction; L'insetticida lindano. Identificazione dei rischi possibili per la riproduzione umana

    Energy Technology Data Exchange (ETDEWEB)

    Traina, M E; Urbani, E [Istituto Superiore di Sanita' , Lab. di Igiene Ambientale, Rome (Italy); Rescia, M; Mantovani, A [Istituto Superiore di Sanita' , Lab. di Tossicologia Comparata e Ecotossicologia, Rome (Italy)

    2001-07-01

    A growing international concern exists about the potential harm to human reproduction caused by pollutants able to interfere with the endocrine system. Particular interest is addressed to organochlorine pesticides persisting in the environment and organisms; such compounds are extensively studied for their adverse effects on reproductive functions and development of laboratory animals. The insecticide lindane (the {gamma}-isomer of hexachlorocyclohexane), widely used before the 80s, has yet to be adequately evaluated as regards the possible reproductive risk. The present report contains a critical revision of the available scientific literature about lindane effects on the male and female reproductive system, pregnancy and development. Besides, the possible higher exposure periods to this pesticide (years 60s-70s) have been determined through the analysis of the lindane products consumed and the evaluation of the active ingredient levels in the environment and in the tissues and biological fluids, with particular regard to Italy. The present review aims at supporting further toxicological and epidemiological studies to assess the possible reproductive risk posed by environmental and professional exposure to chlorinated insecticides. [Italian] L'ipotesi che l'esposizione a sostanze inquinanti in grado di alterare l'equilibrio del sistema endocrino possa avere effetti sulla riproduzione umana e sullo sviluppo e' attualmente oggetto d'interesse nella comunita' scientifica. Particoalre attenzione e' stata indirizzata ai pesticidi organoclorurati a lunga persistenza nell'ambiente e negli organismi, per i quali esistono numerose evidenze di effetti nocivi per la riproduzione, negli studi di tossicologia sperimentale. L'insetticida lindano (l'isomero-{gamma} dell'esaclorocicloesano), largamente utilizzato prima degli anni '80, non e' stato fino ad oggi adeguatamente valutato per un possibile rischio riproduttivo a lungo termine. In questa rassegna e' stata pertanto

  14. The insecticide lindane. Identification of possible risks for human reproduction; L'insetticida lindano. Identificazione dei rischi possibili per la riproduzione umana

    Energy Technology Data Exchange (ETDEWEB)

    Traina, M.E.; Urbani, E. [Istituto Superiore di Sanita' , Lab. di Igiene Ambientale, Rome (Italy); Rescia, M.; Mantovani, A. [Istituto Superiore di Sanita' , Lab. di Tossicologia Comparata e Ecotossicologia, Rome (Italy)

    2001-07-01

    A growing international concern exists about the potential harm to human reproduction caused by pollutants able to interfere with the endocrine system. Particular interest is addressed to organochlorine pesticides persisting in the environment and organisms; such compounds are extensively studied for their adverse effects on reproductive functions and development of laboratory animals. The insecticide lindane (the {gamma}-isomer of hexachlorocyclohexane), widely used before the 80s, has yet to be adequately evaluated as regards the possible reproductive risk. The present report contains a critical revision of the available scientific literature about lindane effects on the male and female reproductive system, pregnancy and development. Besides, the possible higher exposure periods to this pesticide (years 60s-70s) have been determined through the analysis of the lindane products consumed and the evaluation of the active ingredient levels in the environment and in the tissues and biological fluids, with particular regard to Italy. The present review aims at supporting further toxicological and epidemiological studies to assess the possible reproductive risk posed by environmental and professional exposure to chlorinated insecticides. [Italian] L'ipotesi che l'esposizione a sostanze inquinanti in grado di alterare l'equilibrio del sistema endocrino possa avere effetti sulla riproduzione umana e sullo sviluppo e' attualmente oggetto d'interesse nella comunita' scientifica. Particoalre attenzione e' stata indirizzata ai pesticidi organoclorurati a lunga persistenza nell'ambiente e negli organismi, per i quali esistono numerose evidenze di effetti nocivi per la riproduzione, negli studi di tossicologia sperimentale. L'insetticida lindano (l'isomero-{gamma} dell'esaclorocicloesano), largamente utilizzato prima degli anni '80, non e' stato fino ad oggi adeguatamente valutato per un possibile rischio

  15. Gut Microbiota Mediate Insecticide Resistance in the Diamondback Moth, Plutella xylostella (L.).

    Science.gov (United States)

    Xia, Xiaofeng; Sun, Botong; Gurr, Geoff M; Vasseur, Liette; Xue, Minqian; You, Minsheng

    2018-01-01

    The development of insecticide resistance in insect pests is a worldwide concern and elucidating the underlying mechanisms is critical for effective crop protection. Recent studies have indicated potential links between insect gut microbiota and insecticide resistance and these may apply to the diamondback moth, Plutella xylostella (L.), a globally and economically important pest of cruciferous crops. We isolated Enterococcus sp. (Firmicutes), Enterobacter sp. (Proteobacteria), and Serratia sp. (Proteobacteria) from the guts of P. xylostella and analyzed the effects on, and underlying mechanisms of insecticide resistance. Enterococcus sp. enhanced resistance to the widely used insecticide, chlorpyrifos, in P. xylostella , while in contrast, Serratia sp. decreased resistance and Enterobacter sp. and all strains of heat-killed bacteria had no effect. Importantly, the direct degradation of chlorpyrifos in vitro was consistent among the three strains of bacteria. We found that Enterococcus sp., vitamin C, and acetylsalicylic acid enhanced insecticide resistance in P. xylostella and had similar effects on expression of P. xylostella antimicrobial peptides. Expression of cecropin was down-regulated by the two compounds, while gloverin was up-regulated. Bacteria that were not associated with insecticide resistance induced contrasting gene expression profiles to Enterococcus sp. and the compounds. Our studies confirmed that gut bacteria play an important role in P. xylostella insecticide resistance, but the main mechanism is not direct detoxification of insecticides by gut bacteria. We also suggest that the influence of gut bacteria on insecticide resistance may depend on effects on the immune system. Our work advances understanding of the evolution of insecticide resistance in this key pest and highlights directions for research into insecticide resistance in other insect pest species.

  16. Gut Microbiota Mediate Insecticide Resistance in the Diamondback Moth, Plutella xylostella (L.

    Directory of Open Access Journals (Sweden)

    Xiaofeng Xia

    2018-01-01

    Full Text Available The development of insecticide resistance in insect pests is a worldwide concern and elucidating the underlying mechanisms is critical for effective crop protection. Recent studies have indicated potential links between insect gut microbiota and insecticide resistance and these may apply to the diamondback moth, Plutella xylostella (L., a globally and economically important pest of cruciferous crops. We isolated Enterococcus sp. (Firmicutes, Enterobacter sp. (Proteobacteria, and Serratia sp. (Proteobacteria from the guts of P. xylostella and analyzed the effects on, and underlying mechanisms of insecticide resistance. Enterococcus sp. enhanced resistance to the widely used insecticide, chlorpyrifos, in P. xylostella, while in contrast, Serratia sp. decreased resistance and Enterobacter sp. and all strains of heat-killed bacteria had no effect. Importantly, the direct degradation of chlorpyrifos in vitro was consistent among the three strains of bacteria. We found that Enterococcus sp., vitamin C, and acetylsalicylic acid enhanced insecticide resistance in P. xylostella and had similar effects on expression of P. xylostella antimicrobial peptides. Expression of cecropin was down-regulated by the two compounds, while gloverin was up-regulated. Bacteria that were not associated with insecticide resistance induced contrasting gene expression profiles to Enterococcus sp. and the compounds. Our studies confirmed that gut bacteria play an important role in P. xylostella insecticide resistance, but the main mechanism is not direct detoxification of insecticides by gut bacteria. We also suggest that the influence of gut bacteria on insecticide resistance may depend on effects on the immune system. Our work advances understanding of the evolution of insecticide resistance in this key pest and highlights directions for research into insecticide resistance in other insect pest species.

  17. Impact of reduced-risk insecticides on soybean aphid and associated natural enemies.

    Science.gov (United States)

    Ohnesorg, Wayne J; Johnson, Kevin D; O'Neal, Matthew E

    2009-10-01

    Insect predators in North America suppress Aphis glycines Matsumura (Hemiptera: Aphididae) populations; however, insecticides are required when populations reach economically damaging levels. Currently, insecticides used to manage A. glycines are broad-spectrum (pyrethroids and organophosphates), and probably reduce beneficial insect abundance in soybean, Glycine max (L.) Merr. Our goal was to determine whether insecticides considered reduced-risk by the Environmental Protection Agency could protect soybean yield from A. glycines herbivory while having a limited impact on the aphid's natural enemies. We compared three insecticides (imidacloprid, thiamethoxam, and pymetrozine,) to a broad-spectrum insecticide (lamda-cyhalothrin) and an untreated control using two application methods. We applied neonicotinoid insecticides to seeds (imidacloprid and thiamethoxam) as well as foliage (imidacloprid); pymetrozine and lamda-cyhalothrin were applied only to foliage. Foliage-applied insecticides had lower A. glycines populations and higher yields than the seed-applied insecticides. Among foliage-applied insecticides, pymetrozine and imidacloprid had an intermediate level of A. glycines population and yield protection compared with lamda-cyhalothrin and the untreated control. We monitored natural enemies with yellow sticky cards, sweep-nets, and direct observation. Before foliar insecticides were applied (i.e., before aphid populations developed) seed treatments had no observable effect on the abundance of natural enemies. After foliar insecticides were applied, differences in natural enemy abundance were observed when sampled with sweep-nets and direct observation but not with yellow sticky cards. Based on the first two sampling methods, pymetrozine and the foliage-applied imidacloprid had intermediate abundances of natural enemies compared with the untreated control and lamda-cyhalothrin.

  18. Biochar in co-contaminated soil manipulates arsenic solubility and microbiological community structure, and promotes organochlorine degradation.

    Directory of Open Access Journals (Sweden)

    Samuel J Gregory

    Full Text Available We examined the effect of biochar on the water-soluble arsenic (As concentration and the extent of organochlorine degradation in a co-contaminated historic sheep-dip soil during a 180-d glasshouse incubation experiment. Soil microbial activity, bacterial community and structure diversity were also investigated. Biochar made from willow feedstock (Salix sp was pyrolysed at 350 or 550°C and added to soil at rates of 10 g kg-1 and 20 g kg-1 (representing 30 t ha-1 and 60 t ha-1. The isomers of hexachlorocyclohexane (HCH alpha-HCH and gamma-HCH (lindane, underwent 10-fold and 4-fold reductions in concentration as a function of biochar treatment. Biochar also resulted in a significant reduction in soil DDT levels (P < 0.01, and increased the DDE:DDT ratio. Soil microbial activity was significantly increased (P < 0.01 under all biochar treatments after 60 days of treatment compared to the control. 16S amplicon sequencing revealed that biochar-amended soil contained more members of the Chryseobacterium, Flavobacterium, Dyadobacter and Pseudomonadaceae which are known bioremediators of hydrocarbons. We hypothesise that a recorded short-term reduction in the soluble As concentration due to biochar amendment allowed native soil microbial communities to overcome As-related stress. We propose that increased microbiological activity (dehydrogenase activity due to biochar amendment was responsible for enhanced degradation of organochlorines in the soil. Biochar therefore partially overcame the co-contaminant effect of As, allowing for enhanced natural attenuation of organochlorines in soil.

  19. The sublethal effects of the organochlorines dieldrin and lindane on growth and reproduction of Eudrilus eugeniae and Eisenia fetida (Oligochaeta

    Directory of Open Access Journals (Sweden)

    Editorial Office

    1994-07-01

    Full Text Available Experimental exposure of the earthworm species Eudrilus eugeniae to organochlorines showed that dieldrin causes damage to sperm ultrastructure when viewed electronmicroscopically. Worms containing concentrations of 7,27 mg/kg dieldrin and higher showed more than 10% sperm damage. Exposure of Eisenia fetida to sublethal concentrations of lindane did not result in sperm damage but demonstrated an increase in growth and reproductive activity. It is argued that quantification of sperm damage and correlation with pesticide concentration could provide a useful tool for evaluating environmental quality. Furthermore, the effects of sublethal concentrations of pesticides that manifest themselves in increased growth and reproductive activity could affect ecological balances.

  20. Transcriptional networks associated with the immune system are disrupted by organochlorine pesticides in largemouth bass (Micropterus salmoides) ovary.

    Science.gov (United States)

    Martyniuk, Christopher J; Doperalski, Nicholas J; Feswick, April; Prucha, Melinda S; Kroll, Kevin J; Barber, David S; Denslow, Nancy D

    2016-08-01

    Largemouth bass (Micropterus salmoides) inhabiting Lake Apopka, Florida are exposed to high levels of persistent organochlorine pesticides (OCPs) and dietary uptake is a significant route of exposure for these apex predators. The objectives of this study were to determine the dietary effects of two organochlorine pesticides (p, p'-dichlorodiphenyldichloroethylene; p, p' DDE and methoxychlor; MXC) on the reproductive axis of largemouth bass. Reproductive bass (late vitellogenesis) were fed one of the following diets: control pellets, 125ppm p, p'-DDE, or 10ppm MXC (mg/kg) for 84days. Due to the fact that both p,p' DDE and MXC have anti-androgenic properties, the anti-androgenic pharmaceutical flutamide was fed to a fourth group of largemouth bass (750ppm). Following a 3 month exposure, fish incorporated p,p' DDE and MXC into both muscle and ovary tissue, with the ovary incorporating 3 times more organochlorine pesticides compared to muscle. Endpoints assessed were those related to reproduction due to previous studies demonstrating that these pesticides impact the reproductive axis and we hypothesized that a dietary exposure would result in impaired reproduction. However, oocyte distribution, gonadosomatic index, plasma vitellogenin, and plasma sex steroids (17β-estradiol, E2 and testosterone, T) were not different between control animals and contaminant-fed largemouth bass. Moreover, neither p, p' DDE nor MXC affected E2 or T production in ex vivo oocyte cultures from chemical-fed largemouth bass. However, both pesticides did interfere with the normal upregulation of androgen receptor that is observed in response to human chorionic gonadotropin in ex vivo cultures, an observation that may be related to their anti-androgenic properties. Transcriptomics profiling in the ovary revealed that gene networks related to cell processes such as leukocyte cell adhesion, ossification, platelet function and inhibition, xenobiotic metabolism, fibrinolysis, and thermoregulation