
Sample records for opossum monodelphis domestica

  1. Age-Dependent Changes in the Proteome Following Complete Spinal Cord Transection in a Postnatal South American Opossum (Monodelphis domestica)


    Noor, Natassya M.; Steer, David L.; Wheaton, Benjamin J.; C Joakim Ek; Truettner, Jessie S.; W Dalton Dietrich; Dziegielewska, Katarzyna M.; Richardson, Samantha J.; A Ian Smith; VandeBerg, John L; Saunders, Norman R.


    Recovery from severe spinal injury in adults is limited, compared to immature animals who demonstrate some capacity for repair. Using laboratory opossums (Monodelphis domestica), the aim was to compare proteomic responses to injury at two ages: one when there is axonal growth across the lesion and substantial behavioural recovery and one when no axonal growth occurs. Anaesthetized pups at postnatal day (P) 7 or P28 were subjected to complete transection of the spinal cord at thoracic level T1...

  2. Facial Mechanosensory Influence on Forelimb Movement in Newborn Opossums, Monodelphis domestica.

    Directory of Open Access Journals (Sweden)

    Marie-Josée Desmarais

    Full Text Available The opossum, Monodelphis domestica, is born very immature but crawls, unaided, with its forelimbs (FL from the mother's birth canal to a nipple where it attaches to pursue its development. What sensory cues guide the newborn to the nipple and trigger its attachment to it? Previous experiments showed that low intensity electrical stimulation of the trigeminal ganglion induces FL movement in in vitro preparations and that trigeminal innervation of the facial skin is well developed in the newborn. The skin does not contain Vater-Pacini or Meissner touch corpuscles at this age, but it contains cells which appear to be Merkel cells (MC. We sought to determine if touch perceived by MC could exert an influence on FL movements. Application of the fluorescent dye AM1-43, which labels sensory cells such as MC, revealed the presence of a large number of labeled cells in the facial epidermis, especially in the snout skin, in newborn opossums. Moreover, calibrated pressure applied to the snout induced bilateral and simultaneous electromyographic responses of the triceps muscle in in vitro preparations of the neuraxis and FL from newborn. These responses increase with stimulation intensity and tend to decrease over time. Removing the facial skin nearly abolished these responses. Metabotropic glutamate 1 receptors being involved in MC neurotransmission, an antagonist of these receptors was applied to the bath, which decreased the EMG responses in a reversible manner. Likewise, bath application of the purinergic type 2 receptors, used by AM1-43 to penetrate sensory cells, also decreased the triceps EMG responses. The combined results support a strong influence of facial mechanosensation on FL movement in newborn opossums, and suggest that this influence could be exerted via MC.

  3. Amelotin Gene Structure and Expression during Enamel Formation in the Opossum Monodelphis domestica.

    Directory of Open Access Journals (Sweden)

    Barbara Gasse

    Full Text Available Amelotin (AMTN is an ameloblast-secreted protein that belongs to the secretory calcium-binding phosphoprotein family, which also includes the enamel matrix proteins amelogenin, ameloblastin and enamelin. Although AMTN is supposed to play an important role in enamel formation, data were long limited to the rodents, in which it is expressed during the maturation stage. Recent comparative studies in sauropsids and amphibians revealed that (i AMTN was expressed earlier, i.e. as soon as ameloblasts are depositing the enamel matrix, and (ii AMTN structure was different, a change which mostly resulted from an intraexonic splicing in the large exon 8 of an ancestral mammal. The present study was performed to know whether the differences in AMTN structure and expression in rodents compared to non-mammalian tetrapods dated back to an early ancestral mammal or were acquired later in mammalian evolution. We sequenced, assembled and screened the jaw transcriptome of a neonate opossum Monodelphis domestica, a marsupial. We found two AMTN transcripts. Variant 1, representing 70.8% of AMTN transcripts, displayed the structure known in rodents, whereas variant 2 (29.2% exhibited the nonmammalian tetrapod structure. Then, we studied AMTN expression during amelogenesis in a neonate specimen. We obtained similar data as those reported in rodents. These findings indicate that more than 180 million years ago, before the divergence of marsupials and placentals, changes occurred in AMTN function and structure. The spatiotemporal expression was delayed to the maturation stage of amelogenesis and the intraexonic splicing gave rise to isoform 1, encoded by variant 1 and lacking the RGD motif. The ancestral isoform 2, housing the RGD, was initially conserved, as demonstrated here in a marsupial, then secondarily lost in the placental lineages. These findings bring new elements towards our understanding of the non-prismatic to prismatic enamel transition that occurred at

  4. The evolution of active vibrissal sensing in mammals: evidence from vibrissal musculature and function in the marsupial opossum Monodelphis domestica. (United States)

    Grant, Robyn A; Haidarliu, Sebastian; Kennerley, Natalie J; Prescott, Tony J


    Facial vibrissae, or whiskers, are found in nearly all extant mammal species and are likely to have been present in early mammalian ancestors. A sub-set of modern mammals, including many rodents, move their long mystacial whiskers back and forth at high speed whilst exploring in a behaviour known as 'whisking'. It is not known whether the vibrissae of early mammals moved in this way. The grey short-tailed opossum, Monodelphis domestica, is considered a useful species from the perspective of tracing the evolution of modern mammals. Interestingly, these marsupials engage in whisking bouts similar to those seen in rodents. To better assess the likelihood that active vibrissal sensing was present in ancestral mammals, we examined the vibrissal musculature of the opossum using digital miscroscopy to see whether this resembles that of rodents. Although opossums have fewer whiskers than rats, our investigation found that they have a similar vibrissal musculature. In particular, in both rats and opossums, the musculature includes both intrinsic and extrinsic muscles with the intrinsic muscles positioned as slings linking pairs of large vibrissae within rows. We identified some differences in the extrinsic musculature which, interestingly, matched with behavioural data obtained through high-speed video recording, and indicated additional degrees of freedom for positioning the vibrissae in rats. These data show that the whisker movements of opossum and rat exploit similar underlying mechanisms. Paired with earlier results suggesting similar patterns of vibrissal movement, this strongly implies that early therian (marsupial and placental) mammals were whisking animals that actively controlled their vibrissae.

  5. Weight-bearing locomotion in the developing opossum, Monodelphis domestica following spinal transection: remodeling of neuronal circuits caudal to lesion.

    Directory of Open Access Journals (Sweden)

    Benjamin J Wheaton

    Full Text Available Complete spinal transection in the mature nervous system is typically followed by minimal axonal repair, extensive motor paralysis and loss of sensory functions caudal to the injury. In contrast, the immature nervous system has greater capacity for repair, a phenomenon sometimes called the infant lesion effect. This study investigates spinal injuries early in development using the marsupial opossum Monodelphis domestica whose young are born very immature, allowing access to developmental stages only accessible in utero in eutherian mammals. Spinal cords of Monodelphis pups were completely transected in the lower thoracic region, T10, on postnatal-day (P7 or P28 and the animals grew to adulthood. In P7-injured animals regrown supraspinal and propriospinal axons through the injury site were demonstrated using retrograde axonal labelling. These animals recovered near-normal coordinated overground locomotion, but with altered gait characteristics including foot placement phase lags. In P28-injured animals no axonal regrowth through the injury site could be demonstrated yet they were able to perform weight-supporting hindlimb stepping overground and on the treadmill. When placed in an environment of reduced sensory feedback (swimming P7-injured animals swam using their hindlimbs, suggesting that the axons that grew across the lesion made functional connections; P28-injured animals swam using their forelimbs only, suggesting that their overground hindlimb movements were reflex-dependent and thus likely to be generated locally in the lumbar spinal cord. Modifications to propriospinal circuitry in P7- and P28-injured opossums were demonstrated by changes in the number of fluorescently labelled neurons detected in the lumbar cord following tracer studies and changes in the balance of excitatory, inhibitory and neuromodulatory neurotransmitter receptors' gene expression shown by qRT-PCR. These results are discussed in the context of studies indicating

  6. Spontaneous development of full weight-supported stepping after complete spinal cord transection in the neonatal opossum, Monodelphis domestica.

    Directory of Open Access Journals (Sweden)

    Benjamin J Wheaton

    Full Text Available Spinal cord trauma in the adult nervous system usually results in permanent loss of function below the injury level. The immature spinal cord has greater capacity for repair and can develop considerable functionality by adulthood. This study used the marsupial laboratory opossum Monodelphis domestica, which is born at a very early stage of neural development. Complete spinal cord transection was made in the lower-thoracic region of pups at postnatal-day 7 (P7 or P28, and the animals grew to adulthood. Injury at P7 resulted in a dense neuronal tissue bridge that connected the two ends of the cord; retrograde neuronal labelling indicated that supraspinal and propriospinal innervation spanned the injury site. This repair was associated with pronounced behavioural recovery, coordinated gait and an ability to use hindlimbs when swimming. Injury at P28 resulted in a cyst-like cavity encased in scar tissue forming at the injury site. Using retrograde labelling, no labelled brainstem or propriospinal neurons were found above the lesion, indicating that detectable neuronal connectivity had not spanned the injury site. However, these animals could use their hindlimbs to take weight-supporting steps but could not use their hindlimbs when swimming. White matter, demonstrated by Luxol Fast Blue staining, was present in the injury site of P7- but not P28-injured animals. Overall, these studies demonstrated that provided spinal injury occurs early in development, regrowth of supraspinal innervation is possible. This repair appears to lead to improved functional outcomes. At older ages, even without detectable axonal growth spanning the injury site, substantial development of locomotion was still possible. This outcome is discussed in conjunction with preliminary findings of differences in the local propriospinal circuits following spinal cord injury (demonstrated with fluororuby labelling, which may underlie the weight bearing locomotion observed in the

  7. Microscopic anatomy of the lower respiratory tract of the grey short-tailed opossum (Monodelphis domestica). (United States)

    Cope, L A; Henry, R W; Reed, R B


    The respiratory tracts of seven grey short-tailed opossums were histologically examined. Six opossums were prepared by perfusion with buffered formalin. Opossum seven was perfused with gluteraldehyde. Samples taken from the respiratory passages and lungs of specimens 1-6 were stained with haematoxylin and eosin. A mixture of methylene and azure blue was used for specimen 7. The trachea and right and left principal bronchi are lined with a pseudostratified ciliated columnar epithelium with occasional goblet cells. The secondary and tertiary bronchi and the primary and secondary bronchioles are lined by a simple ciliated columnar epithelium. The terminal bronchioles and a portion of the respiratory bronchioles are lined by a simple ciliated cuboidal epithelium. The terminal portion of the respiratory bronchioles and the alveolar ducts are lined with simple squamous epithelium. Alveoli are lined by type I and II pneumocytes. Tracheal glands are present in the tela submucosa. The fibromusculocartilaginous tunic of the trachea consists of c-shaped cartilage rings and the trachealis muscle. A lamina muscularis mucosa begins in the intrapulmonary portion of the principal bronchus and continues into the respiratory bronchioles. Bronchial glands are present in the propria submucosa and tela submucosa of the principal bronchi. The musculocartilaginous tunic is localized to the extrapulmonary portion of the principal bronchus. The bronchial cartilages are irregular shaped plates and limited to the extrapulmonary portion of the principal bronchus. The visceral pleura is a simple squamous mesothelium covering the outer surface of the lung.

  8. Age-dependent changes in the proteome following complete spinal cord transection in a postnatal South American opossum (Monodelphis domestica.

    Directory of Open Access Journals (Sweden)

    Natassya M Noor

    Full Text Available Recovery from severe spinal injury in adults is limited, compared to immature animals who demonstrate some capacity for repair. Using laboratory opossums (Monodelphis domestica, the aim was to compare proteomic responses to injury at two ages: one when there is axonal growth across the lesion and substantial behavioural recovery and one when no axonal growth occurs. Anaesthetized pups at postnatal day (P 7 or P28 were subjected to complete transection of the spinal cord at thoracic level T10. Cords were collected 1 or 7 days after injury and from age-matched controls. Proteins were separated based on isoelectric point and subunit molecular weight; those whose expression levels changed following injury were identified by densitometry and analysed by mass spectrometry. Fifty-six unique proteins were identified as differentially regulated in response to spinal transection at both ages combined. More than 50% were cytoplasmic and 70% belonged to families of proteins with characteristic binding properties. Proteins were assigned to groups by biological function including regulation (40%, metabolism (26%, inflammation (19% and structure (15%. More changes were detected at one than seven days after injury at both ages. Seven identified proteins: 14-3-3 epsilon, 14-3-3 gamma, cofilin, alpha enolase, heart fatty acid binding protein (FABP3, brain fatty acid binding protein (FABP7 and ubiquitin demonstrated age-related differential expression and were analysed by qRT-PCR. Changes in mRNA levels for FABP3 at P7+1day and ubiquitin at P28+1day were statistically significant. Immunocytochemical staining showed differences in ubiquitin localization in younger compared to older cords and an increase in oligodendrocyte and neuroglia immunostaining following injury at P28. Western blot analysis supported proteomic results for ubiquitin and 14-3-3 proteins. Data obtained at the two ages demonstrated changes in response to injury, compared to controls, that were

  9. Cortico-cerebral histogenesis in the opossum Monodelphis domestica: generation of a hexalaminar neocortex in the absence of a basal proliferative compartment

    Directory of Open Access Journals (Sweden)

    Mallamaci Antonello


    Full Text Available Abstract Background The metatherian Monodelphis domestica, commonly known as the South-American short-tailed opossum, is an appealing animal model for developmental studies on cortico-cerebral development. Given its phylogenetic position, it can help in tracing evolutionary origins of key traits peculiar to the eutherian central nervous system. The capability of its pup to regenerate damaged cortico-spinal connections makes it an ideal substrate for regenerative studies. Recent sequencing of its genome and the ex utero accessibility of its developing cerebral cortex further enhance its experimental interest. However, at the moment, a comprehensive cellular and molecular characterization of its cortical development is missing. Results A systematic analysis of opossum cortico-cerebral development was performed, including: origin of cortical neurons; migration of these neurons from their birthplaces to their final layer destinations; and molecular differentiation of distinct neocortical laminae. We observed that opossum projection neurons and interneurons are generated by pallial and subpallial precursors, respectively, similar to rodents. A six-layered cortex with a eutherian-like molecular profile is laid down, according to the inside-out rule. However, neocortical projection neurons are generated by apical neural precursors and almost no basal progenitors may be found in the neuronogenic neopallial primordium. In the opossum neocortex, Tbr2, the hallmark of eutherian basal progenitors, is transiently expressed by postmitotic progenies of apical precursors prior to the activation of more mature neuronal markers. Conclusions The neocortical developmental program predates Eutheria-Methatheria branching. However, in metatherians, unlike eutherians, a basal proliferative compartment is not needed for the formation of a six-layered neuronal blueprint.

  10. ¬Immunolocalization of cation-chloride cotransporters in the developing and mature spinal cord of opossums, Monodelphis domestica

    Directory of Open Access Journals (Sweden)

    Ha-Loan ePhan


    Full Text Available Spinal inhibition is required to generate coordinated outputs between antagonistic muscles during locomotion. It relies on low neuronal chloride concentration set by two cation-chloride cotransporters, NKCC1 and KCC2 which, respectively, pumps Cl- in or out of neurons. It is generally accepted that NKCC1 is gradually inactivated during development, while KCC2 is upregulated and activated, resulting in low intracellular [Cl-]. Newborn opossums are very immature but perform rhythmic and alternate movements of the forelimbs to crawl on the mother’s belly and attach to a teat. Their hindlimbs are immobile. The alternation of the forelimbs suggests that mechanisms allowing spinal inhibition are present at birth. We studied the anatomical basis of inhibition in the spinal enlargements of postnatal opossums by immunolocalizing NKCC1 and KCC2. In some specimens, motoneurons and sensory afferents were labeled with TRDA prior to immunolabeling. At birth, both NKCC1 and KCC2 are detected in the presumptive grey and white matter of the ventral and the intermediolateral cord of both enlargements, but are sparse in the dorsal horn, where KCC2 is mostly seen on a small bundle of dendrites along primary afferents. KCC2 labeling is bright and has a mesh-like appearance in the grey matter and a radial appearance in the white matter, whereas NKCC1 is pale and diffuse. The subsequent expression of the cotransporters follows general ventrodorsal and mediolateral gradients, with the lumbar segments slightly lagging the cervical segments, until the mature pattern is observed around the 5th week. At all ages studied, KCC2 labeling is strong in the periphery of neurons. NKCC1 labeling decreases and becomes more uniformly distributed in the cells with age. Despite the significant anatomical and motor differences between the forelimbs and the hindlimbs of neonatal opossums, the maturation of KCC2 and NKCC1 is quite similar in both enlargements.

  11. Taxonomy Icon Data: gray short-tailed opossum [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available gray short-tailed opossum Monodelphis domestica Chordata/Vertebrata/Mammalia/Theria.../Metatheria Monodelphis_domestica_L.png Monodelphis_domestica_NL.png Monodelphis_domestica_S.png Monodelphis_domestic...a_NS.png ...

  12. Ultrastructural changes in the uterine luminal and glandular epithelium during the oestrous cycle of the marsupial Monodelphis domestica (grey short-tailed opossum). (United States)

    Wick, Regula; Kress, Annetrudi


    Ultrastructural changes in the endometrium associated with the oestrous cycle were studied in the South American marsupial Monodelphis domestica. The most conspicuous changes include the height and the differentiation of the uterine luminal and glandular epithelium, which consists of ciliated and non-ciliated cells. The glandular epithelium attains its maximum development during oestrus, the luminal epithelium at postoestrus. A distinct increase in the number of ciliated cells can be observed during pro-oestrus, reaching a maximum number at oestrus; this is followed by a process of deciliation. The presence of solitary cilia on the apices of non-ciliated cells is very conspicuous during all oestrous stages and can best be seen on the luminal epithelium. These findings differ from the observations in eutherian mammals, where solitary cilia are only found in the immature uterus or after ovariectomy. The secretory activity of non-ciliated cells of the luminal epithelium is hardly noticeable along the apical membrane and stains only very faintly with Alcian blue. The glandular epithelium cells are filled apically with exocytotic vesicles at oestrus and early postoestrus. However, in contrast to the cervical gland cells, they hardly stain with Alcian blue, indicating that mucins of a different type must be present. Mechanisms for the remodelling of the luminal and glandular epithelium are especially conspicuous at metoestrus and early pro-oestrus and include the presence of autolysosomes, residual bodies and apoptotic bodies. In the endometrial stroma, around the uterine glands, macrophages accumulate and attain a typical oestrous stage-dependent appearance during their phagocytotic activities.

  13. Cellular and molecular drivers of differential organ growth: insights from the limbs of Monodelphis domestica. (United States)

    Dowling, Anna; Doroba, Carolyn; Maier, Jennifer A; Cohen, Lorna; VandeBerg, John; Sears, Karen E


    A fundamental question in biology is "how is growth differentially regulated during development to produce organs of particular sizes?" We used a new model system for the study of differential organ growth, the limbs of the opossum (Monodelphis domestica), to investigate the cellular and molecular basis of differential organ growth in mammals. Opossum forelimbs grow much faster than hindlimbs, making opossum limbs an exceptional system with which to study differential growth. We first used the great differences in opossum forelimb and hindlimb growth to identify cellular processes and molecular signals that underlie differential limb growth. We then used organ culture and pharmacological addition of FGF ligands and inhibitors to test the role of the Fgf/Mitogen-activated protein kinases (MAPK) signaling pathway in driving these cellular processes. We found that molecular signals from within the limb drive differences in cell proliferation that contribute to the differential growth of the forelimb and hindlimbs of opossums. We also found that alterations in the Fgf/MAPK pathway can generate differences in cell proliferation that mirror those observed between wild-type forelimb and hindlimbs of opossums and that manipulation of Fgf/MAPK signaling affects downstream focal adhesion-extracellular matrix (FA-ECM) and Wnt signaling in opossum limbs. Taken together, these findings suggest that evolutionary changes in the Fgf/MAPK pathway could help drive the observed differences in cell behaviors and growth in opossum forelimb and hindlimbs.

  14. Convergent and divergent evolution of genomic imprinting in the marsupial Monodelphis domestica

    Directory of Open Access Journals (Sweden)

    Das Radhika


    Full Text Available Abstract Background Genomic imprinting is an epigenetic phenomenon resulting in parent-of-origin specific monoallelic gene expression. It is postulated to have evolved in placental mammals to modulate intrauterine resource allocation to the offspring. In this study, we determined the imprint status of metatherian orthologues of eutherian imprinted genes. Results L3MBTL and HTR2A were shown to be imprinted in Monodelphis domestica (the gray short-tailed opossum. MEST expressed a monoallelic and a biallelic transcript, as in eutherians. In contrast, IMPACT, COPG2, and PLAGL1 were not imprinted in the opossum. Differentially methylated regions (DMRs involved in regulating imprinting in eutherians were not found at any of the new imprinted loci in the opossum. Interestingly, a novel DMR was identified in intron 11 of the imprinted IGF2R gene, but this was not conserved in eutherians. The promoter regions of the imprinted genes in the opossum were enriched for the activating histone modification H3 Lysine 4 dimethylation. Conclusions The phenomenon of genomic imprinting is conserved in Therians, but the marked difference in the number and location of imprinted genes and DMRs between metatherians and eutherians indicates that imprinting is not fully conserved between the two Therian infra-classes. The identification of a novel DMR at a non-conserved location as well as the first demonstration of histone modifications at imprinted loci in the opossum suggest that genomic imprinting may have evolved in a common ancestor of these two Therian infra-classes with subsequent divergence of regulatory mechanisms in the two lineages.

  15. Carpal ontogeny in Monodelphis domestica and Caluromys philander (Marsupialia). (United States)

    Prochel, J A N; Sánchez-Villagra, Marcelo R


    Carpal bones have experienced numerous changes during marsupial evolution, even though their diversity and development remain poorly studied. The aim of this work was to document adult form and the pattern of mesenchymal tissue condensation and formation of chondrification and ossification centers in the hand of two marsupials. Two fundamental questions were asked: whether the loss of embryonic precursors was associated with the loss of adult elements, or whether there were developmental signs of ancestral mammalian elements that have been fused or lost in marsupial taxa. We were also interested to find out whether there is sexual dimorphismus in the carpals, as has been reported for some didelphids. Histological sections, cleared and stained specimens and macerated skeletons representing an ontogenetic series of Monodelphis domestica were used to document carpal development. Comparisons were made with perinatal stages of Caluromys philander and with adult specimens of other marsupials. A prenatal M. domestica in the 13th day after conception has a cell condensation that because of its position is homologized with a centrale, which is at birth already lost or fused. Neonatal M. domestica and C. philander have the number and arrangement of their adult carpal anatomy. Trapezium and trapezoid start ossification later than most other carpals, while pisiform and prepollex are the last to do so. Adult males of M. domestica have relatively larger and more robust pisiforms, compared to other carpals, than females. This sexual dimorphism develops relatively late as it was not recorded in male specimens around 160 days old. An extra sesamoid bone located just distal to the radius and proximo-palmar to the scaphoid was recorded in specimens of C. philander, C. derbianus and Didelphis virginiana.

  16. Evolution of mammalian sensorimotor cortex: Thalamic projections to parietal cortical areas in Monodelphis domestica

    Directory of Open Access Journals (Sweden)

    James Clinton Dooley


    Full Text Available The current experiments build upon previous studies designed to reveal the network of parietal cortical areas present in the common mammalian ancestor. Understanding this ancestral network is essential for highlighting the basic somatosensory circuitry present in all mammals, and how this basic plan was modified to generate species specific behaviors. Our animal model, the short-tailed opossum (Monodelphis domestica, is a South American marsupial that has been proposed to have a similar ecological niche and morphology to the earliest common mammalian ancestor. In this investigation, we injected retrograde neuroanatomical tracers into the face and body representations of primary somatosensory cortex (S1, the rostral and caudal somatosensory fields (SR and SC, as well as a multimodal region (MM. Projections from different architectonically defined thalamic nuclei were then quantified. Our results provide further evidence to support the hypothesized basic mammalian plan of thalamic projections to S1, with the lateral and medial ventral posterior thalamic nuclei (VPl and VPm projecting to S1 body and S1 face, respectively. Additional strong projections are from the medial division of posterior nucleus (Pom. SR receives projections from several midline nuclei, including the medial dorsal, ventral medial nucleus, and Pom. SC and MM show similar patterns of connectivity, with projections from the ventral anterior and ventral lateral nuclei, VPm and VPl, and the entire posterior nucleus (medial and lateral. Notably, MM is distinguished from SC by relatively dense projections from the dorsal division of the lateral geniculate nucleus and pulvinar. We discuss the finding that S1 of the short-tailed opossum has a similar pattern of projections as other marsupials and mammals, but also some distinct projections not present in other mammals. Further we provide additional support for a primitive posterior parietal cortex which receives input from multiple

  17. The development of enamel tubules during the formation of enamel in the marsupial Monodelphis domestica.


    Sasagawa, I; Ferguson, M W


    In Monodelphis domestica, although both processes from odontoblasts and projections from ameloblasts were found in developing enamel, the majority of the contents of enamel tubules were probably processes that originated from odontoblasts. Processes from odontoblasts penetrating into enamel touched part of the ameloblasts in the stage of enamel formation. No specialised cell junctions were seen at the adherence between the two. There were no enamel tubules in the aprismatic and pseudoprismati...

  18. Histone H3 trimethylation at lysine 9 marks the inactive metaphase X chromosome in the marsupial Monodelphis domestica. (United States)

    Zakharova, Irina S; Shevchenko, Alexander I; Shilov, Alexander G; Nesterova, Tatyana B; Vandeberg, John L; Zakian, Suren M


    In somatic cells of female marsupial and eutherian mammals, X chromosome inactivation (XCI) occurs. XCI results in the transcriptional silencing of one of the two X chromosomes and is accompanied by specific covalent histone modifications attributable to the inactive chromatin state. Because data about repressed chromatin of the inactive X chromosome (Xi) in marsupials are sparse, we examined in more detail the distribution of active and inactive chromatin markers on metaphase X chromosomes of an American marsupial, Monodelphis domestica. Consistent with data reported previously both for eutherian and marsupial mammals, we found that the Xi of M. domestica lacks active histone markers-H3K4 dimethylation and H3K9 acetylation. We did not observe on metaphase spreads enrichment of the Xi with H3K27 trimethylation which is involved in XCI in eutherians and was detected on the Xi in the interphase nuclei of mature female M. domestica in an earlier study. Moreover, we found that the Xi of M. domestica was specifically marked with H3K9 trimethylation, which is known to be a component of the Xi chromatin in eutherians and is involved in both marsupials and eutherians in meiotic sex chromosome inactivation which has been proposed as an ancestral mechanism of XCI.

  19. Development of the lateral ventricular choroid plexus in a marsupial, Monodelphis domestica

    Directory of Open Access Journals (Sweden)

    VandeBerg John L


    Full Text Available Abstract Background Choroid plexus epithelial cells are the site of blood/cerebrospinal fluid (CSF barrier and regulate molecular transfer between the two compartments. Their mitotic activity in the adult is low. During development, the pattern of growth and timing of acquisition of functional properties of plexus epithelium are not known. Methods Numbers and size of choroid plexus epithelial cells and their nuclei were counted and measured in the lateral ventricular plexus from the first day of its appearance until adulthood. Newborn Monodelphis pups were injected with 5-bromo-2-deoxyuridine (BrdU at postnatal day 3 (P3, P4 and P5. Additional animals were injected at P63, P64 and P65. BrdU-immunopositive nuclei were counted and their position mapped in the plexus structure at different ages after injections. Double-labelling immunocytochemistry with antibodies to plasma protein identified post-mitotic cells involved in protein transfer. Results Numbers of choroid plexus epithelial cells increased 10-fold between the time of birth and adulthood. In newborn pups each consecutive injection of BrdU labelled 20-40 of epithelial cells counted. After 3 injections, numbers of BrdU positive cells remained constant for at least 2 months. BrdU injections at an older age (P63, P64, P65 resulted in a smaller number of labelled plexus cells. Numbers of plexus cells immunopositive for both BrdU and plasma protein increased with age indicating that protein transferring properties are acquired post mitotically. Labelled nuclei were only detected on the dorsal arm of the plexus as it grows from the neuroependyma, moving along the structure in a 'conveyor belt' like fashion. Conclusions The present study established that lateral ventricular choroid plexus epithelial cells are born on the dorsal side of the structure only. Cells born in the first few days after choroid plexus differentiation from the neuroependyma remain present even two months later. Protein

  20. Changes in the epithelium of the vaginal complex during the estrous cycle of the marsupial Monodelphis domestica. 1. Transmission electron microscopy study. (United States)

    Regli, Christian; Kress, Annetrudi


    The vaginal complex of marsupials differs from that of eutherians. Cervices open separately in a sinus vaginalis or cul-de-sac. Two lateral vaginae adjoin the sinus vaginalis and fuse at the level of the urethra opening and form the sinus urogenitalis. During the estrous cycle the vaginal epithelium undergoes a number of specified morphological changes. This paper is the first to describe these changes on an ultrastructural level in a marsupial. Investigations in Monodelphis vagina reveal that a cyclic switch exists between a keratinized and a stratified nonkeratinized epithelium. Keratinization starts during proestrus and reaches its maximum during estrus. In the postestrus, desquamation of the stratum corneum takes place, mostly in two steps. In metestrus one to two additional layers of the now nonkeratinized surface cells are shed into the vaginal lumen. Typical cell structures, such as keratin filaments, keratohyalin and membrane-coating granules, are involved in the keratinization process. Keratohyalin is found in the cytoplasm as well as in the nucleus of stratum granulosum cells, a phenomenon which is known from other parakeratinized epithelia of rapid turnover. Membrane-coating granules, responsible for the permeability barrier between the epithelial cells, are of the nonlamellated type in the nonkeratinized epithelium and produce an amorphous material in the intercellular spaces after extrusion. At periods, however, when the epithelium is keratinized, membrane-coating granules are of the lamellated type and form a lamellated barrier structure after extrusion in the intercellular space. The loss of the protective keratinized layers asks for an additional defense mechanism for the epithelium. The migration of leukocytes through the epithelium predominantly during post- and metestrus and their presence in the vaginal lumen may play a protective role together with the bacterial content.

  1. Myosin isoform expression in the prehensile tails of didelphid marsupials: functional differences between arboreal and terrestrial opossums. (United States)

    Rupert, J E; Schmidt, E Cordero; Moreira-Soto, A; Herrera, B Rodríguez; Vandeberg, J L; Butcher, M T


    Prehensile tails are defined as having the ability to grasp objects and are commonly used as a fifth appendage during arboreal locomotion. Despite the independent evolution of tail prehensility in numerous mammalian genera, data relating muscle structure, physiology, and function of prehensile tails are largely incomplete. Didelphid marsupials make an excellent model to relate myosin heavy chain (MHC) isoform fiber type with structure/function of caudal muscles, as all opossums have a prehensile tail and tail use varies between arboreal and terrestrial forms. Expanding on our previous work in the Virginia opossum, this study tests the hypothesis that arboreal and terrestrial opossums differentially express faster versus slower MHC isoforms, respectively. MHC isoform expression and percent fiber type distribution were determined in the flexor caudae longus (FCL) muscle of Caluromys derbianus (arboreal) and Monodelphis domestica (terrestrial), using a combination of gel electrophoresis and immunohistochemistry analyses. C. derbianus expresses three MHC isoforms (1, 2A, 2X) that are distributed (mean percentage) as 8.2% MHC-1, 2.6% 1/2A, and 89.2% 2A/X hybrid fibers. M. domestica also expresses MHC-1, 2A, and 2X, in addition to the 2B isoform, distributed as 17.0% MHC-1, 1.3% 1/2A, 9.0% 2A, 75.2% 2A/X, and 0.3% 2X/B hybrid fibers. The distribution of similar isoform fiber types differed significantly between species (P derbianus was observed to have larger cross-sectional area (CSA) for each corresponding fiber type along with a greater amount of extra-cellular matrix. An overall faster fiber type composition (and larger fibers) in the tail of an arboreal specialist supports our hypothesis, and correlates with higher muscle force required for tail hanging and arboreal maneuvering on terminal substrates. Conversely, a broader distribution of highly oxidative fibers in the caudal musculature is well suited for tail nest building/remodeling behaviors of terrestrial

  2. Asp-ase Activity of the Opossum Granzyme B Supports the Role of Granzyme B as Part of Anti-Viral Immunity Already during Early Mammalian Evolution.

    Directory of Open Access Journals (Sweden)

    Zhirong Fu

    Full Text Available Granzyme B is one of the key effector molecules in our defense against viruses and intracellular bacteria. This serine protease together with the pore forming protein perforin, induces caspase or Bid-dependent apoptosis in target cells. Here we present the first characterization of a granzyme B homolog, the grathepsodenase, in a non-placental mammal, the American opossum (Monodelphis domestica. The recombinant enzyme was produced in a human cell line and used to study its primary and extended cleavage specificity using a panel of chromogenic substrates and recombinant protein substrates. The opossum granzyme B was found to have a specificity similar to human granzyme B, although slightly less restrictive in its extended specificity. The identification of a granzyme B homolog with asp-ase (cleaving after aspartic acid specificity in a non-placental mammal provides strong indications that caspase or Bid-dependent apoptosis by a serine protease with a conserved primary specificity has been part of anti-viral immunity since early mammalian evolution. This finding also indicates that an asp-ase together with a chymase were the first two serine protease genes to appear in the mammalian chymase locus.

  3. Meiotic sex chromosome inactivation in the marsupial Monodelphis domestica. (United States)

    Hornecker, Jacey L; Samollow, Paul B; Robinson, Edward S; Vandeberg, John L; McCarrey, John R


    In eutherian mammals, the X and Y chromosomes undergo meiotic sex chromosome inactivation (MSCI) during spermatogenesis in males. However, following fertilization, both the paternally (Xp) and maternally (Xm) inherited X chromosomes are active in the inner cell mass of the female blastocyst, and then random inactivation of one X chromosome occurs in each cell, leading to a mosaic pattern of X-chromosome activity in adult female tissues. In contrast, marsupial females show a nonrandom pattern of X chromosome activity, with repression of the Xp in all somatic tissues. Here, we show that MSCI also occurs during spermatogenesis in marsupials in a manner similar to, but more stable than that in eutherians. These findings support the suggestion that MSCI may have provided the basis for an early dosage compensation mechanism in mammals based solely on gametogenic events, and that random X-chromosome inactivation during embryogenesis may have evolved subsequently in eutherian mammals.

  4. Image collection: 142 [Togo Picture Gallery[Archive

    Lifescience Database Archive (English)

    Full Text Available 142 Monodelphis_domestica_NL.png ハイイロジネズミオポッサム Gray shrew opossum Monodelphis domestica 13616 生物アイコン,脊索動物門,脊椎動物亜門,哺乳綱,獣亜綱,後獣下綱,

  5. Effect of light-dark changes on the locomotor activity in open field in adult rats and opossums. (United States)

    Klejbor, I; Ludkiewicz, B; Turlejski, K


    There have been no reports on how the light-dark changes determine the locomotor activity of animals in the group of high reactivity (HR) and low reactivity (LR). In the present study we have compared selected parameters of the locomotor activity of the HR and the LR groups of the laboratory opossums and Wistar rats during consecutive, light and dark phases in the open field test. Sixty male Wistar adult rats, at an average weight of 350 g each, and 24 adult Monodelphis opossums of both sexes at an average weight of 120 g each were used. The animals' activity for 2 h daily between the hours of 17:30 and 19:30, in line with the natural light-dark cycle were recorded and then analysed using VideoTrack ver.2.0 (Vievpoint France). According to our results, we noted that a change of the experimental conditions from light to dark involves an increase in the locomotor activity in rats and opossums of the HR group, while there is no effect on the activity of the rats and opossums in the LR group. Locomotor activity in the HR rats, both in the light and dark conditions is characterised by a consistent pattern of change - higher activity in the first stage of the recording and a slowdown (habituation) in the second phase of the observation. The locomotor activity of the opossum, during both light and dark conditions, was observed to be at a consistently high level compared to the rats.

  6. Mammalian genome projects reveal new growth hormone (GH) sequences. Characterization of the GH-encoding genes of armadillo (Dasypus novemcinctus), hedgehog (Erinaceus europaeus), bat (Myotis lucifugus), hyrax (Procavia capensis), shrew (Sorex araneus), ground squirrel (Spermophilus tridecemlineatus), elephant (Loxodonta africana), cat (Felis catus) and opossum (Monodelphis domestica). (United States)

    Wallis, Michael


    Mammalian growth hormone (GH) sequences have been shown previously to display episodic evolution: the sequence is generally strongly conserved but on at least two occasions during mammalian evolution (on lineages leading to higher primates and ruminants) bursts of rapid evolution occurred. However, the number of mammalian orders studied previously has been relatively limited, and the availability of sequence data via mammalian genome projects provides the potential for extending the range of GH gene sequences examined. Complete or nearly complete GH gene sequences for six mammalian species for which no data were previously available have been extracted from the genome databases-Dasypus novemcinctus (nine-banded armadillo), Erinaceus europaeus (western European hedgehog), Myotis lucifugus (little brown bat), Procavia capensis (cape rock hyrax), Sorex araneus (European shrew), Spermophilus tridecemlineatus (13-lined ground squirrel). In addition incomplete data for several other species have been extended. Examination of the data in detail and comparison with previously available sequences has allowed assessment of the reliability of deduced sequences. Several of the new sequences differ substantially from the consensus sequence previously determined for eutherian GHs, indicating greater variability than previously recognised, and confirming the episodic pattern of evolution. The episodic pattern is not seen for signal sequences, 5' upstream sequence or synonymous substitutions-it is specific to the mature protein sequence, suggesting that it relates to the hormonal function. The substitutions accumulated during the course of GH evolution have occurred mainly on the side of the hormone facing away from the receptor, in a non-random fashion, and it is suggested that this may reflect interaction of the receptor-bound hormone with other proteins or small ligands.

  7. Radiation lethality in the opossum

    Energy Technology Data Exchange (ETDEWEB)

    Prasad, N.; Bushong, S.C.; North, L.B.; Thornby, J.


    Groups of male opossum (Didelphis virginiana) at 6 months of age were exposed to 350, 500, 550, 600, 650, 700, and 750 rad of whole-body /sup 60/Co radiation at a midline dose rate of 125 rad/min. The 30-day LD/sub 50/ was 511 rad with 95% confidence limits of 454 to 576 rad. The overall mean survival time was 17.9 days and the highest incidence of death occurred on the 16th day.

  8. SINEs, evolution and genome structure in the opossum. (United States)

    Gu, Wanjun; Ray, David A; Walker, Jerilyn A; Barnes, Erin W; Gentles, Andrew J; Samollow, Paul B; Jurka, Jerzy; Batzer, Mark A; Pollock, David D


    Short INterspersed Elements (SINEs) are non-autonomous retrotransposons, usually between 100 and 500 base pairs (bp) in length, which are ubiquitous components of eukaryotic genomes. Their activity, distribution, and evolution can be highly informative on genomic structure and evolutionary processes. To determine recent activity, we amplified more than one hundred SINE1 loci in a panel of 43 M. domestica individuals derived from five diverse geographic locations. The SINE1 family has expanded recently enough that many loci were polymorphic, and the SINE1 insertion-based genetic distances among populations reflected geographic distance. Genome-wide comparisons of SINE1 densities and GC content revealed that high SINE1 density is associated with high GC content in a few long and many short spans. Young SINE1s, whether fixed or polymorphic, showed an unbiased GC content preference for insertion, indicating that the GC preference accumulates over long time periods, possibly in periodic bursts. SINE1 evolution is thus broadly similar to human Alu evolution, although it has an independent origin. High GC content adjacent to SINE1s is strongly correlated with bias towards higher AT to GC substitutions and lower GC to AT substitutions. This is consistent with biased gene conversion, and also indicates that like chickens, but unlike eutherian mammals, GC content heterogeneity (isochore structure) is reinforced by substitution processes in the M. domestica genome. Nevertheless, both high and low GC content regions are apparently headed towards lower GC content equilibria, possibly due to a relative shift to lower recombination rates in the recent Monodelphis ancestral lineage. Like eutherians, metatherian (marsupial) mammals have evolved high CpG substitution rates, but this is apparently a convergence in process rather than a shared ancestral state.

  9. Oggetti e memoria domestica

    Directory of Open Access Journals (Sweden)

    Marina Brancato


    Full Text Available Questo contributo è un ideale viaggio nella memoria attraverso le stanze che compongono le nostre case. Un itinerario fra gli oggetti che fanno da sfondo quotidiano alla nostra scenografia domestica. Nello specifico indagheremo album fotografici, souvenir, ninnoli (mnemoteche domestiche. Sin dall’inizio abbiamo considerato gli ambienti domestici veri e propri serbatoi di memorie individuali e collettive. In tali serbatoi i soggetti depositano tracce delle proprie biografie, esprimendo e confermando progetti identitari.

  10. Expression and cellular distribution of ubiquitin in response to injury in the developing spinal cord of Monodelphis domestica

    DEFF Research Database (Denmark)

    Noor, Natassya M; Møllgård, Kjeld; Wheaton, Benjamin J;


    Ubiquitin, an 8.5 kDa protein associated with the proteasome degradation pathway has been recently identified as differentially expressed in segment of cord caudal to site of injury in developing spinal cord. Here we describe ubiquitin expression and cellular distribution in spinal cord up to pos...... changes in ubiquitin expression and cellular distribution in development and response to spinal injury suggest an intricate regulatory system that modulates these responses which, when better understood, may lead to potential therapeutic targets....

  11. Behavior and maintenance of the woolly opossum (Caluromys) in captivity. (United States)

    Bucher, J E; Fritz, H I


    Circadian activity, general behavior, dietary requirements, and reproductive activity were recorded in a small laboratory colony (four females, six males) of two species of the woolly opossum (Caluromys lanatus and C derbianus) over a period of 3 years. The two species were indiscernable in all aspects of their behavior. Both were completely nocturnal and rarely active during daylight hours. General behavior was apparently related to many variables, particularly individual temperament and cage size. Even docile individuals were more excitable when housed in small cages. Although the woolly opossum is reported to prefer a meat diet, the opossums in this study remained healthy on a meat-egg-fruit diet, and showed a special liking for fruit, especially bananas. Vaginal smears indicated that females of the colony were cyclic, but all attempts to breed them were unsuccessful. Sexual behavior included pre-mount, pelvic-thrust displays on the part of the male, with complete repulsion by all females.

  12. Precocity of Gnathostoma turgidum in naturally infected four-eyed opossum Philander opossum pallidus from Temascal, Oaxaca, Mexico. (United States)

    Almeyda-Artigas, Roberto Javier; Mosqueda-Cabrera, Miguel Angel; Sánchez-Núñez, Edmundo


    Two female advanced third-stage larvae of Gnathostoma turgidum recovered from the liver of one naturally infected four-eyed opossum Philander opossum pallidus collected in Oaxaca, Mexico, were morphologically examined. Because of some characteristics, the larvae do not fit into the typical advanced third-stage. The body shows a size at least three times larger than expected and rows of spines only in the anterior part of the body surface. Consequently, in this research, we document for the first time the precocity in third-stage larvae of G. turgidum, and we also highlight some facts about the fourth larval stage occurring in spirurins.

  13. Gene : CBRC-MEUG-01-1241 [SEVENS

    Lifescience Database Archive (English)


  14. Gene : CBRC-MEUG-01-2512 [SEVENS

    Lifescience Database Archive (English)


  15. Molecular physiology of Musca domestica (Diptera)



    A mosca domestica (Musca domestica) é um dos insetos largamente distribuído e conhecido pelo homem. A larva de M. domestica possui no conteúdo luminal do ventrículo anterior e médio uma atividade proteolítica com pH ótimo entre 3,0 3,5 e propriedades cinéticas similares a catepsina-D. Três cDNAs codificantes para preprocatepsina-D (ppCAD1, ppCAD2 e ppCAD3) foram clonados a partir de uma biblioteca de cDNA ventricular de larvas de M. domestica. As sequências possuem o peptídeo sinal, o propep...

  16. Erythrocyte glucose-6-phosphate dehydrogenase from Brazilian opossum Didelphis marsupialis

    Directory of Open Access Journals (Sweden)

    Barretto O.C. de O.


    Full Text Available In a comparative study of erythrocyte metabolism of vertebrates, the specific activity of glucose-6-phosphate dehydrogenase (G6PD of the Brazilian opossum Didelphis marsupialis in a hemolysate was shown to be high, 207 ± 38 IU g-1 Hb-1 min-1 at 37ºC, compared to the human erythrocyte activity of 12 ± 2 IU g-1 Hb-1 min-1 at 37ºC. The apparent high specific activity of the mixture led us to investigate the physicochemical properties of the opossum enzyme. We report that reduced glutathione (GSH in the erythrocytes was only 50% higher than in human erythrocytes, a value lower than expected from the high G6PD activity since GSH is maintained in a reduced state by G6PD activity. The molecular mass, determined by G-200 Sephadex column chromatography at pH 8.0, was 265 kDa, which is essentially the same as that of human G6PD (260 kDa. The Michaelis-Menten constants (Km: 55 µM for glucose-6-phosphate and nicotinamide adenine dinucleotide phosphate (Km: 3.3 µM were similar to those of the human enzyme (Km: 50-70 and Km: 2.9-4.4, respectively. A 450-fold purification of the opossum enzyme was achieved and the specific activity of the purified enzyme, 90 IU/mg protein, was actually lower than the 150 IU/mg protein observed for human G6PD. We conclude that G6PD after purification from the hemolysate of D. marsupialis does not have a high specific activity. Thus, it is quite probable that the red cell hyperactivity reported may be explained by increased synthesis of G6PD molecules per unit of hemoglobin or to reduced inactivation in the RBC hemolysate.

  17. Lack of Sarcocystis neurona antibody response in Virginia opossums (Didelphis virginiana) fed Sarcocystis neurona-infected muscle tissue. (United States)

    Cheadle, M A; Lindsay, D S; Greiner, E C


    Serum was collected from laboratory-reared Virginia opossums (Didelphis virginiana) to determine whether experimentally infected opossums shedding Sarcocystis neurona sporocysts develop serum antibodies to S. neurona merozoite antigens. Three opossums were fed muscles from nine-banded armadillos (Dasypus novemcinctus), and 5 were fed muscles from striped skunks (Mephitis mephitis). Serum was also collected from 26 automobile-killed opossums to determine whether antibodies to S. neurona were present in these opossums. Serum was analyzed using the S. neurona direct agglutination test (SAT). The SAT was modified for use with a filter paper collection system. Antibodies to S. neurona were not detected in any of the serum samples from opossums, indicating that infection in the opossum is localized in the small intestine. Antibodies to S. neurona were detected in filter-paper-processed serum samples from 2 armadillos naturally infected with S. neurona.

  18. A new developmental mechanism for the separation of the mammalian middle ear ossicles from the jaw (United States)

    Urban, Daniel J.; Anthwal, Neal; Luo, Zhe-Xi; Maier, Jennifer A.; Sadier, Alexa


    Multiple mammalian lineages independently evolved a definitive mammalian middle ear (DMME) through breakdown of Meckel's cartilage (MC). However, the cellular and molecular drivers of this evolutionary transition remain unknown for most mammal groups. Here, we identify such drivers in the living marsupial opossum Monodelphis domestica, whose MC transformation during development anatomically mirrors the evolutionary transformation observed in fossils. Specifically, we link increases in cellular apoptosis and TGF-BR2 signalling to MC breakdown in opossums. We demonstrate that a simple change in TGF-β signalling is sufficient to inhibit MC breakdown during opossum development, indicating that changes in TGF-β signalling might be key during mammalian evolution. Furthermore, the apoptosis that we observe during opossum MC breakdown does not seemingly occur in mouse, consistent with homoplastic DMME evolution in the marsupial and placental lineages. PMID:28179517

  19. Prevalence and risk factors associated with Sarcocystis neurona infections in opossums (Didelphis virginiana) from central California. (United States)

    Rejmanek, Daniel; Vanwormer, Elizabeth; Miller, Melissa A; Mazet, Jonna A K; Nichelason, Amy E; Melli, Ann C; Packham, Andrea E; Jessup, David A; Conrad, Patricia A


    Sarcocystis neurona, a protozoal parasite shed by opossums (Didelphis virginiana), has been shown to cause significant morbidity and mortality in horses, sea otters, and other marine mammals. Over the course of 3 years (fall 2005-summer 2008), opossums from central California were tested for infection with S. neurona. Of 288 opossums sampled, 17 (5.9%) were infected with S. neurona based on the molecular characterization of sporocysts from intestinal scrapings or feces. Risk factors evaluated for association with S. neurona infection in opossums included: age, sex, location, season, presence of pouch young in females, concomitant infection, and sampling method (live-trapped or traffic-killed). Multivariate logistic regression analysis identified that opossums in the Central Valley were 9 times more likely to be infected than those near the coast (p=0.009). Similarly, opossum infection was 5 times more likely to be detected during the reproductive season (March-July; p=0.013). This first investigation of S. neurona infection prevalence and associated risk factors in opossums in the western United States can be used to develop management strategies aimed at reducing the incidence of S. neurona infections in susceptible hosts, including horses and threatened California sea otters (Enhydra lutris neries).

  20. A review of Sarcocystis spp. shed by opossums (Didelphis spp. in Brazil

    Directory of Open Access Journals (Sweden)

    Samantha Yuri Oshiro Branco Valadas


    Full Text Available South American opossums are the definitive hosts of Sarcocystis neurona, Sarcocystis falcatula, Sarcocystis speeri and Sarcocystis lindsayi. The sporocysts of these species of Sarcocystis are morphologically similar and methods like infectivity and pathogenicity for intermediate hosts (immunodeficient mice and psittacine birds and molecular tools are used for identification. Opossums are synanthropic wild animals, and widely distributed in Brazilian territory. Previous studies have shown high environmental contamination with S. neurona sporocysts in several Brazilian regions. This paper reviews information on Sarcocystis spp. shed by various opossum species and its occurrence in Brazil.

  1. Light preferences of Musca domestica L.

    NARCIS (Netherlands)

    Smallegange, RC; denOtter, CJ; Sommeijer, MJ; Francke, PJ


    The attractiveness of ultraviolet, blue, green and white light to two strains of Musca domestica L. has been examined in a tunnel. Phototactic behaviour appeared to be affected by the illuminance of the tunnel and depends on the origin of the flies.

  2. Genetically different isolates of Trypanosoma cruzi elicit different infection dynamics in raccoons (Procyon lotor) and Virginia opossums (Didelphis virginiana). (United States)

    Roellig, Dawn M; Ellis, Angela E; Yabsley, Michael J


    Trypanosoma cruzi is a genetically and biologically diverse species. In the current study we determined T. cruzi infection dynamics in two common North American reservoirs, Virginia opossums (Didelphis virginiana) and raccoons (Procyon lotor). Based on previous molecular and culture data from naturally-exposed animals, we hypothesised that raccoons would have a longer patent period than opossums, and raccoons would be competent reservoirs for both genotypes T. cruzi I (TcI) and TcIIa, while opossums would only serve as hosts for TcI. Individuals (n=2 or 3) of each species were inoculated with 1x10(6) culture-derived T. cruzi trypomastigotes of TcIIa (North American (NA) - raccoon), TcI (NA - opossum), TcIIb (South American - human), or both TcI and TcIIa. Parasitemias in opossums gradually increased and declined rapidly, whereas parasitemias peaked sooner in raccoons and they maintained relatively high parasitemia for 5weeks. Raccoons became infected with all three T. cruzi strains, while opossums only became infected with TcI and TcIIb. Although opossums were susceptible to TcIIb, infection dynamics were dramatically different compared with TcI. Opossums inoculated with TcIIb seroconverted, but parasitemia duration was short and only detectable by PCR. In addition, raccoons seroconverted sooner (3-7days post inoculation) than opossums (10days post inoculation). These data suggest that infection dynamics of various T. cruzi strains can differ considerably in different wildlife hosts.

  3. Philander opossum (Marsupialia, a new host record for Sparganum of Lueheella Baer, 1924 (= Spirometra Mueller, 1937

    Directory of Open Access Journals (Sweden)

    Delir Corrêa Gomes


    Full Text Available Two samples of Sparganum, the larval form of Lueheella Baer, 1924 (= Spirometra Mueller, 1937 were recovered from Philander opossum (L. 1758 captured in Salobra, Mato Grosso State, Brazil, by Dr. Lauro Travassos in may, 1942. This is the first report of the presence of this larval form in P. opossum. Dealing with helminths recovered from Brazilian Marsupialia, deposited in Oswaldo Cruz Institute Helminthological Collection, we examined in two samples of the preserved material collected in Salobra. Mato Grosso State, nine larval forms (Sparganum of Lueheella sp. One of the samples, with six specimens, tissue. It is the first report of philander opossum harbouring this larval stage. The studied preserved wet material was stained and whole mounts were deposited in the Oswaldo Cruz institute Helminthological collection ns. 31.470 and 31.471. Measurements are in mm.Duas amostras de Sparganum, a forma larvar de Lueheella Baer, 1924 (=Spirometra Mueller, 1937, foram coletadas em Philander opossum (L., 1758 capturado em Salobra, MT, pelo Dr. Lauro Travassos, em maio de 1942. Essa é a primeira referência da presença desse estágio larvar em P. opossum.

  4. Experimental Aerosol Inoculation and Investigation of Potential Lateral Transmission of Mycobacterium bovis in Virginia Opossum (Didelphis virginiana). (United States)

    Fenton, Karla A; Fitzgerald, Scott D; Bolin, Steve; Kaneene, John; Sikarskie, James; Greenwald, Rena; Lyashchenko, Konstantin


    An endemic focus of Mycobacterium bovis (M. bovis) infection in the state of Michigan has contributed to a regional persistence in the animal population. The objective of this study was to determine if Virginia opossums (Didelphis virginiana) contribute to disease persistence by experimentally assessing intraspecies lateral transmission. One wild caught pregnant female opossum bearing 11 joeys (young opossum) and one age-matched joey were obtained for the study. Four joeys were aerosol inoculated with M. bovis (inoculated), four joeys were noninoculated (exposed), and four joeys plus the dam were controls. Four replicate groups of one inoculated and one exposed joey were housed together for 45 days commencing 7 days after experimental inoculation. At day 84 opossums were sacrificed. All four inoculated opossums had a positive test band via rapid test, culture positive, and gross/histologic lesions consistent with caseogranulomatous pneumonia. The exposed and control groups were unremarkable on gross, histology, rapid test, and culture. In conclusion, M. bovis infection within the inoculated opossums was confirmed by gross pathology, histopathology, bacterial culture, and antibody tests. However, M. bovis was not detected in the control and exposed opossums. There was no appreciable lateral transmission of M. bovis after aerosol inoculation and 45 days of cohabitation between infected and uninfected opossums.

  5. Experimental Aerosol Inoculation and Investigation of Potential Lateral Transmission of Mycobacterium bovis in Virginia Opossum (Didelphis virginiana

    Directory of Open Access Journals (Sweden)

    Karla A. Fenton


    Full Text Available An endemic focus of Mycobacterium bovis (M. bovis infection in the state of Michigan has contributed to a regional persistence in the animal population. The objective of this study was to determine if Virginia opossums (Didelphis virginiana contribute to disease persistence by experimentally assessing intraspecies lateral transmission. One wild caught pregnant female opossum bearing 11 joeys (young opossum and one age-matched joey were obtained for the study. Four joeys were aerosol inoculated with M. bovis (inoculated, four joeys were noninoculated (exposed, and four joeys plus the dam were controls. Four replicate groups of one inoculated and one exposed joey were housed together for 45 days commencing 7 days after experimental inoculation. At day 84 opossums were sacrificed. All four inoculated opossums had a positive test band via rapid test, culture positive, and gross/histologic lesions consistent with caseogranulomatous pneumonia. The exposed and control groups were unremarkable on gross, histology, rapid test, and culture. In conclusion, M. bovis infection within the inoculated opossums was confirmed by gross pathology, histopathology, bacterial culture, and antibody tests. However, M. bovis was not detected in the control and exposed opossums. There was no appreciable lateral transmission of M. bovis after aerosol inoculation and 45 days of cohabitation between infected and uninfected opossums.

  6. Aerobic bacteria cultured from the mouth of the American opossum (Didelphis virginiana) with reference to bacteria associated with bite infections.


    Howell, J. M.; Dalsey, W C


    The American opossum inflicts bite injuries both when hunted for food and when accidentally provoked when handled in captivity. This study involved aerobically culturing organisms from the mouths of seven wild opossums (Didelphis virginiana). Isolates included streptococci, coagulase-positive and -negative staphylococci, Aeromonas spp., Citrobacter freundii, Eikenella corrodens, and Escherichia coli.

  7. Gene : CBRC-MEUG-01-0989 [SEVENS

    Lifescience Database Archive (English)


  8. Molecular characterization of Sarcocystis neurona strains from opossums (Didelphis virginiana) and intermediate hosts from Central California. (United States)

    Rejmanek, Daniel; Miller, Melissa A; Grigg, Michael E; Crosbie, Paul R; Conrad, Patricia A


    Sarcocystis neurona is a significant cause of neurological disease in horses and other animals, including the threatened Southern sea otter (Enhydra lutris nereis). Opossums (Didelphis virginiana), the only known definitive hosts for S. neurona in North America, are an introduced species in California. S. neurona DNA isolated from sporocysts and/or infected tissues of 10 opossums, 6 horses, 1 cat, 23 Southern sea otters, and 1 harbor porpoise (Phocoena phocoena) with natural infections was analyzed based on 15 genetic markers, including the first internal transcribed spacer (ITS-1) region; the 25/396 marker; S. neurona surface antigen genes (snSAGs) 2, 3, and 4; and 10 different microsatellites. Based on phylogenetic analysis, most of the S. neurona strains segregated into three genetically distinct groups. Additionally, fifteen S. neurona samples from opossums and several intermediate hosts, including sea otters and horses, were found to be genetically identical across all 15 genetic markers, indicating that fatal encephalitis in Southern sea otters and equine protozoal myeloencephalitis (EPM) in horses is strongly linked to S. neurona sporocysts shed by opossums. (c) 2010 Elsevier B.V. All rights reserved.

  9. Sarcocystis neurona and Neospora caninum in Brazilian opossums (Didelphis spp.): Molecular investigation and in vitro isolation of Sarcocystis spp. (United States)

    Gondim, Leane S Q; Jesus, Rogério F; Ribeiro-Andrade, Müller; Silva, Jean C R; Siqueira, Daniel B; Marvulo, Maria F V; Aléssio, Felipe M; Mauffrey, Jean-François; Julião, Fred S; Savani, Elisa San Martin Mouriz; Soares, Rodrigo M; Gondim, Luís F P


    Sarcocystis neurona and Neospora spp. are protozoan parasites that induce neurological diseases in horses and other animal species. Opossums (Didelphis albiventris and Didelphis virginiana) are definitive hosts of S. neurona, which is the major cause of equine protozoal myeloencephalitis (EPM). Neospora caninum causes abortion in cattle and infects a wide range of animal species, while N. hughesi is known to induce neurologic disease in equids. The aims of this study were to investigate S. neurona and N. caninum in tissues from opossums in the northeastern Brazil, and to isolate Brazilian strains of Sarcocystis spp. from wild opossums for comparison with previously isolated strains. Carcasses of 39 opossums from Bahia state were available for molecular identification of Sarcocystis spp. and N. caninum in their tissues, and for sporocyst detection by intestinal scraping. In addition, Sarcocystis-like sporocysts from nine additional opossums, obtained in São Paulo state, were tested. Sarcocystis DNA was found in 16 (41%) of the 39 opossums' carcasses; N. caninum DNA was detected in tissues from three opossums. The sporocysts from the nine additional opossums from São Paulo state were tested by bioassay and induced infection in nine budgerigars, but in none of the gamma-interferon knockout mice. In vitro isolation was successful using tissues from all nine budgerigars. The isolated strains were maintained in CV-1 and Vero cells. Three of nine isolates presented contamination in cell culture and were discarded. Analysis of six isolates based on five loci showed that these parasites were genetically different from each other and also distinct from S. neurona, S. falcatula, S. lindsayi, and S. speeri. In conclusion, opossums in the studied regions were infected with N. caninum and Sarcocystis spp. and represent a potential source of infection to other animals. This is the first report of N. caninum infection in tissues from black-eared opossum (D. aurita or D

  10. Diet of Monodelphis glirina (Mammalia: Didelphidae in forest fragments in southern Amazon

    Directory of Open Access Journals (Sweden)

    Welvis Felipe Fernandes Castilheiro


    Full Text Available The current study aimed to evaluate the diet of Monodelphis glirina (Wagner, 1842 in forest fragments of Alta Floresta, located in the south of the Amazon, state of Mato Grosso. The diet was determined by the analysis of the stomach contents from 57 subjects sampled between May and September 2009. Nine food categories were present: Coleoptera, Orthoptera, Hymenoptera, Diplopoda, Nematoda, seeds, miscellaneous, hair and bait leftovers (banana and peanut butter. Coleoptera was the category eaten most frequently, rating 50% of abundance and 91.22% of occurrence. "Seeds" were the least abundant (0.11% and rated 1.75% in occurrence, probably because seeds are easy to digest. The size of the fragments negatively and significantly influenced the amount of Coleoptera in the diet. The rainy season seemed to have significant influence over the abundance of arthropods in the diet. The items in the diet suggest that M. glirina is opportunistic and has a generalist diet, tending to be insectivore when living in the forest and exploring the food resources according to their availability.

  11. R. Strauss: Symphonia domestica, Op. 53 / David Nice

    Index Scriptorium Estoniae

    Nice, David


    Uuest heliplaadist "R. Strauss: Symphonia domestica, Op. 53. National Youth Orchestra of Great Britain / Christopher Seaman. Pickwick IMP Classics CD PCD 1080; Selected comparisons: SNO, Järvi (3/88) Chandos CHAN 8572"

  12. R. Strauss: Symphonia domestica, Op. 53 / David Nice

    Index Scriptorium Estoniae

    Nice, David


    Uuest heliplaadist "R. Strauss: Symphonia domestica, Op. 53. National Youth Orchestra of Great Britain / Christopher Seaman. Pickwick IMP Classics CD PCD 1080; Selected comparisons: SNO, Järvi (3/88) Chandos CHAN 8572"

  13. Wound Myiasis Due to Musca domestica (Diptera: Muscidae in Persian Horned Viper, Pseudocerastes persicus (Squamata: Viperidae

    Directory of Open Access Journals (Sweden)

    R Dehghani


    Full Text Available A case of myiasis due to Musca domestica describes in Pseudocerastes persicus for the first time. The snake was found in Bari Karafs, Kashan, Iran, with a lesion on its body. Fourteen live larvae of M. domestica removed from its wound. This is the first report of a new larval habitat of M. domestica.

  14. INFECTION BY Rickettsia felis IN OPOSSUMS (Didelphis sp.) FROM YUCATAN, MEXICO. (United States)

    Peniche-Lara, Gaspar; Ruiz-Piña, Hugo A; Reyes-Novelo, Enrique; Dzul-Rosado, Karla; Zavala-Castro, Jorge


    Rickettsia felis is an emergent pathogen and the causative agent of a typhus-like rickettsiosis in the Americas. Its transmission cycle involves fleas as biological vectors (mainly Ctenocephalides felis) and multiple domestic and synanthropic mammal hosts. Nonetheless, the role of mammals in the cycle of R. felis is not well understood and many efforts are ongoing in different countries of America to clarify it. The present study describes for the first time in Mexico the infection of two species of opossum (Didelphis virginiana and D. marsupialis) by R. felis. A diagnosis was carried out from blood samples by molecular methods through the gltA and 17 kDa genes and sequence determination. Eighty-seven opossum samples were analyzed and 28 were found to be infected (32.1%) from five out of the six studied localities of Yucatan. These findings enable recognition of the potential epidemiological implications for public health of the presence of infected synanthropic Didelphis in households.

  15. Isolation and amino acid sequences of opossum vasoactive intestinal polypeptide and cholecystokinin octapeptide.



    Evolutionary history suggests that the marsupials entered South America from North America about 75 million years ago and subsequently dispersed into Australia before the separation between South America and Antarctica-Australia. A question of interest is whether marsupial peptides resemble the corresponding peptides of Old or New World mammals. Previous studies had shown that "little" gastrin of the North American marsupial, the opossum, is identical in length to that of the New World mammal...

  16. Receptors and cGMP signalling mechanism for E. coli enterotoxin in opossum kidney

    Energy Technology Data Exchange (ETDEWEB)

    Forte, L.R.; Krause, W.J.; Freeman, R.H. (Univ. of Missouri, Columbia (USA) Harry S. Truman Memorial Veterans Medical Center, Columbia, MO (USA))


    Receptors for the heat-stable enterotoxin produced by Escherichia coli were found in the kidney and intestine of the North American opossum and in cultured renal cell lines. The enterotoxin markedly increased guanosine 3{prime},5{prime}-cyclic monophosphate (cGMP) production in slices of kidney cortex and medulla, in suspensions of intestinal mucosa, and in the opossum kidney (OK) and rat kangaroo kidney (PtK-2) cell lines. In contrast, atrial natriuretic factor elicited much smaller increases in cGMP levels of kidney, intestine, or cultured kidney cell lines. The enterotoxin receptors in OK cells had a molecular mass of approximately 120 kDa when measured by sodium dodecyl sulfate-polyacrylamide gel electrophoresis of receptors crosslinked with {sup 125}I-enterotoxin. The occurrence of receptors for the E. coli peptide in OK implies that these receptors may be involved in the regulation of renal tubular function in the opossum. E. coli enterotoxin caused a much larger increase in urine cGMP excretion than did atrial natriuretic factor when these peptides were injected intravenously into opossums. However, atrial natriuretic factor elicited a marked diuresis, natriuresis, and increased urinary excretion of calcium, phosphate, potassium, and magnesium. In contrast, the enterotoxin did not acutely influence OK fluid and electrolyte excretion. Thus the substantial increase in cGMP synthesis produced by the bacterial peptide in OK cortex and medulla in vitro and the increased renal excretion of cGMP in vivo were not associated with changes in electrolyte or water excretion. Whether cGMP represents a second messenger molecule in the kidney is an interesting question that was raised but not answered in this series of experiments.

  17. Structural and Ultrastructural Aspects of Folliculogenesis in Didelphis albiventris, the South-American Opossum


    Cesario, Maria Dalva [UNESP; Michelin Matheus, Selma M. [UNESP


    The ovarian histology, the structural and the ultrastructural characteristics of the folliculogenesis in Didelphis albiventris were described in detail. Recent studies suggest that methatherian mammals have unusual reproductive cycle but there are few informations regarding the marsupials reproductive life. Despite of the opossum folliculogenesis pattern resembles methatherian and eutherian pattern in many aspects, the analysis shows some peculiar features of the oocyte structure and ultrastr...

  18. Adaptive evolution of the venom-targeted vWF protein in opossums that eat pitvipers.

    Directory of Open Access Journals (Sweden)

    Sharon A Jansa

    Full Text Available The rapid evolution of venom toxin genes is often explained as the result of a biochemical arms race between venomous animals and their prey. However, it is not clear that an arms race analogy is appropriate in this context because there is no published evidence for rapid evolution in genes that might confer toxin resistance among routinely envenomed species. Here we report such evidence from an unusual predator-prey relationship between opossums (Marsupialia: Didelphidae and pitvipers (Serpentes: Crotalinae. In particular, we found high ratios of replacement to silent substitutions in the gene encoding von Willebrand Factor (vWF, a venom-targeted hemostatic blood protein, in a clade of opossums known to eat pitvipers and to be resistant to their hemorrhagic venom. Observed amino-acid substitutions in venom-resistant opossums include changes in net charge and hydrophobicity that are hypothesized to weaken the bond between vWF and one of its toxic snake-venom ligands, the C-type lectin-like protein botrocetin. Our results provide the first example of rapid adaptive evolution in any venom-targeted molecule, and they support the notion that an evolutionary arms race might be driving the rapid evolution of snake venoms. However, in the arms race implied by our results, venomous snakes are prey, and their venom has a correspondingly defensive function in addition to its usual trophic role.

  19. Cranial anatomy of the earliest marsupials and the origin of opossums.

    Directory of Open Access Journals (Sweden)

    Inés Horovitz

    Full Text Available BACKGROUND: The early evolution of living marsupials is poorly understood in part because the early offshoots of this group are known almost exclusively from jaws and teeth. Filling this gap is essential for a better understanding of the phylogenetic relationships among living marsupials, the biogeographic pathways that led to their current distribution as well as the successive evolutionary steps that led to their current diversity, habits and various specializations that distinguish them from placental mammals. METHODOLOGY/PRINCIPAL FINDINGS: Here we report the first skull of a 55 million year old peradectid marsupial from the early Eocene of North America and exceptionally preserved skeletons of an Oligocene herpetotheriid, both representing critical groups to understand early marsupial evolution. A comprehensive phylogenetic cladistic analysis of Marsupialia including the new findings and close relatives of marsupials show that peradectids are the sister group of living opossums and herpetotheriids are the sister group of all living marsupials. CONCLUSIONS/SIGNIFICANCE: The results imply that North America played an important role in early Cenozoic marsupial evolutionary history and may have even been the center of origin of living marsupials and opossums. New data from the herpetotheriid postcranium support the view that the ancestral morphotype of Marsupialia was more terrestrial than opossums are. The resolution of the phylogenetic position of peradectids reveals an older calibration point for molecular estimates of divergence times among living marsupials than those currently used.

  20. Expression pattern of antibacterial genes in the Musca domestica

    Institute of Scientific and Technical Information of China (English)

    WANG Yan; JIN XiaoBao; ZHU JiaYong; ZENG AiHua; CHU FuJiang; YANG XiaoRong; MA Yan


    This work studied the transcriptional patterns of three antibacterial genes, attacin, defensin and cecropin, during the development of Musca domestica. Quantitative analysis by real-time PCR was performed on mRNA levels in different development stages and challenged 3rd-instar larva at different time points after challenge of Musca domestica. The results revealed a predominance of the transcripts of all three genes during the 3rd-instar larvae and the adults. In the meanwhile, it revealed the greatest increase in mRNA. The transcript levels increased to 801 times, 1009 times and 2500 times respectively for cecropin, attacin and defensin in 3rd-instar larvae after challenging susceptible bacterium. The results suggested that the transcriptional patterns of Musca domestica antibacterial genes were different during the different growth stages as well as the microbial challenge encountered in 3rd-instar larvae.

  1. Expression pattern of antibacterial genes in the Musca domestica

    Institute of Scientific and Technical Information of China (English)


    This work studied the transcriptional patterns of three antibacterial genes,attacin,defensin and cecropin,during the development of Musca domestica. Quantitative analysis by real-time PCR was performed on mRNA levels in different development stages and challenged 3rd-instar larva at different time points after challenge of Musca domestica. The results revealed a predominance of the transcripts of all three genes during the 3rd-instar larvae and the adults. In the meanwhile,it revealed the greatest increase in mRNA. The transcript levels increased to 801 times,1009 times and 2500 times respectively for cecropin,attacin and defensin in 3rd-instar larvae after challenging susceptible bacterium. The results suggested that the transcriptional patterns of Musca domestica antibacterial genes were different during the different growth stages as well as the microbial challenge encountered in 3rd-instar larvae.

  2. Opossum carboxylesterases: sequences, phylogeny and evidence for CES gene duplication events predating the marsupial-eutherian common ancestor

    Directory of Open Access Journals (Sweden)

    Chan Jeannie


    Full Text Available Abstract Background Carboxylesterases (CES perform diverse metabolic roles in mammalian organisms in the detoxification of a broad range of drugs and xenobiotics and may also serve in specific roles in lipid, cholesterol, pheromone and lung surfactant metabolism. Five CES families have been reported in mammals with human CES1 and CES2 the most extensively studied. Here we describe the genetics, expression and phylogeny of CES isozymes in the opossum and report on the sequences and locations of CES1, CES2 and CES6 'like' genes within two gene clusters on chromosome one. We also discuss the likely sequence of gene duplication events generating multiple CES genes during vertebrate evolution. Results We report a cDNA sequence for an opossum CES and present evidence for CES1 and CES2 like genes expressed in opossum liver and intestine and for distinct gene locations of five opossum CES genes,CES1, CES2.1, CES2.2, CES2.3 and CES6, on chromosome 1. Phylogenetic and sequence alignment studies compared the predicted amino acid sequences for opossum CES with those for human, mouse, chicken, frog, salmon and Drosophila CES gene products. Phylogenetic analyses produced congruent phylogenetic trees depicting a rapid early diversification into at least five distinct CES gene family clusters: CES2, CES1, CES7, CES3, and CES6. Molecular divergence estimates based on a Bayesian relaxed clock approach revealed an origin for the five mammalian CES gene families between 328–378 MYA. Conclusion The deduced amino acid sequence for an opossum cDNA was consistent with its identity as a mammalian CES2 gene product (designated CES2.1. Distinct gene locations for opossum CES1 (1: 446,222,550–446,274,850, three CES2 genes (1: 677,773,395–677,927,030 and a CES6 gene (1: 677,585,520–677,730,419 were observed on chromosome 1. Opossum CES1 and multiple CES2 genes were expressed in liver and intestine. Amino acid sequences for opossum CES1 and three CES2 gene products

  3. NCBI nr-aa BLAST: CBRC-CJAC-01-1179 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1179 ref|XP_001362997.1| PREDICTED: hypothetical protein isoform 2 [Monodelphi...s domestica] ref|XP_001363415.1| PREDICTED: hypothetical protein isoform 2 [Monodelphis domestica] XP_001362997.1 2e-08 30% ...

  4. Recombination, transcription, and diversity of a partially germline-joined VH in a mammal. (United States)

    Wang, Xinxin; Miller, Robert D


    Full or partially germline-joined V genes have been described in a number of different vertebrate lineages where they can contribute to the expressed antibody repertoire through different mechanisms. Here we demonstrate that VH3.1, a partially germline-joined VH gene in the opossum Monodelphis domestica, can undergo V(D)J recombination to generate productive IgH transcripts. VH3.1 is fused to a DH gene segment in the germline DNA and is the only known example of a germline-joined VH in a mammal. B cells that have recombined VH3.1 were not detected until nearly 2 months of age, around the time of weaning, and much later than B cells using the conventional VH. Compared to opossum IgH transcripts using the conventional VH genes, those with VH3.1 have unusually long CDR3 due to the length of the germline-joined DH.

  5. Fatal attraction. Control of the housefly (Musca domestica)

    NARCIS (Netherlands)

    Smallegange, R.C.


    Despite its long association with man, the housefly (Musea domestica Linnaeus) remains one of the most difficult pests to control. It is a ubiquitous insect that can be found in houses, stables, food processing factories and other domesticated areas and buildings. Reliance on insecticides for fly co

  6. Diversity of K+ channels in circular smooth muscle of opossum lower esophageal sphincter. (United States)

    Zhang, Y; Paterson, W G


    We previously demonstrated that a balance of K+ and Ca2+-activated Cl- channel activity maintained the basal tone of circular smooth muscle of opossum lower esophageal sphincter (LES). In the current studies, the contribution of major K+ channels to the LES basal tone was investigated in circular smooth muscle of opossum LES in vitro. K+ channel activity was recorded in dispersed single cells at room temperature using patch-clamp recordings. Whole-cell patch-clamp recordings displayed an outward current beginning to activate at -60 mV by step test pulses lasting 400 ms (-120 mV to +100 mV) with increments of 20 mV from holding potential of -80 mV ([K+]I = 150 mM, [K+]o = 2.5 mM). However, no inward rectification was observed. The outward current peaked within 50 ms and showed little or no inactivation. It was significantly decreased by bath application of nifedipine, tetraethylammonium (TEA), 4-aminopyridine (4-AP), and iberiotoxin (IBTN). Further combination of TEA with 4-AP, nifedipine with 4-AP, and IBTN with TEA, or vice versa, blocked more than 90% of the outward current. Ca2+-sensitive single channels were recorded at asymetrical K+ gradients in cell-attached patch-clamp configurations (100.8+/-3.2 pS, n = 8). Open probability of the single channels recorded in inside-out patch-clamp configurations were greatly decreased by bath application of IBTN (100 nM) (Vh = -14.4+/-4.8 mV in control vs. 27.3+/-0.1 mV, n = 3, P < 0.05). These data suggest that large conductance Ca2+-activated K+ and delayed rectifier K+ channels contribute to the membrane potential, and thereby regulate the basal tone of opossum LES circular smooth muscle.

  7. Natural infection of the opossum Didelphis albiventris (Marsupialia, Didelphidae with Leishmania donovani, in Brazil

    Directory of Open Access Journals (Sweden)

    Ítalo A. Sherlock


    Full Text Available An opossum, Didelphis albiventris, from Jacobina, bahia State, was found naturally infected with Leishmania donovani, being the first non-canid wild mammal to be detected with agent of kala-azar in the New World.Um gambá, Didelphis albiventris, de Jacobina, Bahia, foi encontrado com infecção natural pela Leishmania donovani, sendo o primeiro mamífero silvestre não-canídeo a ser achado com o agente do calazar nas Américas.

  8. INFECTION BY Rickettsia felis IN OPOSSUMS (Didelphis sp. FROM YUCATAN, MEXICO

    Directory of Open Access Journals (Sweden)



    Full Text Available Rickettsia felis is an emergent pathogen and the causative agent of a typhus-like rickettsiosis in the Americas. Its transmission cycle involves fleas as biological vectors (mainly Ctenocephalides felis and multiple domestic and synanthropic mammal hosts. Nonetheless, the role of mammals in the cycle of R. felis is not well understood and many efforts are ongoing in different countries of America to clarify it. The present study describes for the first time in Mexico the infection of two species of opossum (Didelphis virginiana and D. marsupialis by R. felis. A diagnosis was carried out from blood samples by molecular methods through the gltAand 17 kDa genes and sequence determination. Eighty-seven opossum samples were analyzed and 28 were found to be infected (32.1% from five out of the six studied localities of Yucatan. These findings enable recognition of the potential epidemiological implications for public health of the presence of infected synanthropic Didelphis in households.

  9. Prevalence of agglutinating antibodies to Sarcocystis neurona in skunks (Mephitis Mephitis), raccoons (Procyon lotor), and opossums (Didelphis Virginiana) from Connecticut. (United States)

    Mitchell, Sheila M; Richardson, Dennis J; Cheadle, M Andy; Zajac, Anne M; Lindsay, David S


    Equine protozoal myeloencephalitis is the most important protozoan disease of horses in North America and is usually caused by Sarcocystis neurona. Natural cases of encephalitis caused by S. neurona have been reported in skunks (Mephitis mephitis) and raccoons (Procyon lotor). Opossums (Didelphis spp.) are the only known definitive host. Sera from 24 striped skunks, 12 raccoons, and 7 opossums (D. virginiana) from Connecticut were examined for agglutinating antibodies to S. neurona using the S. neurona agglutination test (SAT) employing formalin-fixed merozoites as antigen. The SAT was validated for skunk sera using pre- and postinfection serum samples from 2 experimentally infected skunks. Of the 24 (46%) skunks 11 were positive, and all 12 raccoons were positive for S. neurona antibodies. None of the 7 opossums was positive for antibodies to S. neurona. These results suggest that exposure to sporocysts of S. neurona by intermediate hosts is high in Connecticut. The absence of antibodies in opossums collected from the same areas is most likely because of the absence of systemic infection in the definitive host.

  10. Dogs and Opossums Positive for Vaccinia Virus during Outbreak Affecting Cattle and Humans, São Paulo State, Brazil. (United States)

    Peres, Marina G; Barros, Claudenice B; Appolinário, Camila M; Antunes, João M A P; Mioni, Mateus S R; Bacchiega, Thais S; Allendorf, Susan D; Vicente, Acácia F; Fonseca, Clóvis R; Megid, Jane


    During a vaccinia virus (VACV) outbreak in São Paulo State, Brazil, blood samples were collected from cows, humans, other domestic animals, and wild mammals. Samples from 3 dogs and 3 opossums were positive for VACV by PCR. Results of gene sequencing yielded major questions regarding other mammalian species acting as reservoirs of VACV.

  11. Triterpenes and phenolic compounds in apple fruit (Malus domestica Borkh.)


    Lv, Yanrong


    Apple (Malus × domestica Borkh.), a popular and widely cultivated fruit world-wide, contains bioactive triterpenes and phenolic compounds with potentially valuable pharmacological functions. This thesis investigated the effects of pre-harvest and postharvest factors on concentrations of these bioactive compounds in apples. It also studied the effect of ozone treatment, before or during storage, combined with cold storage on triterpene and phenolic compound concentrations in apples and the ant...

  12. transportados por Musca domestica. Lima-Perú.

    Directory of Open Access Journals (Sweden)

    Christian Castillo Elera


    Full Text Available Objetivo: Determinar el porcentaje de parásitos de importancia en salud pública que son transportados por Musca domestica. Diseño: Estudio transversal, descriptivo no experimental. Lugar: Instituto de Medicina Tropical ¿Daniel A. Carrión¿, Universidad Nacional Mayor de San Marcos. Participantes: 1867 ejemplares de Musca domestica. Intervenciones: Técnicas de lavado y machacado de moscas; los sedimentos se analizaron con las coloraciones de Lugol y Kinyoun empleando microscopio óptico. Principales medidas de resultado: Análisis en frecuencias absolutas y relativas de parasitos encontrados en las técnicas de machacado y lavado. Resultados: Se hallaron los siguientes parásitos: Endolimax nana (41.13%, Blastocystis hominis (34.68%, Entamoeba hartmanni (10.86%, Entamoeba coli (4.34%, Cyclospora cayetanensis (4.34%, Giardia lamblia (2.17% y Toxocara canis (2,17%. Conclusiones: Los parásitos encontrados en Musca domestica del mercado Caquetá fueron los siguientes: Endolimax nana, Blastocystis hominis, Entamoeba hartmanni, Entamoeba coli, Cyclospora cayetanensis, Giardia lamblia y Toxocara canis, siendo el de mayor frecuencia E. nana en el total de la muestra y a su vez, en el subgrupo de lavado. Se describe el hallazgo de Toxocara canis no reportado en estudios similares.

  13. DNA barcodes effectively identify the morphologically similar Common Opossum (Didelphis marsupialis) and Virginia Opossum (Didelphis virginiana) from areas of sympatry in Mexico. (United States)

    Cervantes, Fernando A; Arcangeli, Jésica; Hortelano-Moncada, Yolanda; Borisenko, Alex V


    Two morphologically similar species of opossum from the genus Didelphis-Didelphis virginiana and Didelphis marsupialis-cooccur sympatrically in Mexico. High intraspecific variation complicates their morphological discrimination, under both field and museum conditions. This study aims to evaluate the utility and reliability of using DNA barcodes (short standardized genome fragments used for DNA-based identification) to distinguish these two species. Sequences of the cytochrome c oxidase subunit I (Cox1) mitochondrial gene were obtained from 12 D. marsupialis and 29 D. virginiana individuals and were compared using the neighbor-joining (NJ) algorithm with Kimura's two-parameter (K2P) model of nucleotide substitution. Average K2P distances were 1.56% within D. virginiana and 1.65% in D. marsupialis. Interspecific distances between D. virginiana and D. marsupialis varied from 7.8 to 9.3% and their barcode sequences formed distinct non-overlapping clusters on NJ trees. All sympatric specimens of both species were effectively discriminated, confirming the utility of Cox1 barcoding as a tool for taxonomic identification of these morphologically similar taxa.

  14. Prevalence of antibodies to Trypanosoma cruzi, Toxoplasma gondii, Encephalitozonn cuniculi, Sarcocystis neurona, Besnoitia darlingi, and Neospora caninum in North American opossum, Didelphis virginiana, from Southern Louisian (United States)

    We examined the prevalence of antibodies to zoonotic protozoan parasites (Trypanosoma cruzi, Toxoplasma gondii, and Encephalitozoon cuniculi) and protozoan’s of veterinary importance (Neospora caninum, Sarcocystis neurona and Besnoitia darlingi) in a population of North American opossums (Didelphis...

  15. First molecular evidence of Toxoplasma gondii in opossums (Didelphis virginiana) from Yucatan, Mexico. (United States)

    Torres-Castro, M; Noh-Pech, H; Puerto-Hernández, R; Reyes-Hernández, B; Panti-May, A; Hernández-Betancourt, S; Yeh-Gorocica, A; González-Herrera, L; Zavala-Castro, J; Puerto, F I


    Toxoplasma gondii is an obligate intracellular parasite recognized as a causal agent of toxoplasmosis; zoonotic disease endemic in many countries worldwide, including Mexico. Different species of animals participate in the wild cycle infection, including opossums of the species Didelphis virginiana. Thirteen D. virginiana were captured in Yucatan, Mexico. Detection of T. gondii was achieved by Polymerase Chain Reaction, which determined an infection of 76.9% (10/13) in brains. Positive amplicons were sequenced for analysis, this produced results similar to T. gondii with identity and coverage values of 98% and 96-100%, respectively. This study presents the first molecular evidence of the circulation of T. gondii in D. virginiana from Mexico.

  16. Morphologic aspects of Tetratrichomonas didelphidis isolated from opossums Didelphis marsupialis and Lutreolina crassicaudata

    Directory of Open Access Journals (Sweden)

    Tiana Tasca


    Full Text Available Tetratrichomonas didelphidis (Hegner & Ratcliffe, 1927 Andersen & Reilly, 1965 is a flagellate protozoan found in the intestine, cecum, and colon of Didelphis marsupialis. The parasitic protozoa used in this study was found and isolated in the intestine of opossums in Pavlova starch-containing medium in Florianópolis, State of Santa Catarina, Brazil, from D. marsupialis and Lutreolina crassicaudata. The strains were cultivated in Diamond medium without maltose and with starch solution, pH 7.5 at 28°C. The specimens were stained by the Giemsa method and Heidenhain's iron hematoxylin. The light microscopy study of the trophozoites revealed the same morphologic characteristics as specimens previously described.

  17. Description of Leishmania (Leishmania forattinii sp. n., a new parasite infecting opossums and rodents in Brazil

    Directory of Open Access Journals (Sweden)

    Elizaide L. A. Yoshida


    Full Text Available A new parasite species of Leishmania is described, L. (Leishmania forattinii sp. n., which was isolated from a pooled triturate of liver and spleen of a opossum (Didelphis marsupialis aurita and from skin samples from a rodent (Proechmys iheringi denigratus, captured in primary forest on the Atlantic Cost of Brazil. Our results on the basis of biological and molecular criteria indicate that this taxonomically distinct parasite ias a new species of the L. mexicana complex, but closely related to L. (L. aristidesi Laison & shaw, 1979, as revelated by phenetic and phylogenetic numerical analyses of the enzyme data. L. forattinii was clearly distinguishable from other Leishmania species of the genus usisng enzyme electrophoresis, monoclonal antibodies, molecular karyotypes, analysis of restriction enzyme digestion patterns of kinetoplast DNA (kDNA, as well as the use of kDNA hybridization procedures.

  18. First molecular evidence of Toxoplasma gondii in opossums (Didelphis virginiana from Yucatan, Mexico

    Directory of Open Access Journals (Sweden)

    M. Torres-Castro


    Full Text Available Toxoplasma gondii is an obligate intracellular parasite recognized as a causal agent of toxoplasmosis; zoonotic disease endemic in many countries worldwide, including Mexico. Different species of animals participate in the wild cycle infection, including opossums of the species Didelphis virginiana. Thirteen D. virginiana were captured in Yucatan, Mexico. Detection of T. gondii was achieved by Polymerase Chain Reaction, which determined an infection of 76.9% (10/13 in brains. Positive amplicons were sequenced for analysis, this produced results similar to T. gondii with identity and coverage values of 98% and 96-100%, respectively. This study presents the first molecular evidence of the circulation of T. gondii in D. virginiana from Mexico.

  19. Cultivated Characters of Nandina domestica%南天竹栽培性状研究

    Institute of Scientific and Technical Information of China (English)



    [Objective] This study was to systematically investigate the cultivated characters of Nandina domestica and to lay a foundation for breeding, cultivating, as well as its application in landscape. [Method] Using N.domestica populations from 13 different areas of Hunan Province as tested samples, the cultivated characters of N.domestica in both the cultivated type and wild type were systematically studied through field experiment and comparative analysis. [Resul] The phenological features of N.domestica from different areas and germplasm resources were basically identical; the growth patterns of cultivated type and wild type were also basically identical, but the cultivated type grew faster than the wild type; both the two types grew quickly at young stage, and either the annual growth of new shoots or the growth pattern of leaves confirmed the fitting curve of the Logistic equation. [Conclusion] This research provided basis for the exploitation and utilization the germplasm resources of N.domestica.

  20. Humoral Immune Response Kinetics in Philander opossum and Didelphis marsupialis Infected and Immunized by Trypanosoma cruzi Employing an Immunofluorescence Antibody Test

    Directory of Open Access Journals (Sweden)

    Ana Paula Legey


    Full Text Available Philander opossum and Didelphis marsupialis considered the most ancient mammals and an evolutionary success, maintain parasitism by Trypanosoma cruzi without developing any apparent disease or important tissue lesion. In order to elucidate this well-balanced interaction, we decided to compare the humoral immune response kinetics of the two didelphids naturally and experimentally infected with T. cruzi and immunized by different schedules of parasite antigens, employing an indirect fluorescence antibody test (IFAT. Both didelphids responded with high serological titers to different immunization routes, while the earliest response occurred with the intradermic route. Serological titers of naturally infected P. opossum showed a significant individual variation, while those of D. marsupialis remained stable during the entire follow-up period. The serological titers of the experimentally infected animals varied according to the inoculated strain. Our data suggest that (1 IFAT was sensitive for follow-up of P. opossum in natural and experimental T. cruzi infections; (2 both P. opossum and D. marsupialis are able to mount an efficient humoral immune response as compared to placental mammals; (3 experimentally infected P. opossum and D. marsupialis present distinct patterns of infection, depending on the subpopulation of T. cruzi, (4 the differences observed in the humoral immune responses between P. opossum and D. marsupialis, probably, reflect distinct strategies selected by these animals during their coevolution with T. cruzi.

  1. Musca domestica laboratory susceptibility to three ethnobotanical culinary plants. (United States)

    El Zayyat, Elham A; Soliman, Mohammed I; Elleboudy, Noha A; Ofaa, Shaimaa E


    Throughout history, synanthropic Musca domestica had remained a worldwide problem whenever poor sanitation and bad hygienic conditions exists. Houseflies growing resistance to chemical insecticides are a rising environmental problem that necessitates search for alternatives. Mentha cervina, Ocimum basilicum, and Coriandrum sativum were tested for bioactivity on M. domestica adults and larvae. They are culinary Mediterranean plants. In adulticidal bioassay, using both CDC bottles and fumigation techniques, basil was the most effective extract with LC50 1.074 and 34.996 g/L, respectively. Concerning larvicidal bioassay by fumigation technique, coriander had the highest toxicity index with LC50 29.521 g/L. In both dipping and feeding technique, basil had the highest toxicity with LC50 32.643 and 0.749 g/L, respectively. Basil showed the highest toxicity results in four out of the five models tested followed by coriander then mint; this result highlights the potentiality of basil as a green insecticide in management of flies and opens new insight in the industrialization of basil-based fly control products.

  2. Transcriptional response of Musca domestica larvae to bacterial infection.

    Directory of Open Access Journals (Sweden)

    Ting Tang

    Full Text Available The house fly Musca domestica, a cosmopolitan dipteran insect, is a significant vector for human and animal bacterial pathogens, but little is known about its immune response to these pathogens. To address this issue, we inoculated the larvae with a mixture of Escherichia coli and Staphylococcus aureus and profiled the transcriptome 6, 24, and 48 h thereafter. Many genes known to controlling innate immunity in insects were induced following infection, including genes encoding pattern recognition proteins (PGRPs, various components of the Toll and IMD signaling pathways and of the proPO-activating and redox systems, and multiple antimicrobial peptides. Interestingly, we also uncovered a large set of novel immune response genes including two broad-spectrum antimicrobial peptides (muscin and domesticin, which might have evolved to adapt to house-fly's unique ecological environments. Finally, genes mediating oxidative phosphorylation were repressed at 48 h post-infection, suggesting disruption of energy homeostasis and mitochondrial function at the late stages of infection. Collectively, our data reveal dynamic changes in gene expression following bacterial infection in the house fly, paving the way for future in-depth analysis of M. domestica's immune system.

  3. Shape, variance and integration during craniogenesis: contrasting marsupial and placental mammals. (United States)

    Goswami, A; Polly, P D; Mock, O B; Sánchez-Villagra, M R


    Studies of morphological integration can provide insight into developmental patterns, even in extinct taxa known only from skeletal remains, thus making them an important tool for studies of evolutionary development. However, interpreting patterns of integration and assessing their significance for organismal evolution requires detailed understanding of the developmental interactions that shape integration and how those interactions change through ontogeny. Thus far, relatively little comparative data have been produced for this important topic, and the data that do exist are overwhelmingly from humans and their close relatives or from laboratory models such as mice. Here, we compare data on shape, variance and integration through postnatal ontogeny for a placental mammal, the least shrew, Cryptotis parva, and a marsupial mammal, the gray short-tailed opossum, Monodelphis domestica. Cranial variance decreased dramatically from early to late ontogeny in Cryptotis, but remained stable through ontogeny in Monodelphis, potentially reflecting functional constraints related to the short gestation and early ossification of oral bones in marsupials. Both Cryptotis and Monodelphis showed significant changes in cranial integration through ontogeny, with a mixture of increased, decreased and stable levels of integration in different cranial regions. Of particular note is that Monodelphis showed an unambiguous decrease in integration of the oral region through ontogeny, potentially relating to their early ossification. Selection at different stages of development may have markedly different effects if patterns of integration change substantially through ontogeny. Our results suggest that high integration of the oral region combined with functional constraints for suckling during early postnatal ontogeny may drive the stagnant variance observed in Monodelphis and potentially other marsupials. © 2012 The Authors. Journal of Evolutionary Biology © 2012 European Society For

  4. Serological evidence of exposure to tick-borne agents in opossums (Didelphis spp.) in the state of São Paulo, Brazil. (United States)

    Melo, Andréia Lima Tomé; Aguiar, Daniel Moura de; Spolidorio, Mariana Granziera; Yoshinari, Natalino Hajime; Matushima, Eliana Reiko; Labruna, Marcelo Bahia; Horta, Mauricio Claudio


    This work involved a serological investigation of tick-borne pathogens in opossums in eight municipalities of the state of São Paulo, Brazil. Serum samples from 109 opossums (91 Didelphis aurita and 18 Didelphis albiventris) were tested to detect antibodies to Rickettsia rickettsii (Taiaçu strain, 1:64 cut-off) and Ehrlichia canis (São Paulo strain, 1:40 cut-off), by indirect immunofluorescence assay (IFA); and against Borrelia burgdorferi (strain G39/40) by enzyme-linked immunosorbent assay (ELISA). The presence of antibodies to anti-R. rickettsii, anti-E. canis and anti-B. burgdorferi was detected in 32 (29.35%), 16 (14.67%) and 30 (27.52%) opossums, respectively. Opossum endpoint titers ranged from 64 to 1,024 for R. rickettsii, from 40 to 160 for E. canis, and from 400 to >51,200 for B. burgdorferi. These serological results suggest that opossums have been exposed to Rickettsia spp., Ehrlichia spp., and B. burgdorferi-related agents in the state of São Paulo. Our study underscores the need for further research about these agents in this study area, in view of the occurrence of Spotted Fever and Baggio-Yoshinari Syndrome disease in humans in the state of São Paulo, Brazil.

  5. Membrane potential and mechanical responses of the opossum esophagus to vagal stimulation and swallowing. (United States)

    Rattan, S; Gidda, J S; Goyal, R K


    Studies were performed in anesthetized opossums. The electrical changes, recorded using a suction electrode applied to the outside of the esophagus, and mechanical activity, recorded by an intraluminal catheter, were monitored from 5 cm above the lower esophageal sphincter. Swallowing was associated with membrane hyperpolarization followed by depolarization and spike burst. Electrical stimulation of the decentralized vagus also caused a prompt hyperpolarization followed by an overshoot depolarization. Single pulses of stimulation caused primarily hyperpolarization. The amplitude and duration of hyperpolarization increased with increasing frequencies of vagal stimulation. Spike burst occurred as the membrane potential was recovering from the peak hyperpolarization and moving toward peak depolarization. The latency of onset of spike burst decreased with increasing frequency of vagal stimulation. The muscle contraction occurred after a latency. The latency of contractions, like the latency of spike burst, decreased with increased frequency of vagal stimulation. These studies show that (a) membrane hyperpolarization is present during the latent period of contraction associated with swallowing, suggesting that swallow-induced esophageal response may be mediated by vagal inhibitory pathway to the esophagus and (b) spike bursts can be temporally dissociated from depolarization by changing the vagal stimulation frequency, suggesting that spike burst and depolarization may be mediated by different excitatory mechanisms.

  6. Susceptibility to thiamethoxam of Musca domestica from Danish livestock farms

    DEFF Research Database (Denmark)

    Kristensen, Michael; Jespersen, Jørgen B


    BACKGROUND: Neonicotinoid baits are currently replacing anticholinesterase baits for control of adult houseflies (Musca domestica L.). Introduction of new insecticides includes evaluation of their cross-resistance potential, which was assessed for thiamethoxam in field populations from Denmark. R...

  7. Leishmania chagasi in Opossums (Didelphis albiventris) in an Urban Area Endemic for Visceral Leishmaniasis, Campo Grande, Mato Grosso do Sul, Brazil (United States)

    Humberg, Roberta M. P.; Oshiro, Elisa T.; Cruz, Maria do Socorro Pires e; Ribolla, Paulo E. M.; Alonso, Diego P.; Ferreira, Alda M. T.; Bonamigo, Raquel A.; Tasso, Norton; de Oliveira, Alessandra Gutierrez


    We investigated the occurrence of Leishmania infantum chagasi in Didelphis albiventris opossums at a wild animal rehabilitation center in the city of Campo Grande, Brazil. A total of 54 opossums were tested for L. i. chagasi infection in peripheral blood and bone marrow samples. The samples were analyzed by direct examination, culturing in a specific medium, and polymerase chain reaction–restriction fragment length polymorphism. Leishmania i. chagasi DNA was detected by polymerase chain reaction–restriction fragment length polymorphism in 11 (20.37%) animals. A total of 81.81% of positive opossums were captured in areas of known visceral leishmaniasis transmission. These results suggest a role for D. albiventris in the urban transmission of visceral leishmaniasis. PMID:22802435

  8. Prevalence of and risk factors associated with the presence of Sarcocystis neurona sporocysts in opossum (Didelphis virginiana) from Michigan: a retrospective study. (United States)

    Elsheikha, Hany M; Murphy, Alice J; Mansfield, Linda S


    From April 1996 to December 2002 the prevalence of Sarcocystis neurona sporocysts in North American opossum (Didelphis virginiana) in Southern Michigan was estimated. Sporocysts of S. neurona were found in intestinal scrapings from 31 (15%) of 206 examined opossum. The frequency of infection was higher in adult animals (26/206; 12.6%) and females (19/206; 9.2%) than in juveniles (5/206; 2.4%) and males (12/206; 5.8%). Also, prevalence of S. neurona sporocysts in opossums in relation to factors such as age, sex, season, body condition, presence of concomitant infection, and presence of young in the pouch of females was studied in detail over the course of the year, 2002. Univariate analyses identified the following factors as being associated with the presence of S. neurona sporocysts in opossums: (i) for age, adult (odd ratio [OR] = 2.074, P = 0.0005); (ii) for sex, female (OR = 7.016, P = 0.0119); (iii) for season, summer (OR = 7.917, P = 0.0032) and spring (OR = 4.071, P = 0.1063); (iv) for body condition, poor (OR = 3.50, P = 0.1200) and good (OR = 1.167, P = 0.8637); (v) for the presence of concomitant infection (OR = 23.056, P = 0001), and (vi) for the presence of young in the pouch of females (OR = 40.083, P = 0.0001). Multivariate logistic-regression analyses selected the following factors as being significantly associated with presence of S. neurona sporocysts in opossums: (i) for the presence of concomitant infection (OR = 8.722, P = 0.0160) and (ii) for the presence of young in the pouch of females (OR = 31.915, P = 0.0065). The prevalence of S. neurona sporocysts in D. virginiana suggests that this opossum may constitute an ample reservoir of infection to other animals in the northern United States.

  9. Mitochondrial phenotype of marsupial torpor: Fuel metabolic switch in the Chilean mouse-opossum Thylamys elegans. (United States)

    Cortés, Pablo Andres; Bacigalupe, Leonardo Daniel; Mondaca, Fredy; Desrosiers, Véronique; Blier, Pierre U


    Torpor is a phenotype characterized by a controlled decline of metabolic rate and body temperature. During arousal from torpor, organs undergo rapid metabolic reactivation and rewarming to near normal levels. As torpor progress, animals show a preference for fatty acids over glucose as primary source of energy. Here, we analyzed for first time the changes in the maximal activity of key enzymes related to fatty acid (Carnitine palmitoyltransferase and β-Hydroxyacyl CoA dehydrogenase) and carbohydrate (Pyruvate kinase, Phosphofructokinase and Lactate dehydrogenase) catabolism, as well as mitochondrial oxidative capacity (Citrate synthase), in six organs of torpid, arousing and euthermic Chilean mouse-opossums (Thylamys elegans). Our results showed that activity of enzymes related to fatty acid and carbohydrate catabolism were different among torpor phases and the pattern of variation differs among tissues. In terms of lipid utilization, maximal enzymatic activities differ in tissues with high oxidative capacity such as heart, kidney, and liver. In terms of carbohydrate use, lower enzymatic activities were observed during torpor in brain and liver. Interestingly, citrate synthase activity did not differ thought torpor-arousal cycle in any tissues analyzed, suggesting no modulation of mitochondrial content in T. elegans. Overall results provide an indication that modulation of enzymes associated with carbohydrate and fatty-acid pathways is mainly oriented to limit energy expensive processes and sustain energy metabolism during transition from torpor to euthermy. Future studies are required to elucidate if physiological events observed for T. elegans are unique from other marsupials, or represents a general response in marsupials. J. Exp. Zool. 325A:41-51, 2016. © 2015 Wiley Periodicals, Inc. © 2015 Wiley Periodicals, Inc.

  10. Análisis de los compuestos volátiles de la ciruela amarilla (Prunus domestica L. ssp. domestica

    Directory of Open Access Journals (Sweden)

    Yineth Ruiz


    Full Text Available El aroma de las frutas se debe a los constituyentes volátiles presentes que, aunque se encuentran en muy bajas concentraciones, contribuyen al aroma global en grados muy diversos. Se hace necesario usar técnicas de aislamiento y concentración que garanticen el análisis de una composición química semejante a la de la fruta. Este trabajo tuvo como objetivo el análisis de los compuestos volátiles de la ciruela amarilla (Prunus domestica L. ssp.domestica por el método de evaporación del aroma asistida por solvente (SAFE. Este método utiliza un equipo de destilación conectado a una bomba de alto vacío que ofrece la posibilidad de aislar rápidamente compuestos volátiles sin daño térmico en diferentes matrices alimentarias. La separación e identificación de los compuestos volátiles se realizó por cromatografía de gases-espectrometría de masas (GC-MS. Se identificaron 47 compuestos (6,55 mg/kg de pulpa de fruta, entre ellos 14 alcoholes, 8 aldehídos, 7 ésteres, 5 cetonas, 4 ácidos carboxílicos, 4 hidrocarburos aromáticos, 3 lactonas, un compuesto azufrado y una hidroxicetona; 16 de ellos se informan por primera vez. El acetato de etilo (2,88 mg/kg, etanol (1 mg/kg y ácido octanoico (0,78 mg/kg fueron los constituyentes volátiles mayoritarios de esta variedad de ciruela.

  11. Análisis de los compuestos volátiles de la ciruela amarilla (Prunus domestica L. ssp. domestica

    Directory of Open Access Journals (Sweden)

    Yineth Ruiz


    Full Text Available El aroma de las frutas se debe a los constituyentes volátiles presentes que, aunque se encuentran en muy bajas concentraciones, contribuyen al aroma global en grados muy diversos. Se hace necesario usar técnicas de aislamiento y concentración que garanticen el análisis de una composición química semejante a la de la fruta. Este trabajo tuvo como objetivo el análisis de los compuestos volátiles de la ciruela amarilla (Prunus domestica L. ssp. domestica por el método de evaporación del aroma asistida por solvente (SAFE. Este método utiliza un equipo de destilación conectado a una bomba de alto vacío que ofrece la posibilidad de aislar rápidamente compuestos volátiles sin daño térmico en diferentes matrices alimentarias. La separación e identificación de los compuestos volátiles se realizó por cromatografía de gases-espectrometría de masas (GC-MS. Se identificaron 47 compuestos (6,55 mg/kg de pulpa de fruta, entre ellos 14 alcoholes, 8 aldehídos, 7 ésteres, 5 cetonas, 4 ácidos carboxílicos, 4 hidrocarburos aromáticos, 3 lactonas, un compuesto azufrado y una hidroxicetona; 16 de ellos se informan por primera vez. El acetato de etilo (2,88 mg/kg, etanol (1 mg/kg y ácido octanoico (0,78 mg/kg fueron los constituyentes volátiles mayoritarios de esta variedad de ciruela.

  12. NCBI nr-aa BLAST: CBRC-MEUG-01-0170 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0170 ref|NP_001034951.1| bitter taste receptor Modo-T2R7A [Monodelphis... domestica] dbj|BAE80367.1| bitter taste receptor [Monodelphis domestica] NP_001034951.1 1e-106 67% ...

  13. NCBI nr-aa BLAST: CBRC-DNOV-01-0589 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0589 ref|YP_087188.1| NADH dehydrogenase subunit 4 [Monodelphis domest...ica] emb|CAD48209.2| NADH dehydrogenase subunit 4 [Monodelphis domestica] YP_087188.1 0.20 22% ...

  14. NCBI nr-aa BLAST: CBRC-MDOM-02-0501 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0501 ref|NP_001034947.1| bitter taste receptor Modo-T2R25 [Monodelphis... domestica] dbj|BAE80373.1| bitter taste receptor [Monodelphis domestica] NP_001034947.1 1e-174 100% ...

  15. NCBI nr-aa BLAST: CBRC-MDOM-02-0508 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0508 ref|NP_001034942.1| bitter taste receptor Modo-T2R21 [Monodelphis... domestica] dbj|BAE80369.1| bitter taste receptor [Monodelphis domestica] NP_001034942.1 5e-76 49% ...

  16. NCBI nr-aa BLAST: CBRC-ACAR-01-1168 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1168 ref|NP_001034943.1| bitter taste receptor Modo-T2R2 [Monodelphis ...domestica] dbj|BAE80359.1| bitter taste receptor [Monodelphis domestica] NP_001034943.1 4e-24 26% ...

  17. NCBI nr-aa BLAST: CBRC-ACAR-01-0502 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0502 ref|NP_001034951.1| bitter taste receptor Modo-T2R7A [Monodelphis... domestica] dbj|BAE80367.1| bitter taste receptor [Monodelphis domestica] NP_001034951.1 5e-26 29% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-1656 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1656 ref|NP_001034958.1| bitter taste receptor Modo-T2R7B [Monodelphis... domestica] dbj|BAE80368.1| bitter taste receptor [Monodelphis domestica] NP_001034958.1 2e-39 43% ...

  19. NCBI nr-aa BLAST: CBRC-ACAR-01-1170 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1170 ref|NP_001034951.1| bitter taste receptor Modo-T2R7A [Monodelphis... domestica] dbj|BAE80367.1| bitter taste receptor [Monodelphis domestica] NP_001034951.1 2e-26 26% ...

  20. NCBI nr-aa BLAST: CBRC-ACAR-01-0506 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0506 ref|NP_001034953.1| bitter taste receptor Modo-T2R29 [Monodelphis... domestica] dbj|BAE80377.1| bitter taste receptor [Monodelphis domestica] NP_001034953.1 9e-31 29% ...

  1. NCBI nr-aa BLAST: CBRC-MEUG-01-2684 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2684 ref|NP_001034954.1| bitter taste receptor Modo-T2R3A [Monodelphis... domestica] dbj|BAE80360.1| bitter taste receptor [Monodelphis domestica] NP_001034954.1 8e-98 61% ...

  2. NCBI nr-aa BLAST: CBRC-MEUG-01-2740 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2740 ref|NP_001034941.1| bitter taste receptor Modo-T2R62 [Monodelphis... domestica] dbj|BAE80383.1| bitter taste receptor [Monodelphis domestica] NP_001034941.1 2e-99 58% ...

  3. NCBI nr-aa BLAST: CBRC-MDOM-08-0131 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0131 ref|NP_001034948.1| bitter taste receptor Modo-T2R3D [Monodelphis... domestica] dbj|BAE80361.1| bitter taste receptor [Monodelphis domestica] NP_001034948.1 1e-113 67% ...

  4. NCBI nr-aa BLAST: CBRC-MEUG-01-0664 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0664 ref|NP_001034949.1| bitter taste receptor Modo-T2R28 [Monodelphis... domestica] dbj|BAE80376.1| bitter taste receptor [Monodelphis domestica] NP_001034949.1 2e-73 49% ...

  5. NCBI nr-aa BLAST: CBRC-MEUG-01-1767 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1767 ref|NP_001034946.1| bitter taste receptor Modo-T2R3H [Monodelphis... domestica] dbj|BAE80364.1| bitter taste receptor [Monodelphis domestica] NP_001034946.1 8e-66 47% ...

  6. NCBI nr-aa BLAST: CBRC-MDOM-02-0427 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0427 ref|NP_001034947.1| bitter taste receptor Modo-T2R25 [Monodelphis... domestica] dbj|BAE80373.1| bitter taste receptor [Monodelphis domestica] NP_001034947.1 7e-68 44% ...

  7. NCBI nr-aa BLAST: CBRC-XTRO-01-2798 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2798 ref|NP_001034955.1| bitter taste receptor Modo-T2R1 [Monodelphis ...domestica] dbj|BAE80358.1| bitter taste receptor [Monodelphis domestica] NP_001034955.1 3e-33 31% ...

  8. NCBI nr-aa BLAST: CBRC-MEUG-01-1844 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1844 ref|NP_001034942.1| bitter taste receptor Modo-T2R21 [Monodelphis... domestica] dbj|BAE80369.1| bitter taste receptor [Monodelphis domestica] NP_001034942.1 2e-57 41% ...

  9. NCBI nr-aa BLAST: CBRC-MDOM-08-0135 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0135 ref|NP_001034962.1| bitter taste receptor Modo-T2R38 [Monodelphis... domestica] dbj|BAE80378.1| bitter taste receptor [Monodelphis domestica] NP_001034962.1 1e-180 100% ...

  10. NCBI nr-aa BLAST: CBRC-XTRO-01-3308 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3308 ref|NP_001034951.1| bitter taste receptor Modo-T2R7A [Monodelphis... domestica] dbj|BAE80367.1| bitter taste receptor [Monodelphis domestica] NP_001034951.1 2e-26 28% ...

  11. NCBI nr-aa BLAST: CBRC-MEUG-01-1292 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1292 ref|NP_001034953.1| bitter taste receptor Modo-T2R29 [Monodelphis... domestica] dbj|BAE80377.1| bitter taste receptor [Monodelphis domestica] NP_001034953.1 3e-73 59% ...

  12. NCBI nr-aa BLAST: CBRC-ACAR-01-0561 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0561 ref|NP_001034963.1| bitter taste receptor Modo-T2R39 [Monodelphis... domestica] dbj|BAE80379.1| bitter taste receptor [Monodelphis domestica] NP_001034963.1 7e-33 34% ...

  13. NCBI nr-aa BLAST: CBRC-OANA-01-1137 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1137 ref|NP_001034941.1| bitter taste receptor Modo-T2R62 [Monodelphis... domestica] dbj|BAE80383.1| bitter taste receptor [Monodelphis domestica] NP_001034941.1 1e-49 37% ...

  14. NCBI nr-aa BLAST: CBRC-ACAR-01-0901 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0901 ref|NP_001034961.1| bitter taste receptor Modo-T2R40 [Monodelphis... domestica] dbj|BAE80380.1| bitter taste receptor [Monodelphis domestica] NP_001034961.1 5e-29 27% ...

  15. NCBI nr-aa BLAST: CBRC-ACAR-01-0133 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0133 ref|NP_001034948.1| bitter taste receptor Modo-T2R3D [Monodelphis... domestica] dbj|BAE80361.1| bitter taste receptor [Monodelphis domestica] NP_001034948.1 3e-23 28% ...

  16. NCBI nr-aa BLAST: CBRC-ACAR-01-0133 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0133 ref|NP_001034961.1| bitter taste receptor Modo-T2R40 [Monodelphis... domestica] dbj|BAE80380.1| bitter taste receptor [Monodelphis domestica] NP_001034961.1 4e-28 30% ...

  17. NCBI nr-aa BLAST: CBRC-BTAU-01-2945 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2945 ref|NP_001034951.1| bitter taste receptor Modo-T2R7A [Monodelphis... domestica] dbj|BAE80367.1| bitter taste receptor [Monodelphis domestica] NP_001034951.1 9e-57 42% ...

  18. NCBI nr-aa BLAST: CBRC-XTRO-01-3781 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3781 ref|NP_001034963.1| bitter taste receptor Modo-T2R39 [Monodelphis... domestica] dbj|BAE80379.1| bitter taste receptor [Monodelphis domestica] NP_001034963.1 2e-29 27% ...

  19. NCBI nr-aa BLAST: CBRC-ETEL-01-0714 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-0714 ref|NP_001034958.1| bitter taste receptor Modo-T2R7B [Monodelphis... domestica] dbj|BAE80368.1| bitter taste receptor [Monodelphis domestica] NP_001034958.1 4e-53 41% ...

  20. NCBI nr-aa BLAST: CBRC-MDOM-02-0509 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0509 ref|NP_001034949.1| bitter taste receptor Modo-T2R28 [Monodelphis... domestica] dbj|BAE80376.1| bitter taste receptor [Monodelphis domestica] NP_001034949.1 2e-66 45% ...

  1. NCBI nr-aa BLAST: CBRC-MDOM-08-0133 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0133 ref|NP_001034960.1| bitter taste receptor Modo-T2R3F [Monodelphis... domestica] dbj|BAE80362.1| bitter taste receptor [Monodelphis domestica] NP_001034960.1 1e-117 70% ...

  2. NCBI nr-aa BLAST: CBRC-MEUG-01-2478 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2478 ref|NP_001034950.1| bitter taste receptor Modo-T2R24 [Monodelphis... domestica] dbj|BAE80372.1| bitter taste receptor [Monodelphis domestica] NP_001034950.1 8e-69 47% ...

  3. NCBI nr-aa BLAST: CBRC-MEUG-01-1844 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1844 ref|NP_001034964.1| bitter taste receptor Modo-T2R23 [Monodelphis... domestica] dbj|BAE80371.1| bitter taste receptor [Monodelphis domestica] NP_001034964.1 1e-102 58% ...

  4. NCBI nr-aa BLAST: CBRC-XTRO-01-3331 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3331 ref|NP_001034963.1| bitter taste receptor Modo-T2R39 [Monodelphis... domestica] dbj|BAE80379.1| bitter taste receptor [Monodelphis domestica] NP_001034963.1 1e-25 30% ...

  5. NCBI nr-aa BLAST: CBRC-MEUG-01-2325 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2325 ref|NP_001034948.1| bitter taste receptor Modo-T2R3D [Monodelphis... domestica] dbj|BAE80361.1| bitter taste receptor [Monodelphis domestica] NP_001034948.1 3e-36 49% ...

  6. NCBI nr-aa BLAST: CBRC-MDOM-08-0152 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0152 ref|NP_001034959.1| bitter taste receptor Modo-T2R41 [Monodelphis... domestica] dbj|BAE80381.1| bitter taste receptor [Monodelphis domestica] NP_001034959.1 0.0 100% ...

  7. NCBI nr-aa BLAST: CBRC-TGUT-05-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-05-0050 ref|NP_001034963.1| bitter taste receptor Modo-T2R39 [Monodelphis... domestica] dbj|BAE80379.1| bitter taste receptor [Monodelphis domestica] NP_001034963.1 5e-31 28% ...

  8. NCBI nr-aa BLAST: CBRC-PCAP-01-0207 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0207 ref|NP_001034962.1| bitter taste receptor Modo-T2R38 [Monodelphis... domestica] dbj|BAE80378.1| bitter taste receptor [Monodelphis domestica] NP_001034962.1 0.25 30% ...

  9. NCBI nr-aa BLAST: CBRC-OANA-01-1413 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1413 ref|NP_001034941.1| bitter taste receptor Modo-T2R62 [Monodelphis... domestica] dbj|BAE80383.1| bitter taste receptor [Monodelphis domestica] NP_001034941.1 1e-22 30% ...

  10. NCBI nr-aa BLAST: CBRC-XTRO-01-3346 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3346 ref|NP_001034955.1| bitter taste receptor Modo-T2R1 [Monodelphis ...domestica] dbj|BAE80358.1| bitter taste receptor [Monodelphis domestica] NP_001034955.1 4e-20 30% ...

  11. NCBI nr-aa BLAST: CBRC-ACAR-01-1177 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1177 ref|NP_001034961.1| bitter taste receptor Modo-T2R40 [Monodelphis... domestica] dbj|BAE80380.1| bitter taste receptor [Monodelphis domestica] NP_001034961.1 5e-13 27% ...

  12. NCBI nr-aa BLAST: CBRC-MEUG-01-1592 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1592 ref|NP_001034942.1| bitter taste receptor Modo-T2R21 [Monodelphis... domestica] dbj|BAE80369.1| bitter taste receptor [Monodelphis domestica] NP_001034942.1 2e-90 55% ...

  13. NCBI nr-aa BLAST: CBRC-ACAR-01-0502 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0502 ref|NP_001034958.1| bitter taste receptor Modo-T2R7B [Monodelphis... domestica] dbj|BAE80368.1| bitter taste receptor [Monodelphis domestica] NP_001034958.1 2e-22 28% ...

  14. NCBI nr-aa BLAST: CBRC-ACAR-01-1170 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1170 ref|NP_001034961.1| bitter taste receptor Modo-T2R40 [Monodelphis... domestica] dbj|BAE80380.1| bitter taste receptor [Monodelphis domestica] NP_001034961.1 9e-25 29% ...

  15. NCBI nr-aa BLAST: CBRC-XTRO-01-3278 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3278 ref|NP_001034963.1| bitter taste receptor Modo-T2R39 [Monodelphis... domestica] dbj|BAE80379.1| bitter taste receptor [Monodelphis domestica] NP_001034963.1 3e-20 25% ...

  16. NCBI nr-aa BLAST: CBRC-PVAM-01-0869 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0869 ref|NP_001034957.1| bitter taste receptor Modo-T2R27 [Monodelphis... domestica] dbj|BAE80375.1| bitter taste receptor [Monodelphis domestica] NP_001034957.1 5e-19 33% ...

  17. NCBI nr-aa BLAST: CBRC-MEUG-01-0664 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0664 ref|NP_001034942.1| bitter taste receptor Modo-T2R21 [Monodelphis... domestica] dbj|BAE80369.1| bitter taste receptor [Monodelphis domestica] NP_001034942.1 1e-74 49% ...

  18. NCBI nr-aa BLAST: CBRC-MEUG-01-1220 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1220 ref|NP_001034959.1| bitter taste receptor Modo-T2R41 [Monodelphis... domestica] dbj|BAE80381.1| bitter taste receptor [Monodelphis domestica] NP_001034959.1 2e-49 43% ...

  19. NCBI nr-aa BLAST: CBRC-MEUG-01-1832 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1832 ref|NP_001034947.1| bitter taste receptor Modo-T2R25 [Monodelphis... domestica] dbj|BAE80373.1| bitter taste receptor [Monodelphis domestica] NP_001034947.1 2e-38 36% ...

  20. NCBI nr-aa BLAST: CBRC-MDOM-08-0132 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0132 ref|NP_001034946.1| bitter taste receptor Modo-T2R3H [Monodelphis... domestica] dbj|BAE80364.1| bitter taste receptor [Monodelphis domestica] NP_001034946.1 1e-115 69% ...

  1. NCBI nr-aa BLAST: CBRC-MEUG-01-1232 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1232 ref|NP_001034940.1| bitter taste receptor Modo-T2R26 [Monodelphis... domestica] dbj|BAE80374.1| bitter taste receptor [Monodelphis domestica] NP_001034940.1 1e-107 65% ...

  2. NCBI nr-aa BLAST: CBRC-MDOM-02-0510 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0510 ref|NP_001034940.1| bitter taste receptor Modo-T2R26 [Monodelphis... domestica] dbj|BAE80374.1| bitter taste receptor [Monodelphis domestica] NP_001034940.1 3e-71 47% ...

  3. NCBI nr-aa BLAST: CBRC-MEUG-01-1292 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1292 ref|NP_001034947.1| bitter taste receptor Modo-T2R25 [Monodelphis... domestica] dbj|BAE80373.1| bitter taste receptor [Monodelphis domestica] NP_001034947.1 5e-59 44% ...

  4. NCBI nr-aa BLAST: CBRC-ACAR-01-0502 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0502 ref|NP_001034961.1| bitter taste receptor Modo-T2R40 [Monodelphis... domestica] dbj|BAE80380.1| bitter taste receptor [Monodelphis domestica] NP_001034961.1 1e-22 26% ...

  5. NCBI nr-aa BLAST: CBRC-MDOM-02-0504 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0504 ref|NP_001034964.1| bitter taste receptor Modo-T2R23 [Monodelphis... domestica] dbj|BAE80371.1| bitter taste receptor [Monodelphis domestica] NP_001034964.1 2e-69 45% ...

  6. NCBI nr-aa BLAST: CBRC-ACAR-01-0937 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0937 ref|NP_001034963.1| bitter taste receptor Modo-T2R39 [Monodelphis... domestica] dbj|BAE80379.1| bitter taste receptor [Monodelphis domestica] NP_001034963.1 6e-31 30% ...

  7. NCBI nr-aa BLAST: CBRC-MEUG-01-1195 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1195 ref|NP_001034964.1| bitter taste receptor Modo-T2R23 [Monodelphis... domestica] dbj|BAE80371.1| bitter taste receptor [Monodelphis domestica] NP_001034964.1 1e-91 56% ...

  8. NCBI nr-aa BLAST: CBRC-MEUG-01-1789 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1789 ref|NP_001034948.1| bitter taste receptor Modo-T2R3D [Monodelphis... domestica] dbj|BAE80361.1| bitter taste receptor [Monodelphis domestica] NP_001034948.1 7e-53 41% ...

  9. NCBI nr-aa BLAST: CBRC-MEUG-01-2514 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2514 ref|NP_001034946.1| bitter taste receptor Modo-T2R3H [Monodelphis... domestica] dbj|BAE80364.1| bitter taste receptor [Monodelphis domestica] NP_001034946.1 1e-60 44% ...

  10. NCBI nr-aa BLAST: CBRC-ACAR-01-0567 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0567 ref|NP_001034951.1| bitter taste receptor Modo-T2R7A [Monodelphis... domestica] dbj|BAE80367.1| bitter taste receptor [Monodelphis domestica] NP_001034951.1 1e-29 29% ...

  11. NCBI nr-aa BLAST: CBRC-MDOM-02-0502 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0502 ref|NP_001034953.1| bitter taste receptor Modo-T2R29 [Monodelphis... domestica] dbj|BAE80377.1| bitter taste receptor [Monodelphis domestica] NP_001034953.1 2e-74 47% ...

  12. NCBI nr-aa BLAST: CBRC-ACAR-01-0925 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0925 ref|NP_001034959.1| bitter taste receptor Modo-T2R41 [Monodelphis... domestica] dbj|BAE80381.1| bitter taste receptor [Monodelphis domestica] NP_001034959.1 4e-32 30% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1755 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1755 ref|NP_001034947.1| bitter taste receptor Modo-T2R25 [Monodelphis... domestica] dbj|BAE80373.1| bitter taste receptor [Monodelphis domestica] NP_001034947.1 1e-40 35% ...

  14. NCBI nr-aa BLAST: CBRC-MEUG-01-0960 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0960 ref|NP_001034942.1| bitter taste receptor Modo-T2R21 [Monodelphis... domestica] dbj|BAE80369.1| bitter taste receptor [Monodelphis domestica] NP_001034942.1 2e-71 47% ...

  15. NCBI nr-aa BLAST: CBRC-LAFR-01-1517 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-1517 ref|NP_001034951.1| bitter taste receptor Modo-T2R7A [Monodelphis... domestica] dbj|BAE80367.1| bitter taste receptor [Monodelphis domestica] NP_001034951.1 5e-18 27% ...

  16. NCBI nr-aa BLAST: CBRC-MEUG-01-1711 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1711 ref|NP_001034940.1| bitter taste receptor Modo-T2R26 [Monodelphis... domestica] dbj|BAE80374.1| bitter taste receptor [Monodelphis domestica] NP_001034940.1 4e-83 56% ...

  17. NCBI nr-aa BLAST: CBRC-MEUG-01-1292 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1292 ref|NP_001034951.1| bitter taste receptor Modo-T2R7A [Monodelphis... domestica] dbj|BAE80367.1| bitter taste receptor [Monodelphis domestica] NP_001034951.1 1e-48 44% ...

  18. NCBI nr-aa BLAST: CBRC-MEUG-01-0960 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0960 ref|NP_001034940.1| bitter taste receptor Modo-T2R26 [Monodelphis... domestica] dbj|BAE80374.1| bitter taste receptor [Monodelphis domestica] NP_001034940.1 1e-103 64% ...

  19. NCBI nr-aa BLAST: CBRC-SARA-01-0389 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0389 ref|NP_001034959.1| bitter taste receptor Modo-T2R41 [Monodelphis... domestica] dbj|BAE80381.1| bitter taste receptor [Monodelphis domestica] NP_001034959.1 1e-101 60% ...

  20. NCBI nr-aa BLAST: CBRC-MEUG-01-1574 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1574 ref|NP_001034959.1| bitter taste receptor Modo-T2R41 [Monodelphis... domestica] dbj|BAE80381.1| bitter taste receptor [Monodelphis domestica] NP_001034959.1 3e-64 43% ...

  1. NCBI nr-aa BLAST: CBRC-MEUG-01-1592 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1592 ref|NP_001034952.1| bitter taste receptor Modo-T2R22 [Monodelphis... domestica] dbj|BAE80370.1| bitter taste receptor [Monodelphis domestica] NP_001034952.1 1e-101 60% ...

  2. NCBI nr-aa BLAST: CBRC-MEUG-01-1411 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1411 ref|NP_001034948.1| bitter taste receptor Modo-T2R3D [Monodelphis... domestica] dbj|BAE80361.1| bitter taste receptor [Monodelphis domestica] NP_001034948.1 1e-64 45% ...

  3. NCBI nr-aa BLAST: CBRC-ACAR-01-1176 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1176 ref|NP_001034959.1| bitter taste receptor Modo-T2R41 [Monodelphis... domestica] dbj|BAE80381.1| bitter taste receptor [Monodelphis domestica] NP_001034959.1 5e-25 26% ...

  4. NCBI nr-aa BLAST: CBRC-ACAR-01-0914 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0914 ref|NP_001034961.1| bitter taste receptor Modo-T2R40 [Monodelphis... domestica] dbj|BAE80380.1| bitter taste receptor [Monodelphis domestica] NP_001034961.1 6e-36 32% ...

  5. NCBI nr-aa BLAST: CBRC-XTRO-01-0351 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0351 ref|NP_001034961.1| bitter taste receptor Modo-T2R40 [Monodelphis... domestica] dbj|BAE80380.1| bitter taste receptor [Monodelphis domestica] NP_001034961.1 2e-31 31% ...

  6. NCBI nr-aa BLAST: CBRC-MEUG-01-2478 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2478 ref|NP_001034947.1| bitter taste receptor Modo-T2R25 [Monodelphis... domestica] dbj|BAE80373.1| bitter taste receptor [Monodelphis domestica] NP_001034947.1 1e-65 45% ...

  7. NCBI nr-aa BLAST: CBRC-ACAR-01-0921 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0921 ref|NP_001034961.1| bitter taste receptor Modo-T2R40 [Monodelphis... domestica] dbj|BAE80380.1| bitter taste receptor [Monodelphis domestica] NP_001034961.1 8e-37 31% ...

  8. NCBI nr-aa BLAST: CBRC-MEUG-01-1195 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1195 ref|NP_001034953.1| bitter taste receptor Modo-T2R29 [Monodelphis... domestica] dbj|BAE80377.1| bitter taste receptor [Monodelphis domestica] NP_001034953.1 8e-88 60% ...

  9. NCBI nr-aa BLAST: CBRC-MDOM-07-0043 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-07-0043 ref|NP_001034951.1| bitter taste receptor Modo-T2R7A [Monodelphis... domestica] dbj|BAE80367.1| bitter taste receptor [Monodelphis domestica] NP_001034951.1 1e-176 100% ...

  10. NCBI nr-aa BLAST: CBRC-MDOM-08-0130 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0130 ref|NP_001034946.1| bitter taste receptor Modo-T2R3H [Monodelphis... domestica] dbj|BAE80364.1| bitter taste receptor [Monodelphis domestica] NP_001034946.1 1e-140 83% ...

  11. NCBI nr-aa BLAST: CBRC-XTRO-01-2390 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2390 ref|NP_001034963.1| bitter taste receptor Modo-T2R39 [Monodelphis... domestica] dbj|BAE80379.1| bitter taste receptor [Monodelphis domestica] NP_001034963.1 1e-29 32% ...

  12. NCBI nr-aa BLAST: CBRC-MDOM-03-0040 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-03-0040 ref|NP_001034955.1| bitter taste receptor Modo-T2R1 [Monodelphis ...domestica] dbj|BAE80358.1| bitter taste receptor [Monodelphis domestica] NP_001034955.1 1e-178 100% ...

  13. NCBI nr-aa BLAST: CBRC-MEUG-01-2478 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2478 ref|NP_001034951.1| bitter taste receptor Modo-T2R7A [Monodelphis... domestica] dbj|BAE80367.1| bitter taste receptor [Monodelphis domestica] NP_001034951.1 9e-60 45% ...

  14. NCBI nr-aa BLAST: CBRC-MDOM-02-0506 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0506 ref|NP_001034957.1| bitter taste receptor Modo-T2R27 [Monodelphis... domestica] dbj|BAE80375.1| bitter taste receptor [Monodelphis domestica] NP_001034957.1 2e-77 49% ...

  15. NCBI nr-aa BLAST: CBRC-OANA-01-1786 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1786 ref|NP_001034955.1| bitter taste receptor Modo-T2R1 [Monodelphis ...domestica] dbj|BAE80358.1| bitter taste receptor [Monodelphis domestica] NP_001034955.1 9e-46 37% ...

  16. NCBI nr-aa BLAST: CBRC-MDOM-02-0502 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0502 ref|NP_001034958.1| bitter taste receptor Modo-T2R7B [Monodelphis... domestica] dbj|BAE80368.1| bitter taste receptor [Monodelphis domestica] NP_001034958.1 8e-66 42% ...

  17. NCBI nr-aa BLAST: CBRC-ACAR-01-0937 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0937 ref|NP_001034951.1| bitter taste receptor Modo-T2R7A [Monodelphis... domestica] dbj|BAE80367.1| bitter taste receptor [Monodelphis domestica] NP_001034951.1 2e-35 30% ...

  18. NCBI nr-aa BLAST: CBRC-XTRO-01-2417 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2417 ref|NP_001034961.1| bitter taste receptor Modo-T2R40 [Monodelphis... domestica] dbj|BAE80380.1| bitter taste receptor [Monodelphis domestica] NP_001034961.1 3e-32 33% ...

  19. NCBI nr-aa BLAST: CBRC-MDOM-02-0506 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0506 ref|NP_001034964.1| bitter taste receptor Modo-T2R23 [Monodelphis... domestica] dbj|BAE80371.1| bitter taste receptor [Monodelphis domestica] NP_001034964.1 2e-60 42% ...

  20. NCBI nr-aa BLAST: CBRC-MEUG-01-1669 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1669 ref|NP_001034956.1| bitter taste receptor Modo-T2R3J [Monodelphis... domestica] dbj|BAE80365.1| bitter taste receptor [Monodelphis domestica] NP_001034956.1 4e-80 52% ...

  1. NCBI nr-aa BLAST: CBRC-ACAR-01-0942 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0942 ref|NP_001034961.1| bitter taste receptor Modo-T2R40 [Monodelphis... domestica] dbj|BAE80380.1| bitter taste receptor [Monodelphis domestica] NP_001034961.1 9e-36 30% ...

  2. NCBI nr-aa BLAST: CBRC-MEUG-01-2684 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2684 ref|NP_001034948.1| bitter taste receptor Modo-T2R3D [Monodelphis... domestica] dbj|BAE80361.1| bitter taste receptor [Monodelphis domestica] NP_001034948.1 4e-64 45% ...

  3. NCBI nr-aa BLAST: CBRC-MDOM-02-0503 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0503 ref|NP_001034947.1| bitter taste receptor Modo-T2R25 [Monodelphis... domestica] dbj|BAE80373.1| bitter taste receptor [Monodelphis domestica] NP_001034947.1 8e-72 47% ...

  4. NCBI nr-aa BLAST: CBRC-ACAR-01-0942 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0942 ref|NP_001034958.1| bitter taste receptor Modo-T2R7B [Monodelphis... domestica] dbj|BAE80368.1| bitter taste receptor [Monodelphis domestica] NP_001034958.1 3e-33 31% ...

  5. NCBI nr-aa BLAST: CBRC-MDOM-02-0508 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0508 ref|NP_001034957.1| bitter taste receptor Modo-T2R27 [Monodelphis... domestica] dbj|BAE80375.1| bitter taste receptor [Monodelphis domestica] NP_001034957.1 3e-78 49% ...

  6. NCBI nr-aa BLAST: CBRC-DRER-09-0044 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-09-0044 ref|NP_001034953.1| bitter taste receptor Modo-T2R29 [Monodelphis... domestica] dbj|BAE80377.1| bitter taste receptor [Monodelphis domestica] NP_001034953.1 6e-06 23% ...

  7. NCBI nr-aa BLAST: CBRC-ACAR-01-0564 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0564 ref|NP_001034951.1| bitter taste receptor Modo-T2R7A [Monodelphis... domestica] dbj|BAE80367.1| bitter taste receptor [Monodelphis domestica] NP_001034951.1 4e-36 31% ...

  8. NCBI nr-aa BLAST: CBRC-MEUG-01-1551 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1551 ref|NP_001138553.1| opsin 1 (cone pigments), long-wave-sensitive ...[Monodelphis domestica] gb|ABC75816.1| long-wave sensitive opsin [Monodelphis domestica] NP_001138553.1 0.0 92% ...

  9. NCBI nr-aa BLAST: CBRC-MEUG-01-2797 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2797 ref|NP_001138556.1| opsin 1 (cone pigments), short-wave-sensitive... [Monodelphis domestica] gb|ABC75818.1| short-wave sensitive type 1 opsin [Monodelphis domestica] NP_001138556.1 0.0 94% ...

  10. NCBI nr-aa BLAST: CBRC-MDOM-08-0120 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0120 ref|NP_001138556.1| opsin 1 (cone pigments), short-wave-sensitive... [Monodelphis domestica] gb|ABC75818.1| short-wave sensitive type 1 opsin [Monodelphis domestica] NP_001138556.1 0.0 98% ...

  11. NCBI nr-aa BLAST: CBRC-MDOM-09-0015 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-09-0015 ref|NP_001138553.1| opsin 1 (cone pigments), long-wave-sensitive ...[Monodelphis domestica] gb|ABC75816.1| long-wave sensitive opsin [Monodelphis domestica] NP_001138553.1 0.0 98% ...

  12. Phylogenetic evaluation of taxonomic definition of didelphid mouse opossum of the genus Thylamys from valleys of Coquimbo region, Chile. (United States)

    Boric-Bargetto, Dusan; Zúñiga-Reinoso, Álvaro; Cancino, Ricardo A; González-Acuña, Daniel; Rodríguez-Serrano, Enrique; Palma, R Eduardo; Hernández, Cristián E


    Only two species of Didelphidae are currently recognized in Chile, the sister species Thylamys elegans, endemic of Mediterranean ecorregion and Thylamys pallidior, the inhabitant of the Puna and desert canyons. Three subspecies have been described for T. elegans: T. e. elegans, T. e. coquimbensis and T. e. soricinus. However, a recent study based on morphological analyses, synonymized T. elegans coquimbensis from the Coquimbo valleys (30-31° S) with T. pallidior and proposed that T. elegans and T. pallidior could be in sympatry at Coquimbo valleys between Fray Jorge (30°40'S) and Paiguano (30°02' S). We assess the current definition of T. e. coquimbensis and T. e. elegans, as well as this taxonomical conflict among the mouse opossums from the Coquimbo valleys through phylogenetic analyses of cytochrome b mitochondrial gene sequences. In this study, for the first time, we used specimens from the type localities of T. e. coquimbensis and T. e. elegans. In addition, we analyzed diagnostic cranial structures for this taxonomic revision. The results supported two allopatric clades, allowing us to keep the taxonomic definition of T. e. elegans and T. e. coquimbensis as phylogenetic reciprocal monophyletic clades and polyphyletic with T. pallidior. This result corroborates previous morphological analyses, which support that mouse opossums from the Coquimbo valleys are T. e. coquimbensis, thus extending its geographic distribution to the coast of Coquimbo and Atacama regions. We don´t have evidence for sympatric distribution between T. elegans and T. pallidior in the Coquimbo region.

  13. Endogenous Life Cycle of Eimeria marmosopos (Apicomplexa: Eimeriidae) from the Opossum, Didelphis marsupialis (Didelphimorphia: Didelphidae) in Costa Rica. (United States)

    Chinchilla, Misael; Valerio, Idalia; Duszynski, Donald


    The endogenous life cycle of Eimeria marmosopos was studied in experimentally infected young opossums, Didelphis marsupialis . All the endogenous stages were located in the epithelial cells of villi in the small intestine. Giemsa-stained mucosal scrapings and histological sections were studied for the diagnosis of all the life cycle stages. Eimeria marmosopos has 3 generations of meronts (M) that differ by size, shape, and number of merozoites (m), which also differ in their size, shape, and location of their nuclei within the cytoplasm of the meronts. The 3 meront types, M(1)-M(3), respectively, had 8-15 (m(1)), 4-9 (m(2)), and 22-30 (m(3)) merozoites. Macrogametocytes and microgametocytes, as well as macrogametes and microgametes, completed the sexual cycle, finishing with the formation of unsporulated oocysts. This parasite's endogenous development produced severe intestinal lesions in experimentally infected opossums. There are 56 Eimeria species known from all marsupials worldwide, but this is the first complete life cycle in which both the asexual and sexual stages have been documented.

  14. Musca domestica Salivary Gland Hypertrophy Virus, a Globally Distributed Insect Virus that Infects and Sterilizes Female Houseflies (United States)

    The house fly, Musca domestica, is a cosmopolitan pest of livestock and poultry that is of economic, veterinary, and public health importance. Populations of M. domestica are naturally infected with salivary gland hypertrophy virus (MdSGHV), a non-occluded dsDNA virus that inhibits egg production in...

  15. Duplication in the Domestica Apple Collection within the USDA-ARS National Plant Germplasm System in Geneva, New York (United States)

    The USDA-ARS National Plant Germplasm System maintains more than 1300 named accessions of Malus x domestica in a field collection in Geneva, NY. Seven microsatellite markers (GD12, GD15, GD96, GD103, GD142, GD147, GD162) were used to identify duplicates within a set of 1240 domestica accessions with...

  16. Sarcocystis neurona infections in raccoons (Procyon lotor): evidence for natural infection with sarcocysts, transmission of infection to opossums (Didelphis virginiana), and experimental induction of neurologic disease in raccoons. (United States)

    Dubey, J P; Saville, W J; Stanek, J F; Lindsay, D S; Rosenthal, B M; Oglesbee, M J; Rosypal, A C; Njoku, C J; Stich, R W; Kwok, O C; Shen, S K; Hamir, A N; Reed, S M


    Equine protozoal myeloencephalitis (EPM) is a serious neurologic disease of horses in the Americas and Sarcocystis neurona is the most common etiologic agent. The distribution of S. neurona infections follows the geographical distributions of its definitive hosts, opossums (Didelphis virginiana, Didelphis albiventris). Recently, cats and skunks were reported as experimental and armadillos as natural intermediate hosts of S. neurona. In the present report, raccoons (Procyon lotor) were identified as a natural intermediate host of S. neurona. Two laboratory-raised opossums were found to shed S. neurona-like sporocysts after ingesting tongues of naturally-infected raccoons. Interferon-gamma gene knockout (KO) mice fed raccoon-opossum-derived sporocysts developed neurologic signs. S. neurona was identified immunohistochemically in tissues of KO mice fed sporocysts and the parasite was isolated in cell cultures inoculated with infected KO mouse tissues. The DNA obtained from the tongue of a naturally-infected raccoon, brains of KO mice that had neurological signs, and from the organisms recovered in cell cultures inoculated with brains of neurologic KO mice, corresponded to that of S. neurona. Two raccoons fed mature S. neurona sarcocysts did not shed sporocysts in their feces, indicating raccoons are not likely to be its definitive host. Two raccoons fed sporocysts from opossum feces developed clinical illness and S. neurona-associated encephalomyelitis was found in raccoons killed 14 and 22 days after feeding sporocysts; schizonts and merozoites were seen in encephalitic lesions.

  17. Prevalence of antibodies to Trypanosoma cruzi, Toxoplasma gondii, Encephalitozoon cuniculi, Sarcocystis neurona, Besnoitia darlingi, and Neospora caninum in North American opossums, Didelphis virginiana, from southern Louisiana. (United States)

    Houk, Alice E; Goodwin, David G; Zajac, Anne M; Barr, Stephen C; Dubey, J P; Lindsay, David S


    We examined the prevalence of antibodies to zoonotic protozoan parasites ( Trypanosoma cruzi, Toxoplasma gondii, and Encephalitozoon cuniculi) and protozoans of veterinary importance ( Neospora caninum, Sarcocystis neurona, and Besnoitia darlingi) in a population of North American opossums ( Didelphis virginiana) from Louisiana. Samples from 30 opossums were collected as part of a survey for T. cruzi in Louisiana. Frozen sera from these 30 opossums were examined using an indirect immunofluorescent antibody test (IFAT) against in vitro-produced antigenic stages of these protozoans. Additionally, 24 of the 30 samples were examined using hemoculture, and all 30 were examined in the modified direct agglutination test (MAT) for antibodies to To. gondii. The prevalences of reactive IFAT samples were as follows: 60% for T. cruzi, 27% for To. gondii, 23% for E. cuniculi, 17% for S. neurona, 47% for B. darlingi, and 0% for N. caninum. Hemoculture revealed that 16 (67%) of 24 samples were positive for T. cruzi, compared to 18 of 30 (60%) by IFAT. The sensitivity and specificity for the IFAT compared to hemoculture was 100% for each. The modified direct agglutination test revealed that 9 (30%) of the 30 samples from opossums had antibodies to To. gondii , compared to 8 (27%) using the IFAT. The sensitivity and specificity of the IFAT compared to the MAT was 100% and 72%, respectively.

  18. Reconstructing an ancestral mammalian immune supercomplex from a marsupial major histocompatibility complex.

    Directory of Open Access Journals (Sweden)

    Katherine Belov


    Full Text Available The first sequenced marsupial genome promises to reveal unparalleled insights into mammalian evolution. We have used the Monodelphis domestica (gray short-tailed opossum sequence to construct the first map of a marsupial major histocompatibility complex (MHC. The MHC is the most gene-dense region of the mammalian genome and is critical to immunity and reproductive success. The marsupial MHC bridges the phylogenetic gap between the complex MHC of eutherian mammals and the minimal essential MHC of birds. Here we show that the opossum MHC is gene dense and complex, as in humans, but shares more organizational features with non-mammals. The Class I genes have amplified within the Class II region, resulting in a unique Class I/II region. We present a model of the organization of the MHC in ancestral mammals and its elaboration during mammalian evolution. The opossum genome, together with other extant genomes, reveals the existence of an ancestral "immune supercomplex" that contained genes of both types of natural killer receptors together with antigen processing genes and MHC genes.

  19. Phylogenetic relationships of Sarcocystis neurona of horses and opossums to other cyst-forming coccidia deduced from SSU rRNA gene sequences. (United States)

    Elsheikha, Hany M; Lacher, David W; Mansfield, Linda S


    Phylogenetic analyses based on sequences of the nuclear-encoded small subunit rRNA (ssurRNA) gene were performed to examine the origin, phylogeny, and biogeographic relationships of Sarcocystis neurona isolates from opossums and horses from the State of Michigan, USA, in relation to other cyst-forming coccidia. A total of 31 taxa representing all recognized subfamilies and genera of Sarcocystidae were included in the analyses with clonal isolates of two opossum and two horse S. neurona. Phylogenies obtained by the four tree-building methods were consistent with the classical taxonomy based on morphological criteria. The "isosporid" coccidia Neospora, Toxoplasma, Besnoitia, Isospora lacking stieda bodies, and Hyaloklossia formed a sister group to the Sarcocystis spp. Sarcocystis species were divided into three main lineages; S. neurona isolates were located in the second lineage and clustered with S. mucosa, S. dispersa, S. lacertae, S. rodentifelis, S. muris, and Frenkelia spp. Alignment of S. neurona SSU rRNA gene sequences of Michigan opossum isolates (MIOP5, MIOP20) and a S. neurona Michigan horse isolate (MIH8) showed 100% identity. These Michigan isolates differed in 2/1085 bp (0.2%) from a Kentucky S. neurona horse isolate (SN5). Additionally, S. neurona isolates from horses and opossums were identical based on the ultrastructural features and PCR-RFLP analyses thus forming a phylogenetically indistinct group in these regions. These findings revealed the concordance between the morphological and molecular data and confirmed that S. neurona from opossums and horses originated from the same phylogenetic origin.

  20. Musca domestica inspired machine vision system with hyperacuity (United States)

    Riley, Dylan T.; Harman, William M.; Tomberlin, Eric; Barrett, Steven F.; Wilcox, Michael; Wright, Cameron H. G.


    Musca domestica, the common house fly, has a simple yet powerful and accessible vision system. Cajal indicated in 1885 the fly's vision system is the same as in the human retina. The house fly has some intriguing vision system features such as fast, analog, parallel operation. Furthermore, it has the ability to detect movement and objects at far better resolution than predicted by photoreceptor spacing, termed hyperacuity. We are investigating the mechanisms behind these features and incorporating them into next generation vision systems. We have developed a prototype sensor that employs a fly inspired arrangement of photodetectors sharing a common lens. The Gaussian shaped acceptance profile of each sensor coupled with overlapped sensor field of views provide the necessary configuration for obtaining hyperacuity data. The sensor is able to detect object movement with far greater resolution than that predicted by photoreceptor spacing. We have exhaustively tested and characterized the sensor to determine its practical resolution limit. Our tests coupled with theory from Bucklew and Saleh (1985) indicate that the limit to the hyperacuity response may only be related to target contrast. We have also implemented an array of these prototype sensors which will allow for two - dimensional position location. These high resolution, low contrast capable sensors are being developed for use as a vision system for an autonomous robot and the next generation of smart wheel chairs. However, they are easily adapted for biological endoscopy, downhole monitoring in oil wells, and other applications.

  1. Protein Changes during the Stratification of Malus domestica Borkh. Seed. (United States)

    Eichholtz, D A; Robitaille, H A; Herrmann, K M


    Apple seeds (Malus domestica Borkh. cv Golden Delicious) were stratified at 5 and 15 degrees C for various lengths, weighed, and soluble protein of axis and cotyledon tissue was analyzed by sodium dodecyl sulfate-polyacrylamide gel electrophoresis. Only seeds treated at 5 degrees C germinated; seeds treated at 15 degrees C did not germinate. Optimal germination required 63 days of stratification. Excised embryos required less stratification time for germination than intact seeds. When stratification was less than 35 days, the resulting seedlings from 5 degrees C stratified embryos were dwarfed and epinastic. After 63 days of stratification, axes from 5 and 15 degrees C treated intact seeds had increased in fresh weight by 72 and 28% (w/w), respectively. The dry weights of the axes did not change significantly and both fresh and dry weights of cotyledons remained unchanged during stratification. Total soluble protein in axes and cotyledons changed very little during stratification. However, axis polypeptide profiles changed. Most obvious was the occurrence of a new polypeptide and the increase of four other clearly identifiable polypeptides during 5 degrees C treatment. The levels of the five most predominant axis proteins decreased at the same time. We observed no changes in the profiles of soluble cotyledon proteins. Control seeds kept at -10 degrees C showed none of the reported changes.

  2. Screening of solvent dependent antibacterial activity of Prunus domestica. (United States)

    Yaqeen, Zahra; Naqvi, Naim-ul-Hasan; Sohail, Tehmina; Rehman, Zakir-ur; Fatima, Nudrat; Imran, Hina; Rehman, Atiqur


    Fruit of Prunus domestica was extracted in ethanol. The ethanol extract was further extracted with two solvents ethyl acetate and chloroform. The crude ethanol extract and two fractions (ethyl acetate and chloroform) were screened for their antibacterial activity using the agar well diffusion method .They were tested against nine bacteria; five Gram positive bacteria (Staphylococcus aureus, Streptococcuc intermedius, Bacillus cereus, Bacillus pumilus) and four Gram negative bacteria (Eschrichia coli, Proteus mirabilis Shigella flexneri, Salmonella typhi and Klebsiela pneumoniae). The susceptibility of microorganisms to all three fractions was compared with each other and with standard antibiotic (Ampicillin) Among all fractions ethyl acetate exhibited highest antibacterial activity (average zone of inhibition 34.57mm ± 1.3) while ethyl alcohol exhibited least antibacterial activity (average zone of inhibition 17.42mm ± 3.3). Minimum inhibitory concentration of ethanol, ethyl acetate and chloroform fractions was found in the range of 78 μ g/ml to 2500 μ gl/ml against gram positive and gram negative bacteria.

  3. The housefly Musca domestica as a mechanical vector of Clostridium difficile. (United States)

    Davies, M P; Anderson, M; Hilton, A C


    Clostridium difficile is a bacterial healthcare-associated infection that may be transferred by houseflies (Musca domestica) due to their close ecological association with humans and cosmopolitan nature. To determine the ability of M. domestica to transfer C. difficile both mechanically and following ingestion. M. domestica were exposed to independent suspensions of vegetative cells and spores of C. difficile, then sampled on to selective agar plates immediately postexposure and at 1-h intervals to assess the mechanical transfer of C. difficile. Fly excreta was cultured and alimentary canals were dissected to determine internalization of cells and spores. M. domestica exposed to vegetative cell suspensions and spore suspensions of C. difficile were able to transfer the bacteria mechanically for up to 4h upon subsequent contact with surfaces. The greatest numbers of colony-forming units (CFUs) per fly were transferred immediately following exposure (mean CFUs 123.8 +/- 66.9 for vegetative cell suspension and 288.2 +/- 83.2 for spore suspension). After 1h, this had reduced (21.2 +/- 11.4 for vegetative cell suspension and 19.9 +/- 9 for spores). Mean C. difficile CFUs isolated from the M. domestica alimentary canal was 35 +/- 6.5, and mean C. difficile CFUs per faecal spot was 1.04 +/- 0.58. C. difficile could be recovered from fly excreta for up to 96h. This study describes the potential for M. domestica to contribute to environmental persistence and spread of C. difficile in hospitals, highlighting flies as realistic vectors of this micro-organism in clinical areas. Crown Copyright © 2016. Published by Elsevier Ltd. All rights reserved.

  4. Protozoan parasites of Musca domestica Linnaeus (DIPTERA: MUSCIDAE from Lima. Two new records in Peru

    Directory of Open Access Journals (Sweden)

    Martín Cárdenas


    Full Text Available The goal of this research was to increase the knowledge of two parasitic protozoa: Herpetomonas muscarum (Leidy, 1856 Ken, 1880 and Octosporea muscaedomesticae Flu, 1911, in Musca domestica. Both represent new records in Peru. The H. muscarum leptomonad are 36 µ long and are larger than the ones cited by other authors. O. muscadomesticae presents large and plasmodial forms slightly larger than the ones studied by Bulnheim & Vávra (1998. In the M. domestica group surveyed, we determined a significant percentage of H. muscarum (54,0% and O. muscadomesticae (27,0%.

  5. Larvicidal potential of essential oils against Musca domestica and Anopheles stephensi. (United States)

    Chauhan, Nitin; Malik, Anushree; Sharma, Satyawati; Dhiman, R C


    The larvicidal activity of Mentha piperita, Cymbopogan citratus (lemongrass), Eucalyptus globulus and Citrus sinensis (orange) essential oils and their combinations was evaluated against Musca domestica (housefly) and Anopheles stephensi (mosquitoes) through contact toxicity assay. Among all the tested essential oils/combinations, Me. piperita was found to be the most effective larvicidal agent against Mu. domestica and An. stephensi with LC50 values of 0.66 μl/cm(2) and 44.66 ppm, respectively, after 48 h. The results clearly highlighted that the addition of mentha oil to other oils (1:1 ratio) improved their larvicidal activity. The order of effectiveness of essential oils/combinations indicated that the pattern for An. stephensi follows the trend as mentha > mentha + lemongrass > lemongrass > mentha + eucalyptus > eucalyptus > mentha + orange > orange and for Mu. domestica as mentha > mentha + lemongrass > lemongrass > mentha + orange > orange > mentha + eucalyptus > eucalyptus. The images obtained from scanning electron microscopy (SEM) analysis indicated the toxic effect of Me. piperita as the treated larvae were observed to be dehydrated and deformed. This study demonstrates the effectiveness of tested essential oils/combinations against the larval stages of Mu. domestica and An. stephensi and has the potential for development of botanical formulations.

  6. Interaction of some organophosphorus compounds in susceptible and resistant houseflies (Musca domestica L.)

    NARCIS (Netherlands)

    Abdallah, M.D.


    The effect of tri-ortho-cresylphosphate (TOCP) on poisoning by parathion and paraoxon in susceptible and resistant houseflies (Musca domestica L.) was investigated.

    TOCP influenced the penetration of parathion and paraoxon, and this could explain the contradictory results of both an anta

  7. Composting poultry manure by fly larvae (Musca domestica) eliminates Campylobacter jejuni from the manure

    DEFF Research Database (Denmark)

    Nordentoft, Steen; Hald, Birthe


    Introduction The common house fly, Musca domestica (Md) is an important carrier of zoonotic agents, and Campylobacter jejuni is one that may be transmitted between animals and humans by flies. Colonized animals shed the bacteria in feces where larval stages of Md flies develops. Aim of the present...

  8. Adaptation of Musca domestica L. field population to laboratory breeding causes transcriptional alterations

    DEFF Research Database (Denmark)

    Højland, Dorte H.; Vagn Jensen, Karl-Martin; Kristensen, Michael


    The housefly, Musca domestica, has developed resistance to most insecticides applied for its control. Expression of genes coding for detoxification enzymes play a role in the response of the housefly when encountered by a xenobiotic. The highest level of constitutive gene expression of nine P450 ...

  9. Effect of Triflumuron and Pyriproxyfen on Musca domestica L Larval Stages in the Laboratory

    Directory of Open Access Journals (Sweden)

    S Sulaiman


    Full Text Available Background:  The residual effect of triflumuron and pyriproxyfen on Musca domestica L larval stages was studied in the laboratory."n"nMethods: Both IGRs at varying concentrations ranging between 0.5 to 2.5 mg/L were placed inside beakers with mice chow and vitamin B complex and water as food for the 1st, 2nd and 3rd instars M.domestica larvae."n"nResults: Both IGRs inhibit M. domestica adult emergence of 98-98.5% when applied at the lowest concentration of 0.5 mg/L on the 1st instar, 93-97% of adult emergence inhibition on the 2nd instar,and 91-97% of adult emergence inhibi­tion on the 3rd instar larvae respectively. There was no significant difference between triflumuron and pyriproxy­fen on house­fly adult emergence inhibition when fed to the 1st, 2nd and 3rd instars M.domestica larvae (P> 0.05. However, there was a significant difference between the IGRs and the control (P< 0.05."n"nConclusion: Both triflumuron and pyriproxyfen are effective in inhibiting adult emergence of housefly M  domes­tica and therefore should be recommended for fly control particularly in chicken farms and dumping grounds in Malaysia for housefly control activities.

  10. Genomic profiling of plum Prunus domestica L. germplasm using genotyping-by-sequencing (United States)

    European plum P. domestica L. (2n=6x=48) is a commercially important fruit tree species that is cultivated worldwide. With the rise of domestic and international market competition, knowledge on accurate varietal identities can be beneficial for plum breeders, producers and traders. Researchers at...

  11. Selection, resistance risk assessment, and reversion toward susceptibility of pyriproxyfen in Musca domestica L. (United States)

    Shah, Rizwan Mustafa; Abbas, Naeem; Shad, Sarfraz Ali; Sial, Ashfaq Ahmad


    Pyriproxyfen, a juvenile hormone mimic, is an effective larvicide against many pests of veterinary and public health importance. Pyriproxyfen is a biorational insecticide having many environmentally friendly attributes that make it compatible with integrated pest management programs. This experiment was performed for the assessment of resistance evolution and reversion toward susceptibility of Musca domestica to pyriproxyfen. Repeated selection at successive generations resulted in 5.09- and 130-fold increase in lethal concentration 50 (LC50) compared to field and susceptible strain, respectively. A significant decline after 22 generations without selection suggesting resistance to pyriproxyfen was unstable in M. domestica. Realized heritability (h (2)) of resistance to pyriproxyfen was 0.035 in pyriproxyfen-selected strain of M. domestica. The projected rate of resistance development indicated that, if slope = 1.28 and h (2) = 0.035, then 46-21 generations are required for 10-fold increase in LC50 at 50-90 % selection intensity. These findings suggest that a risk for resistance development to pyriproxyfen occurred in M. domestica under continuous selection pressure. Pyriproxyfen susceptibility reversed when its application is ceased for a specified duration.

  12. Effect of Triflumuron and Pyriproxyfen on Musca domestica L Larval Stages in the Laboratory

    Directory of Open Access Journals (Sweden)

    S Sulaiman


    Full Text Available Background:  The residual effect of triflumuron and pyriproxyfen on Musca domestica L larval stages was studied in the laboratory.Methods: Both IGRs at varying concentrations ranging between 0.5 to 2.5 mg/L were placed inside beakers with mice chow and vitamin B complex and water as food for the 1st, 2nd and 3rd instars M.domestica larvae.Results: Both IGRs inhibit M. domestica adult emergence of 98-98.5% when applied at the lowest concentration of 0.5 mg/L on the 1st instar, 93-97% of adult emergence inhibition on the 2nd instar,and 91-97% of adult emergence inhibi­tion on the 3rd instar larvae respectively. There was no significant difference between triflumuron and pyriproxy­fen on house­fly adult emergence inhibition when fed to the 1st, 2nd and 3rd instars M.domestica larvae (P> 0.05. However, there was a significant difference between the IGRs and the control (P< 0.05.Conclusion: Both triflumuron and pyriproxyfen are effective in inhibiting adult emergence of housefly M  domes­tica and therefore should be recommended for fly control particularly in chicken farms and dumping grounds in Malaysia for housefly control activities.

  13. Are autosomal sex-determining factors of the housefly (Musca domestica) spreading north?

    NARCIS (Netherlands)

    Kozielska, Magdalena; Feldmeyer, Barbara; Pen, Ido; Weissing, Franz J.; Beukeboom, Leo W.


    Multiple sex-determining factors have been found in natural populations of the housefly, Musca domestica. Their distribution seems to follow a geographical cline. The 'standard' system, with a male-determining factor, M, located on the Y chromosome, prevails at higher latitudes and altitudes. At low

  14. A microsatellite marker linkage map of the housefly, Musca domestica : Evidence for male recombination

    NARCIS (Netherlands)

    Feldmeyer, B.; Pen, I.; Beukeboom, L. W.


    We present the first molecular marker linkage map for Musca domestica containing 35 microsatellite plus six visible markers. We report the development of 33 new microsatellite markers of which 19 are included in the linkage map. Two hundred and thirty-six F2 individuals were genotyped from three cro

  15. Bacterial cancer of plum trees (prunus domestica), caused by pseudomonas syringae pathovars, in the netherlands

    NARCIS (Netherlands)

    Wenneker, M.; Meijer, H.; Maas, F.M.; Bruine, de A.; Vink, P.; Pham, K.T.K.


    In the Netherlands, bacterial canker in plum trees (Prunus domestica) is a serious and recent problem in plum production. Bacterial canker, caused by Pseudomonas syringae pv. syringae (Pss) and pv. morsprunorum (Psm), is a serious disease of stone fruit, and occurs in all major stone fruit producing

  16. Asociacion entre violencia domestica por la pareja y trastorno de estres postraumatico: un estudio de casos y controles

    National Research Council Canada - National Science Library

    Contreras-Pezzotti, Leddy Marina; Arteaga-Medina, Juan Ernesto; Latorre, Jose Fidel; Folino, Jorge Oscar; Campo-Arias, Adalberto


    Introduccion: La violencia domestica por la pareja (VDP) contra las mujeres es un evento frecuente de violencia interpersonal en paises en desarrollo y desarrollados y representa un problema medico-legal y de la salud publica...

  17. Making the most of RNA-seq: Pre-processing sequencing data with Opossum for reliable SNP variant detection [version 1; referees: 2 approved, 1 approved with reservations

    Directory of Open Access Journals (Sweden)

    Laura Oikkonen


    Full Text Available Identifying variants from RNA-seq (transcriptome sequencing data is a cost-effective and versatile alternative to whole-genome sequencing. However, current variant callers do not generally behave well with RNA-seq data due to reads encompassing intronic regions. We have developed a software programme called Opossum to address this problem. Opossum pre-processes RNA-seq reads prior to variant calling, and although it has been designed to work specifically with Platypus, it can be used equally well with other variant callers such as GATK HaplotypeCaller. In this work, we show that using Opossum in conjunction with either Platypus or GATK HaplotypeCaller maintains precision and improves the sensitivity for SNP detection compared to the GATK Best Practices pipeline. In addition, using it in combination with Platypus offers a substantial reduction in run times compared to the GATK pipeline so it is ideal when there are only limited time or computational resources available.

  18. Making the most of RNA-seq: Pre-processing sequencing data with Opossum for reliable SNP variant detection [version 2; referees: 2 approved, 1 approved with reservations

    Directory of Open Access Journals (Sweden)

    Laura Oikkonen


    Full Text Available Identifying variants from RNA-seq (transcriptome sequencing data is a cost-effective and versatile complement to whole-exome (WES and whole-genome sequencing (WGS analysis. RNA-seq (transcriptome sequencing is primarily considered a method of gene expression analysis but it can also be used to detect DNA variants in expressed regions of the genome. However, current variant callers do not generally behave well with RNA-seq data due to reads encompassing intronic regions. We have developed a software programme called Opossum to address this problem. Opossum pre-processes RNA-seq reads prior to variant calling, and although it has been designed to work specifically with Platypus, it can be used equally well with other variant callers such as GATK HaplotypeCaller. In this work, we show that using Opossum in conjunction with either Platypus or GATK HaplotypeCaller maintains precision and improves the sensitivity for SNP detection compared to the GATK Best Practices pipeline. In addition, using it in combination with Platypus offers a substantial reduction in run times compared to the GATK pipeline so it is ideal when there are only limited time or computational resources available.

  19. Use of the space by the opossum Didelphis aurita Wied-Newied (Mammalia, Marsupialia in a mixed forest fragment of southern Brazil

    Directory of Open Access Journals (Sweden)

    Cáceres Nilton Carlos


    Full Text Available Use of the space by the opossum Didelphis aurita Wied-Newied, 1826 (Mammalia, Marsupialia in a mixed forest fragment of southern Brazil. The space use of the marsupial Didelphis aurita was studied in a forest fragment of southern Brazil from February 1995 to January 1996. The method used was the 'distribution utilization' in which each trap was set in 38 x 38 m quadrats. Captures of each marked individual in each point give information on its habitat use. Food availability was searched and compared to the habitat utilization and to the food consumption of opossums. Distribution patterns of captures (aggregated to random and spatial overlap between individuals were searched. Results showed aggregated distributions of individuals, particularly females, in the fragment. Females used exclusively the fragment during the drier season. Opossums tend to not choose the sites with highest food availability to establish home ranges. Spatial overlap was usually low between forest resident and neighbouring resident females, but much lower during the breeding season (only forest resident females in an apparently pattern of territoriality. Hence, core areas of females decreased in size during the breeding season. Males probably searched primarily for mates during the breeding season being less opportunistic than females in feeding habits, yet their space use did not correlate to food consumption.

  20. Horizontal Transmission of Beauveria bassiana (Hypocreales: Cordycipitaceae) and Metarhizium anisopliae (Hypocreales: Clavicipitaceae) in Musca domestica (Diptera: Muscidae). (United States)

    Cárcamo, M C; Felchicher, F; Duarte, J P; Bernardi, E; Ribeiro, P B


    Beauveria bassiana Vuillemin and Metarhizium anisopliae (Metschnikoff) Sorokin are fungi with potential for controlling Musca domestica L. However, the impact on this dipteral may vary depending on the fungal isolates and the methodology used. This study evaluated the pathogenicity of direct application and horizontal transmission of B. bassiana (CG240) and M. anisopliae (CG34) on adult M. domestica individuals. The impact of B. bassiana and M. anisopliae on M. domestica was evaluated at the concentrations 2 × 10(4), 2 × 10(5), 2 × 10(6), and 2 × 10(7) conidia/ml. Horizontal transmission was also estimated between sexes at different infection periods of the vector insect. The mortality of adult M. domestica individuals directly infected with B. bassiana was above 90%, and the mortality of those infected with M. anisopliae ranged from 25.50 to 97.78%. Horizontal transmission of B. bassiana caused the death of 100% of individuals, in turn, that of M. anisopliae killed 55% of male and 100% of female individuals. Horizontal transmission of fungi was negatively influenced by time. This study shows the potential of these fungi for controlling M. domestica, both with the direct implementation strategy and horizontal transmission. However, field studies are needed to evaluate the capacity to decrease the M. domestica population using these alternatives.

  1. In vivo strains in the femur of the Virginia opossum (Didelphis virginiana) during terrestrial locomotion: testing hypotheses of evolutionary shifts in mammalian bone loading and design. (United States)

    Butcher, Michael T; White, Bartholomew J; Hudzik, Nathan B; Gosnell, W Casey; Parrish, John H A; Blob, Richard W


    Terrestrial locomotion can impose substantial loads on vertebrate limbs. Previous studies have shown that limb bones from cursorial species of eutherian mammals experience high bending loads with minimal torsion, whereas the limb bones of non-avian reptiles (and amphibians) exhibit considerable torsion in addition to bending. It has been hypothesized that these differences in loading regime are related to the difference in limb posture between upright mammals and sprawling reptiles, and that the loading patterns observed in non-avian reptiles may be ancestral for tetrapod vertebrates. To evaluate whether non-cursorial mammals show loading patterns more similar to those of sprawling lineages, we measured in vivo strains in the femur during terrestrial locomotion of the Virginia opossum (Didelphis virginiana), a marsupial that uses more crouched limb posture than most mammals from which bone strains have been recorded, and which belongs to a clade phylogenetically between reptiles and the eutherian mammals studied previously. The presence of substantial torsion in the femur of opossums, similar to non-avian reptiles, would suggest that this loading regime likely reflects an ancestral condition for tetrapod limb bone design. Strain recordings indicate the presence of both bending and appreciable torsion (shear strain: 419.1 ± 212.8 με) in the opossum femur, with planar strain analyses showing neutral axis orientations that placed the lateral aspect of the femur in tension at the time of peak strains. Such mediolateral bending was unexpected for a mammal running with near-parasagittal limb kinematics. Shear strains were similar in magnitude to peak compressive axial strains, with opossum femora experiencing similar bending loads but higher levels of torsion compared with most previously studied mammals. Analyses of peak femoral strains led to estimated safety factor ranges of 5.1-7.2 in bending and 5.5-7.3 in torsion, somewhat higher than typical mammalian values

  2. Late dry season habitat use of common opossum, Didelphis marsupialis (Marsupialia: Didelphidae in neotropical lower montane agricultural areas

    Directory of Open Access Journals (Sweden)

    Christopher S. Vaughan


    Full Text Available Three Didelphis marsupialis were radio tracked during late dry season (23 February-26 April, 1983 in agricultural area at 1500 m elevation in Central Valley, Costa Rica. All animals were nocturnally active, significantly more so between 2100-0300 h. Fifty diurnal den site locations were found, 96% inside tree cavities in living fence rows or abandoned squirrel nests in windbreaks. Two females occupied 3.4 and 3.1 ha 95% home ranges, moving an average 890 and 686 m nightly respectively. The male occupied a 5.6 ha 95% home range for 42 days overlapping 90% of females' home ranges. Over the next 15 days, he moved 1020 m south, establishing three temporary home ranges. During nocturnal movements, windbreaks and living fence rows were used in higher proportion than available, while pasture, roads and cultivated lands were used less then available within 100% home ranges. Abandoned coffee and spruce plantations, fruit orchards and overgrown pastures were used in equal proportions to availability in 100% home ranges. Opossum conservation techniques in coffee growing areas include promoting spruce windbreaks, living fence rows, and garbage dumps.

  3. PRESENCIA DEL ZORRO DE CUATRO OJOS (Philander opossum EN EL CULTIVO DE PIÑA (Ananas comusus

    Directory of Open Access Journals (Sweden)

    Javier Monge-Meza


    Full Text Available El objetivo de este trabajo fue determinar la presencia del zorro de cuatro ojos (Philander opossum en áreas de producción de piña orgánica (Ananas comusus, en Sa nta Ce cilia de La Cruz, Guanacaste, Costa Ri ca. Las capturas se realizaron con trampas grandes de golpe, en muestreos quincenales desde febrero del 2008 hasta febrero del 2009. Se logró la captura de ocho individuos, desde marzo hasta agosto, lo cual indica que la especie podría tener actividad reproductiva desde finales de la época seca y en la lluviosa. Al menos uno de los individuos consumió piña, según análisis de su contenido estomacal. Si n embargo, el nivel de daño observado en el campo no permite considerar a esta especie como una plaga de la piña, sino una especie oportunista que aprovecha frutos maduros dejados en el campo, después de la cosecha. La colecta de individuos en varios meses del año, indican que esta especie utiliza las plantaciones de piña orgánica como parte de su hábitat, lo cual contradice la idea generalizada que los monocultivos no proveen condiciones mínimas para que las especie s de vida silvestre lo visiten o lo habiten.

  4. The occurrence of the cicada Cicadatra persica on apple trees, Malus domestica, in Erneh, Syria. (United States)

    Dardar, Marah A; Belal, Hamzeh M R; Basheer, Abedlnabi M


    An infestation of Cicadatra persica KirKaldy (Hemiptera: Cicadidae) on apple trees, Malus domestica Borkhausen (Rosales: Rosaceae), was reported for the first time in the apple fruit orchards of Erneh, Syria. Nymphs, adults, exuvia, and exit holes in the soil were observed. The species was identified as C. persica based on morphological characters. Some biological observations and an acoustic analysis of the male's songs were also achieved.

  5. Composition of pectic polysaccharides in a Portuguese apple (Malus domestica Borkh. cv Bravo de Esmolfe)



    Malus domestica Borkh. cv Bravo de Esmolfe is a typical Portuguese apple cultivar classified as Protected Designation and Origin (PDO). It is a traditional product produced under strict conditions and labelled with a specific law protected designation. This cultivar presents quite good sweetness and flavor. The monosaccharide composition of the pectic polysaccharides from this traditional apple is herein reported for the first time. Based on the molar ratios obtained from the sugar compositio...

  6. Bioefficacy of essential oils of medicinal plants against housefly, Musca domestica L. (United States)

    Morey, Rashmi A; Khandagle, Abhay J


    The housefly Musca domestica L. is recognized as a public health pest causing a serious threat to human and livestock by vectoring many infectious diseases. Chemical control method commonly used against this pest, though effective, has some major disadvantages, such as development of insect resistance and bioaccumulation. Pest management strategies for populations of houseflies are needed. Presently, bioinsecticides, especially those derived from plant origin, have been increasingly evaluated in controlling insects of medical importance. In order to search for effective and ecofriendly control agents, the essential oils of Mentha piperita, Zingiber officinalis, Emblica officinalis, and Cinnamomum verum were evaluated for their larvicidal, attractant/repellent, and oviposition attractant/deterrent activity against M. domestica. The highest larvicidal activity, i.e., C(50) = 104 ppm was shown by M. piperita. This oil also exhibited 96.8% repellency at the concentration of 1%. The highest oviposition deterrence activity of 98.1% was also exhibited by M. piperita oil at the concentration of 1%. Among the remaining plants, the essential oil of Z. officinalis exhibited significant bioactivities against M. domestica with larvicidal activity, i.e., lethal concentration (LC)(50) = 137 ppm, repellency of 84.9 and 98.1% oviposition deterrence both at 1% concentration. The other two plant oils, viz., C. verum and E. officinalis, showed relatively moderate bioefficacy with larvicidal activity, i.e., LC(50) = 159 and 259 ppm, repellency of 77.9 and 63.0% while oviposition deterrence of 60.0 and 42.6%, respectively. The result revealed that the essential oils of M. piperita have control potential against M. domestica and should be further explored as a component of integrated vector management program.

  7. Metabolic and gene expression analysis of apple (Malus × domestica) carotenogenesis


    Ampomah-Dwamena, Charles; Dejnoprat, Supinya; Lewis, David; Sutherland, Paul; Volz, Richard K; Allan, Andrew C


    Carotenoid accumulation confers distinct colouration to plant tissues, with effects on plant response to light and as well as health benefits for consumers of plant products. The carotenoid pathway is controlled by flux of metabolites, rate-limiting enzyme steps, feed-back inhibition, and the strength of sink organelles, the plastids, in the cell. In apple (Malus × domestica Borkh), fruit carotenoid concentrations are low in comparison with those in other fruit species. The apple fruit flesh,...

  8. Effects of Foliar Treatments of Salicylic Acid on Apple (Malus domestica L.) Against Freezing


    Bengü Türkyılmaz Ünal; Oğuzhan Mentiş; Ethem Akyol


    In our study we aim to increase frost resistance and improve the yield and quality of apple is important in Turkey and world economy. Phenological and morphological observations, physiological and biochemical analyzes were carried out in apple (Malus domestica L.) plants. It was studied to determine the effects of foliar Salicylic acid (0, 500 ppm/plant and 1000 ppm/plant) on adaptation of this plant when exposed to freezing stress, the quality and yield. Leaf photosynthetic pigment contents...

  9. Actividad antioxidante de extractos de semilla de tres variedades de manzana (Malus domestica Borkh -Rosaceae-)


    Verónica CERVANTES-CARDOZA; Rocha-Guzmán, Nuria Elizabeth; Gallegos-Infante, José Alberto; Martha ROSALES-CASTRO; Medina-Torres, Luis; Rubén Francisco GONZÁLEZ-LAREDO


    The oily (hexane) and aqueous extracts from apple seeds (Malus domestica Borkh -Rosaceae-) cultivars Winter Banana (WB), Winter Permain (WP) and Blanca de Asturias (BA) have shown significant differences in phenolic content and antioxidant activity. BA seed oily extracts and WB seed aqueous extracts have presented the best scavenging capacity of DPPH¿ radical and inhibition of hydroxyl radicals. In the biological assay apple seed extracts showed protection against low density lipoproteins (LD...

  10. Efficacy and safety of Curcuma domestica extracts compared with ibuprofen in patients with knee osteoarthritis: a multicenter study (United States)

    Kuptniratsaikul, Vilai; Dajpratham, Piyapat; Taechaarpornkul, Wirat; Buntragulpoontawee, Montana; Lukkanapichonchut, Pranee; Chootip, Chirawan; Saengsuwan, Jittima; Tantayakom, Kesthamrong; Laongpech, Supphalak


    Objective To determine the efficacy and safety of Curcuma domestica extracts in pain reduction and functional improvement. Methods 367 primary knee osteoarthritis patients with a pain score of 5 or higher were randomized to receive ibuprofen 1,200 mg/day or C. domestica extracts 1,500 mg/day for 4 weeks. The main outcomes were Western Ontario and McMaster Universities Osteoarthritis Index (WOMAC) total, WOMAC pain, WOMAC stiffness, and WOMAC function scores. Adverse events (AEs) were also recorded. Results 185 and 182 patients were randomly assigned into C. domestica extracts and ibuprofen groups, respectively. The baseline characteristics were no different between groups. The mean of all WOMAC scores at weeks 0, 2, and 4 showed significant improvement when compared with the baseline in both groups. After using the noninferiority test, the mean difference (95% confidence interval) of WOMAC total, WOMAC pain, and WOMAC function scores at week 4 adjusted by values at week 0 of C. domestica extracts were noninferior to those for the ibuprofen group (P=0.010, P=0.018, and P=0.010, respectively), except for the WOMAC stiffness subscale, which showed a trend toward significance (P=0.060). The number of patients who developed AEs was no different between groups. However, the number of events of abdominal pain/discomfort was significantly higher in the ibuprofen group than that in the C. domestica extracts group (P=0.046). Most subjects (96%–97%) were satisfied with the treatment, and two-thirds rated themselves as improved in a global assessment. Conclusion C. domestica extracts are as effective as ibuprofen for the treatment of knee osteoarthritis. The side effect profile was similar but with fewer gastrointestinal AE reports in the C. domestica extracts group. PMID:24672232


    Directory of Open Access Journals (Sweden)



    Full Text Available The housefly, Musca domestica L., is a cosmopolitan insect, associated with vectoring of various etiologicalagents. In order to search for effective control method, bioefficacy of essential oils of Thyme (Thymus vulgarisand Clove leaf (Eugenia coryophyllus was studied against housefly. The LC (50 3.18ug/cm2 value of Clove leaf oilwas found highly effective as compared to LC (50 value 4.39ug/cm2 of Thyme essential oil for inducing mortalityof M. domestica larvae. The adulticidal activity of Thyme essential oil LC (50 32.71 mg/dm3 was toxic than Cloveleaf essential oil [LC (50 53.10 mg/dm3]. In Attractant / repellant Bioassay, Thyme essential oil revealed 90.21%repellency as compared to 80.68 % value of Clove leaf essential oil against adults of House fly. In fumigationbioassay, Thyme showed high Pupicidal activity than Clove leaf oil and in contact toxicity bioassay using topicalapplication both the oils showed 100 % pupicidal mortality. The data reveals that Clove and Thyme essential oilshave excellent potential for controlling M. domestica population as eco-friendly approach in IPM.

  12. Transcriptomic Analysis of Musca domestica to Reveal Key Genes of the Prophenoloxidase-Activating System. (United States)

    Li, Dianxiang; Liang, Yongli; Wang, Xianwei; Wang, Lei; Qi, Mei; Yu, Yang; Luan, Yuanyuan


    The proPO system regulates melanization in arthropods. However, the genes that are involved in the proPO system in housefly Musca domestica remain unclear. Thus, this study analyzed the combined transcriptome obtained from M. domestica larvae, pupae, and adults that were either normal or bacteria-challenged by an Escherichia coli and Staphylococcus aureus mixture. A total of 54,821,138 clean reads (4.93 Gb) were yielded by Illumina sequencing, which were de novo assembled into 89,842 unigenes. Of the 89,842 unigenes, based on a similarity search with known genes in other insects, 24 putative genes related to the proPO system were identified. Eight of the identified genes encoded for peptidoglycan recognition receptors, two encoded for prophenoloxidases, three encoded for prophenoloxidase-activating enzymes, and 11 encoded for serine proteinase inhibitors. The expression levels of these identified genes were investigated by qRT-PCR assay, which were consistent with expected activation process of the proPO system, and their activation functions were confirmed by the measurement of phenoloxidase activity in bacteria-infected larvae after proPO antibody blockage, suggesting these candidate genes might have potentially different roles in the activation of proPO system. Collectively, this study has provided the comprehensive transcriptomic data of an insect and some fundamental basis toward achieving understanding of the activation mechanisms and immune functions of the proPO system in M. domestica.

  13. Infectivity of housefly, Musca domestica (Diptera: Muscidae to different entomopathogenic fungi

    Directory of Open Access Journals (Sweden)

    Muzammil Farooq

    Full Text Available Abstract The housefly Musca domestica is a worldwide insect pest that acts as a vector for many pathogenic diseases in both people and animals. The present study was conducted to evaluate the virulence of different local isolates of Beauveria bassiana, Metarhizium anisopliae and Isaria fumosorosea on M. domestica using two bioassay techniques: (1 adult immersion and (2 a bait method applied to both larvae and adults. The results showed evidence of a broad range of responses by both stages (larvae and adults to the tested isolates of B. bassiana, M. anisopliae and I. fumosorosea. These responses were concentration-dependent, with mortality percentages ranging from 53.00% to 96.00%. Because it resulted in lower LC50 values and a shorter lethal time, B. bassiana (Bb-01 proved to be the most virulent isolate against both housefly larvae and adults. Sublethal doses of the tested isolates were also assessed to evaluate their effect on M. domestica fecundity and longevity. The fungal infections reduced housefly survival regardless of their sex and also decreased egg production in females.

  14. Dominant fitness costs of resistance to fipronil in Musca domestica Linnaeus (Diptera: Muscidae). (United States)

    Abbas, Naeem; Shah, Rizwan Mustafa; Shad, Sarfraz Ali; Azher, Faheem


    House fly, Musca domestica L., (Diptera: Muscidae) a common pest of poultry, has developed resistance to the commonly used insecticide fipronil. The life history traits were examined in the fipronil-selected (Fipro-SEL), susceptible counterpart (UNSEL), and their hybrid progeny strains in order to design an effective resistant management strategy. Compared to the UNSEL strain, the Fipro-SEL was 181.94-fold resistant to fipronil. This resistance was unstable after five generations without selection. The Fipro-SEL had a significantly longer larval duration, lower pupal weight, lower fecundity, lower hatchability, lower number of next generation larvae, lower intrinsic rate of population increase and lower biotic potential than the UNSEL strain. Most fitness parameters of the hybrid progeny were similar and significantly lower than that in the UNSEL strain, suggesting autosomal and dominant fitness costs. Compared to the UNSEL strain, relative the fitness of the Fipro-SEL, Hybrid1 and Hybrid2 was 0.13, 0.33 and 0.30, respectively. Fipronil resistance resulted in high fitness costs and these fitness costs were dominant and autosomal in the Fipro-SEL strain of M. domestica. Rotation of fipronil with other insecticides having no cross resistance should be useful for delaying the development of resistance in M. domestica.


    Directory of Open Access Journals (Sweden)

    Nicoleta IANOVICI


    Full Text Available The objective of this study was to compare Rosaceae genotypes from for their pollen viability and morphology. The pollen of some varieties of Malus domestica, Pyrus communis, Prunus domestica, Prunus persica and Prunus armeniaca was identified. Pollen from mature anthers was collected. Pollen grains of all genera of Rosaceae surveyed occur as radially symmetric isopolar monads. The main aspect studied were the shape of pollen in the polar view (polar perimeter and polar area of pollen. Shape of pollen is triangular-obtuse-convex in polar view. The pollen class is trizonocolpate-obtus-triangular while the sculpturing of exine surface is striate. The number of colpi is three while the spines are absent. Apart from fully developed pollen grains, also much smaller, not completely developed pollen were found in the samples of the examined species. The viability of the pollen was determined on 1% 2,3,5-triphenyl tetrazolium chloride (TTC. Viable, semi-viable and dead pollen numbers and their percentages were determined. This stain test may be used to determine pollen viability in these species to provide only a rough estimate of viability. The results presented here are important for improving our understanding of Rosaceae reproduction biology. Knowledge of reproduction biology, particularly pollen viability and quality, is critical for the newly-developed cultivars.

  16. Cloning and molecular characterization of an ornithine decarboxylase gene and its expression during embryonic development of the housefly, Musca domestica. (United States)

    Toutges, Michelle J; Santoso, Adi


    We are interested in identifying targets that may be used to develop new control products for the common housefly, Musca domestica, a vector of disease for many vertebrates. One such target, ornithine decarboxylase (ODC), is an embryonic enzyme involved in the regulation of polyamines and is a critical enzyme during M. domestica development. In this study, the cDNA for ODC from M. domestica was cloned, sequenced, and characterized. The full-length cDNA was 1,337-bp, consistent with a single band of approximately 1.35 kb obtained by northern analysis. The open-reading frame contains 1,191 bp, yielding a deduced polypeptide of 396 amino acid residues with a predicted mass of 44,618 Da. The deduced M. domestica ODC protein was homologous to other ODC proteins. mRNA expression profiles analyzed by real-time PCR indicated that the ODC transcript is temporally regulated throughout embryogenesis. Sequence data and Southern blot analysis suggests that there were likely only one or two closely linked copies of the M. domestica ODC gene.

  17. Diversity of Sarcocystis spp shed by opossums in Brazil inferred with phylogenetic analysis of DNA coding ITS1, cytochrome B, and surface antigens. (United States)

    Valadas, Samantha Y O B; da Silva, Juliana I G; Lopes, Estela Gallucci; Keid, Lara B; Zwarg, Ticiana; de Oliveira, Alice S; Sanches, Thaís C; Joppert, Adriana M; Pena, Hilda F J; Oliveira, Tricia M F S; Ferreira, Helena L; Soares, Rodrigo M


    Although few species of Sarcocystis are known to use marsupials of the genus Didelphis as definitive host, an extensive diversity of alleles of surface antigen genes (sag2, sag3, and sag4) has been described in samples of didelphid opossums in Brazil. In this work, we studied 25 samples of Sarcocystis derived from gastrointestinal tract of opossums of the genus Didelphis by accessing the variability of sag2, sag3, sag4, gene encoding cytochrome b (cytB) and first internal transcribed spacer (ITS1). Reference samples of Sarcocystis neurona (SN138) and Sarcocystis falcatula (SF1) maintained in cell culture were also analyzed. We found four allele variants of cytB, seven allele variants of ITS1, 10 allele variants of sag2, 13 allele variants of sag3, and 6 allele variants of sag4. None of the sporocyst-derived sequences obtained from Brazilian opossums revealed 100% identity to SN138 at cytB gene, nor to SN138 or SF1 at ITS1 locus. In addition, none of the sag alleles were found identical to either SF1 or SN138 homologous sequences, and a high number of new sag allele types were found other than those previously described in Brazil. Out of ten sag2 alleles, four are novel, while eight out of 13 sag3 alleles are novel and one out of six sag4 alleles is novel. Further studies are needed to clarify if such a vast repertoire of allele variants of Sarcocystis is the consequence of re-assortments driven by sexual exchange, in order to form individuals with highly diverse characteristics, such as pathogenicity, host spectrum, among others or if it only represents allele variants of different species with different biological traits.

  18. Breeding Management Technology of Nandina domestica Thunb%南天竹繁育管理技术

    Institute of Scientific and Technical Information of China (English)



    从形态特征、生长习性等方面介绍了南天竹的生物学特性,并总结了南天竹的繁育管理技术,包括播种育苗、无性繁殖育苗、病虫害防治,以期为南天竹的繁育管理提供参考。%Biological characteristics of Nandina domestica Thunb were introduced from the aspects of morphological characteristics and growth habit. Breeding management technology of Nandina domestica was summarized,including sowing seedling,asexual reproduction seedling,and pest and disease control,so as to provide reference for breeding management of Nandina domestica Thunb.

  19. Musca domestica Salivary Gland Hypertrophy Virus, a Globally Distributed Insect Virus That Infects and Sterilizes Female Houseflies

    DEFF Research Database (Denmark)

    Prompiboon, Pannipa; Lietze, Verena-Ulrike; Denton, John S S


    The housefly, Musca domestica, is a cosmopolitan pest of livestock and poultry and is of economic, veterinary, and public health importance. Populations of M. domestica are naturally infected with M. domestica salivary gland hypertrophy virus (MdSGHV), a nonoccluded double-stranded DNA virus...... that inhibits egg production in infected females and is characterized by salivary gland hypertrophy (SGH) symptoms. MdSGHV has been detected in housefly samples from North America, Europe, Asia, the Caribbean, and the southwestern Pacific. In this study, houseflies were collected from various locations...... reading frames having homology to genes encoding DNA polymerase and partial homology to the genes encoding four per os infectivity factor proteins (p74, pif-1, pif-2, and pif-3) were selected for phylogenetic analyses. Nucleotide sequences from 16 different geographic isolates were highly homologous...

  20. Chemical composition and insecticidal property of Myrsine stolonifera (Koidz.) walker (Family: Myrsinaceae) on Musca domestica (Diptera: Muscidae). (United States)

    Wang, Xue Gui; Li, Qian; Jiang, Su Rong; Li, Pei; Yang, Ji Zhi


    Musca domestica is one of the most important pests of human health, and has developed strong resistance to many chemicals used for its control. One important approach for creating new pesticides is the exploration of novel compounds from plants. During a wide screening of plants with insecticidal properties that grow in southern China, we found that the methanolic extracts of Myrsine stolonifera had insecticidal activity against the adults of M. domestica. However, the insecticidal constituents and mechanisms of the M. stolonifera extracts remain unclear. The insecticidal components of the methanolic extracts of M. stolonifera were isolated with activity-guided fractionation. From the spectra of nuclear magnetic resonance (NMR) and mass spectrometry (MS), the compounds were identified as syringing (1), 2,6-dimethoxy-4-hydroxyphenol-1-O-β-d-glu (2), kaempferol-3-O-glu-rha-glu (3), and quercetin-3-O-glu-rha-glu (4). This study is the first to report the spectral data for compounds 3 and 4, and their LC50 values were 0.52mg/g sugar and 0.36mg/g sugar 24h after treatment of the adults of M. domestica, respectively. Compounds 3 and 4 (LC25) also inhibited the activities of the enzymes carboxylesterase, glutathione S-transferase, mixed function oxidase, and acetylcholine esterase of adult M. domestica, particularly mixed function oxidase and acetylcholine esterase. The cytotoxic effects of compounds 3 and 4 on cell proliferation, mitochondrial membrane potentials (MMP) and reactive oxygen species (ROS) were demonstrated on SL-1 cells. From the extracts of M. stolonifera, quercetin-3-O-glu-rha-glu and kaempferol-3-O-glu-rha-glu have displayed comparable toxicities to rotenone on M. domestica and also exhibited cytotoxic effects on SL-1 cells; therefore, the extracts of M. stolonifera and their compounds have potential as botanical insecticides to control M. domestica.

  1. A whole transcriptomal linkage analysis of gene co-regulation in insecticide resistant house flies, Musca domestica

    DEFF Research Database (Denmark)

    Li, Ming; Reid, William R; Zhang, Lee;


    generated from the de novo transcriptome assembly. A total of 6159 (43%) of the contigs contained coding regions, among which 1316 genes were identified as being co-up-regulated in ALHF in comparison to both aabys and CS. The majority of these up-regulated genes fell within the SCOP categories of metabolism...... recessive markers) and CS (wild type) to gain valuable insights into the gene interaction and complex regulation in insecticide resistance of house flies, Musca domestica. Results Over 56 million reads were used to assemble the adult female M. domestica transcriptome reference and 14488 contigs were...

  2. Parásitos de importancia en salud pública transportados por Musca domestica. Lima-Perú.


    Christian Castillo Elera; Marcos Castro Mantilla; Carmen Carhuapoma Colquicocha; Hugo Castro Trujillo; Raquel Castro Tamayo; Juan Chambi Choque


    Objetivo: Determinar el porcentaje de parásitos de importancia en salud pública que son transportados por Musca domestica. Diseño: Estudio transversal, descriptivo no experimental. Lugar: Instituto de Medicina Tropical ¿Daniel A. Carrión¿, Universidad Nacional Mayor de San Marcos. Participantes: 1867 ejemplares de Musca domestica. Intervenciones: Técnicas de lavado y machacado de moscas; los sedimentos se analizaron con las coloraciones de Lugol y Kinyoun empleando microscopio óptico. Princip...

  3. Gene : CBRC-MEUG-01-1505 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available _HUMAN 1e-57 48% ref|XP_001373233.1| PREDICTED: similar to olfactory receptor Olfr1177 [Monodelphis domestic...a] 1e-77 59% MVSPDRNQSGAFIFILLGFSDYPVIQMPLFLLFITTYSVIVVGNSGVIAIIRITPKLHIPMYFFLNHWSFVDLCYSTIVTPKLLENLVVEDKSIS

  4. Gene : CBRC-ETEL-01-0666 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available _HUMAN 1e-113 63% ref|XP_001377735.1| PREDICTED: similar to seven transmembrane helix receptor [Monodelphis domestica] 1e-111 59% MPN...STIVTEFLLSGFSDVWEVQSLYTMLFLLMYLATLTGNLLIVTVITLDQRLHTPMYFFILNLSVWDMCYISVTVPKACVIFLLN

  5. Gene : CBRC-CPOR-01-1571 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 1e-125 77% ref|XP_001376783.1| PREDICTED: similar to olfactory receptor Olr374 [Monodelphis domestica] 1e-130 80% MSPACLPLMFRCRDAGLEP...RAQPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGPLFLLFLLLYLLTLGGNAAILWVVSAHSALHSPMYFFLGILSV

  6. Efficacy of Essential Oils from Edible Plants as Insecticides Against the House Fly, Musca Domestica L.

    Directory of Open Access Journals (Sweden)

    Sara M. Palacios


    Full Text Available The compositions of 12 essential oils (EOs obtained by hydrodistillation of edible fruits and herbs were analyzed by gas chromatography/mass spectroscopy (GC/MS. The insecticidal activity of each oil against the house fly Musca domestica was evaluated by placing flies in a glass jar with a screw cap that held a piece of EO-treated cotton yarn. The dose necessary to kill 50% of flies (LC50 in 30 min was determined at 26 ± 1°C. Twelve EOs and 17 individual terpenes were assayed against M. domestica, showing LC50 values ranging from 3.9 to 85.2 and from 3.3 to >100 mg/dm3, respectively. EO from Citrus sinensis was the most potent insecticide (LC50 = 3.9 mg/dm3, followed by EOs from C. aurantium (LC50 = 4.8 mg/dm3 and Eucalyptus cinerea (LC50 = 5.5 mg/dm3. According to GC/MS analysis, limonene (92.47%, linalool (1.43%, and b-myrcene (0.88% were the principal components of C. sinensis EO. Limonene was also the principal constituent (94.07% of C. aurantium, while 1,8-cineole (56.86% was the major constituent of E. cinerea EO. 1,8-Cineole was most active against M. domestica (LC50 = 3.3 mg/dm3, while (4R(+-limonene, was moderately active (LC50 = 6.2 mg/dm3. Dimethyl 2,2-dichlorovinyl phosphate (DDVP selected as a positive control, showed an LC50 of 0.5 mg/dm3. EOs from C. sinensis, C. aurantium, and E. cinerea show promise as natural insecticides against houseflies.

  7. Mass spectrometric analysis of putative capa-gene products in Musca domestica and Neobellieria bullata. (United States)

    Predel, Reinhard; Russell, William K; Tichy, Shane E; Russell, David H; Nachman, Ronald J


    Neuropeptides of the capa-gene are typical of the abdominal neurosecretory system of insects. In this study, we investigated these peptides in two widely distributed and large pest flies, namely Musca domestica and Neobellieria bullata. Using a combination of MALDI-TOF and ESI-QTOF mass spectrometry, periviscerokinins and a pyrokinin were analyzed from single perisympathetic organ preparations. The species-specific peptide sequences differ remarkably between the related dipteran species. These differences could make it possible to develop peptide-analogs with group- or species-specific efficacy.

  8. Effect of some botanical materials on certain biological aspects of the house fly, Musca domestica L

    Directory of Open Access Journals (Sweden)

    Nabawy A. I. Elkattan, Khalafalla S. Ahmed, Saadya M. Elbermawy and Rabab


    Full Text Available The effects of Lantana camara (leaves, Pelargonium zonale (leaves, Cupressus macrocarpa (leaves, Cyperus rotundus (whole plant and Acacia nilotica (seeds powders on some biological aspects of house fly, M. domestica L. were tested. The effects of three lethal concentrations LC25, LC50 and LC75 on the larval duration, pupation percent, pupal weight, pupal duration, adult emergence percent, sex ratio, adult longevity, and fecundity were determined. The induced malformed larvae, pupae and adults were recorded and photographed. The powders of the five plants were found to have promising effects in controlling this insect.

  9. Ectopic expression of Malus domestica class 1 knox genes altered growth and development of Nicotiana tabacum and Prunus domestica, and induced adventitious shoot regeneration from leaf explants without exogenous cytokinin (United States)

    Transgenic tobacco (Nicotiana tabacum L) and plum (Prunus domestica L) plants were regenerated by transforming with apple class 1 KNOX genes (MdKNP1 and MdKNP2) or a corn KN1 (ZmKN1) gene. Transgenic tobacco plants were produced in vitro from transformed leaf discs in the absence of cytokinin in th...

  10. Watery and dark axons in Wallerian degeneration of the opossum's optic nerve: different patterns of cytoskeletal breakdown?

    Directory of Open Access Journals (Sweden)



    Full Text Available In this paper we report a qualitative morphological analysis of Wallerian degeneration in a marsupial. Right optic nerves of opossums Didelphis marsupialis were crushed with a fine forceps and after 24, 48, 72, 96 and 168 hours the animals were anaesthetized and perfused with fixative. The optic nerves were immersed in fixative and processed for routine transmission electron microscopy. Among the early alterations typical of axonal degeneration, we observed nerve fibers with focal degeneration of the axoplasmic cytoskeleton, watery degeneration and dark degeneration, the latter being prevalent at 168 hours after crush. Our results point to a gradual disintegration of the axoplasmic cytoskeleton, opposed to the previous view of an "all-or-nothing'' process (Griffin et al 1995. We also report that, due to an unknown mechanism, fibers show either a dark or watery pattern of axonal degeneration, as observed in axon profiles. We also observed fibers undergoing early myelin breakdown in the absence of axonal alterations.Neste trabalho, relatamos uma análise morfológica qualitativa da degeneração Walleriana em um marsupial. Os nervos ópticos direito de gambás da espécie Didelphis marsupialis foram esmagados com uma pinça fina. Após 24, 48, 72, 96 e 168 horas, os animais foram anestesiados e perfundidos com fixador. A seguir, os nervos foram imersos em fixador e processados para microscopia eletrônica de rotina. Entre as alterações precoces típicas da degeneração, observamos fibras nervosas com degeneração focal do citoesqueleto axoplasmático, degeneração aquosa e degeneração escura, com o último tipo prevalente às 168 horas após esmagamento. Nossos resultados indicam uma desintegração gradual do citoesqueleto axoplasmático, oposta à prévia visão de um processo "tudo-ou-nada''. Relatamos também que, devido a um mecanismo desconhecido, as fibras mostram ou um padrão aquoso ou um padrão escuro de degeneração axonal

  11. Characterization of resistance gene analogues (RGAs) in Apple (Malus 6domestica Borkh.) and their evolutionary history of the Rosaceae family (United States)

    The family of resistance gene analogues (RGAs) with a nucleotide-binding site (NBS) domain accounts for the largest number of disease resistance genes and is one of the largest gene families in plants. We have identified 868 RGAs in the genome of the apple (Malus × domestica Borkh.) cultivar ‘Golden...


    DEFF Research Database (Denmark)

    Bellini, R; Mullens, B A; Jespersen, J B


    Dose-mortality studies were conducted with 2 members of the Entomophthora muscae (Cohn) Fresenius complex from southern California (CA) and Denmark (DA) infecting house flies, Musca domestica L., from southern California. Primary conidia of the DA form were significantly more infective (LC50 = 34...

  13. House fly (Musca domestica) (Diptera: Muscidae) mortality after exposure to commercial fungal formulations in a sugar bait (United States)

    House flies (Musca domestica L.) (Diptera: Muscidae) are major pests of livestock. Biological control is an important tool in an integrated control framework. Increased mortality in filth flies has been documented with entomopathogenic fungi, and several strains are commercially available. Three str...

  14. The affect of Pseudomonas aeruginosa ingestion on antimicrobial peptide (AMP) and lysozyme expression in the common housefly (Musca domestica L.) (United States)

    The common house fly (Musca domestica L.) lives and thrives in one of the most septic niches on Earth, making bacterial exposure imminent. House flies often ingest bacteria and have both physical and chemical defenses utilized to protect themselves from harmful microbes. For example, defense molecul...

  15. Effects of relative humidity, temperature, and population density on production of cuticular hydrocarbons in housefly Musca domestica L.

    NARCIS (Netherlands)

    Noorman, N; Den Otter, CJ

    The production of cuticular hydrocarbons by both males and females of Musca domestica L. under very wet conditions (90% relative humidity) compared to the production at 50 and 20% relative humidity is delayed up to at least 3 days after emergence from the pupae. Eight days after emergence, however,

  16. Genetic variability in apple fruit polyphenol composition in Malus × domestica and Malus sieversii germplasm grown in New Zealand. (United States)

    Volz, Richard K; McGhie, Tony K


    Variations in the concentrations of flavan-3-ol, oligomeric procyanidin, chlorogenic acid, dihydrochalcone, flavonol, and anthocyanin polyphenol groups and total polyphenols were examined in the fruit peel and cortical flesh of 93 (80 Malus × domestica and 13 Malus sieversii) apple genotypes in at least 1 year between 2003 and 2005 grown at one site in New Zealand (NZ). Differences among genotypes accounted for 46-97% of the total variation in the concentrations of total polyphenols and each of the individual phenol groups in the flesh and peel in both species, whereas effects of year and genotype × year were minimal, except for peel flavonols in M. × domestica and flesh flavonols in both species. In these cases, differences among genotypes accounted for less than 30% of the total variation, which was less than the variation found for the interaction between genotype and year. Total polyphenol concentrations among genotypes were spread over a 7- and 9-fold range in the flesh and a 4- and 3-fold range in the peel of M. sieversii and M. × domestica, respectively, with the spread in concentrations of individual polyphenol groups in each tissue and within each species varying from a 2-fold to over a 500-fold range. Higher concentrations were generally found in M. sieversii. In M. × domestica, cultivars and breeding selections originating in NZ had lower average flesh and peel total polyphenols and chlorogenic acid than older cultivars previously imported into NZ from overseas countries.

  17. Reduction of Escherichia coli, Salmonella Enteritidis and Campylobacter jejuni in poultry manure by rearing of Musca domestica fly larvae

    DEFF Research Database (Denmark)

    Nordentoft, Steen; Fischer, C.; Bjerrum, L.


    A major barrier for using animal waste as substrate for production of insects for feed or food is the concern for safety of the end products. In this study we investigated how rearing of fly larvae of Musca domestica in poultry manure influenced the counts of three pathogenic test strains...

  18. ‘Fuji’ apple (Malus domestica Borkh) volatile production during high pCO2 controlled atmosphere storage (United States)

    ‘Fuji’apple [Malus sylvestris var. domestica (Borkh.) Mansf.] volatile compound dynamics were characterized during cold storage in air or at low pO2 controlled atmosphere (CA) with up to 5 kPa CO2. Volatile compounds in storage chambers were adsorbed onto solid sorbent traps and analyzed by GC-MS....

  19. Genome of the house fly, Musca domestica L., a global vector of diseases with adaptations to a septic environment

    NARCIS (Netherlands)

    Scott, Jeffrey G; Warren, Wesley C; Beukeboom, Leo W; Bopp, Daniel; Clark, Andrew G; Giers, Sarah D; Hediger, Monika; Jones, Andrew K; Kasai, Shinji; Leichter, Cheryl A; Li, Ming; Meisel, Richard P; Minx, Patrick; Murphy, Terence D; Nelson, David R; Reid, William R; Rinkevich, Frank D; Robertson, Hugh M; Sackton, Timothy B; Sattelle, David B; Thibaud-Nissen, Francoise; Tomlinson, Chad; Jacobus Mgn Van De Zande, Louis; Walden, Kimberly; Wilson, Richard K; Liu, Nannan


    BACKGROUND: Adult house flies, Musca domestica L., are mechanical vectors of more than 100 devastating diseases that have severe consequences for human and animal health. House fly larvae play a vital role as decomposers of animal wastes, and thus live in intimate association with many animal pathog

  20. 'HoneySweet' (C5), the first genetically engineered Plum pox virus-resistant plum (Prunus domestica L.) cultivar (United States)

    ‘HoneySweet’ plum was released by the U.S. Department of Agriculture, Agricultural Research Service, to provide U.S. growers and P. domestica plum breeders with a high fruit quality plum cultivar resistant to Plum pox virus (PPV). ‘HoneySweet’ was developed through genetic engineering utilizing the...

  1. Habronema muscae (Nematoda: Habronematidae) larvae: developmental stages, migration route and morphological changes in Musca domestica (Diptera: Muscidae). (United States)

    Amado, Sávio; Silveira, Andrea Kill; Vieira, Flávio Dias; Traversa, Donato


    The present paper describes the morphological modifications occurring during the larval development of Habronema muscae (Nematoda: Habronematidae) in Musca domestica (Diptera: Muscidae), along with the reactions caused by parasitism and the migration route of the nematodes inside the flies. Houseflies were reared on faeces of a H. muscae-infected horse, then dissected and processed by histology. The experimental part of the study was performed in 1996 in the Parasitological Experimental Station W.O. Neitz, Federal Rural University of Rio de Janeiro, Seropédica, Rio de Janeiro State, Brazil. Three different larval stages of H. muscae were recovered, measured and described. The encapsulation of larval nematodes was found in the third larval instar (L3) of M. domestica and cryptocephalic pupa. The mature capsules were observed in dipteran L3, pupae and mainly adults. In 1day-old or more M. domestica adults an active rupturing of capsules by H. muscae L3 and the migration to the head through the circulatory system and insect hemocoel were observed. Infective H. muscae L3s remained exclusively in the head of adult 5days-old or more M. domestica.

  2. Effects of relative humidity, temperature, and population density on production of cuticular hydrocarbons in housefly Musca domestica L.

    NARCIS (Netherlands)

    Noorman, N; Den Otter, CJ


    The production of cuticular hydrocarbons by both males and females of Musca domestica L. under very wet conditions (90% relative humidity) compared to the production at 50 and 20% relative humidity is delayed up to at least 3 days after emergence from the pupae. Eight days after emergence, however,

  3. Sex-, age- and strain-related quantities of muscalure on the cuticula of the housefly (Musca domestica)

    NARCIS (Netherlands)

    Noorman, N; denOtter, CJ; Sommeijer, MJ; Francke, PJ


    Muscalure, (Z)-9-tricosene, is the major component of the cuticular contact sex pheromone of female houseflies, Musca domestica. By means of gas chromatography the relative amounts of muscalure were determined on female and male houseflies of different sex, age and strain. Females and males of mixed

  4. Types and Numbers of Sensilla on Antennae and Maxillary Palps of Small and Large Houseflies, Musca domestica (Diptera, Muscidae)

    NARCIS (Netherlands)

    Smallegange, Renate C.; Kelling, Frits J.; Den Otter, Cornelis J.


    Houseflies, Musca domestica, obtained from a high-larval-density culture were significantly (ca. 1.5 times) smaller than those from a low-larval-density culture. The same held true for their antennae and maxillary palps. Structure, number, and distribution of sensilla on antennae and palps of small

  5. F1 hybrid of cultivated apple (Malus x domestica) and European pear (Pyrus communis) with fertile F2 offspring

    NARCIS (Netherlands)

    Fischer, T.C.; Malnoy, M.; Hofmann, T.; Schwab, W.; Palmieri, L.; Wehrens, H.R.M.J.; Schuch, L.A.; Müller, M.; Schimmelpfeng, H.; Velasco, R.; Martens, S.


    The establishment of intergeneric hybrids for horticultural and agricultural crops is still a demanding task for breeding programmes. The aim of such approaches is to introduce new quality and resistance traits and to enlarge the gene pool. Recently, an F1 hybrid between Malus × domestica and Pyrus

  6. Effect of four commercial fungal formulations on mortality and sporulation of house flies (Musca domestica) and stable flies (Stomoxys calcitrans) (United States)

    House flies (Musca domestica L.) and stable flies (Stomoxys calcitrans (L.)) (Diptera: Muscidae) are major pests of livestock. Biological control is an important tool in an integrated control framework. Increased mortality in filth flies has been documented with entomopathogenic fungi, and several s...

  7. The effect of gamma irradiation on curcumin component of Curcuma domestica

    Energy Technology Data Exchange (ETDEWEB)

    Chosdu, R.E.; Erizal; Iriawan, T.; Hilmy, N. [National Atomic Energy Agency, Jakarta (Indonesia). Center for Applications of Isotopes and Radiation


    The effect of gamma irradiation on curcumin component of Curcuma domestica rhizome were investigated. Pure curcumin, sliced and powdered rhizome with 10% of moisture content were irradiated at 0, 10, 30 and 50 kGy (dose rate of 6 kGy/h). Curcumin content was analysed using HPLC method and ESR spectra. Results show that free radicals are already present in unirradiated rhizome. Gamma irradiation at the doses of 10, 30 and 50 kGy induced the free radicals formation of pure curcumin and curcuma domestica rhizome. The ESR spectra of irradiated rhizome gave a very similar spectra to the signal of irradiated pure curcumin. The percentage of free radicals intensity from pure curcumin was very stable at room temperature up to 670 hours of storage. However, the percentage intensity of free radicals in the irradiated rhizome were decay during storage. Irradiation treatment and storage time did not give a significant change on curcumin content, water activity, pH and moisture content of rhizome investigated. (Author).

  8. The effect of gamma irradiation on curcumin component of Curcuma domestica (United States)

    Chosdu, R.; Erizal; Iriawan, T.; Hilmy, N.


    The effect of gamma irradiation on curcumin component of Curcuma domestica rhizome were investigated. Pure curcumin, sliced and powdered rhizome with 10% of moisture content were irradiated at 0, 10, 30 and 50 kGy (dose rate of 6 kGy/h). Curcumin content was analysed using HPLC method and ESR spectra. Results show that free radicals are already present in unirradiated rhizome. Gamma irradiation at the doses of 10, 30 and 50 kGy induced the free radicals formation of pure curcumin and Curcuma domestica rhizome. The ESR spectra of irradiated rhizome gave a very similar spectra to the signal of irradiated pure curcumin. The percentage of free radicals intensity from pure curcumin was very stable at room temperature up to 670 hours of storage. However, the percentage intensity of free radicals in the irradiated rhizome were decay during storage. Irradiation treatment and storage time did not give a significant change on curcumin content, water activity, pH and moisture content of rhizome investigated.

  9. Heat shock transcriptional factors in Malus domestica: identification, classification and expression analysis

    Directory of Open Access Journals (Sweden)

    Giorno Filomena


    Full Text Available Abstract Background Heat shock transcriptional factors (Hsfs play a crucial role in plant responses to biotic and abiotic stress conditions and in plant growth and development. Apple (Malus domestica Borkh is an economically important fruit tree whose genome has been fully sequenced. So far, no detailed characterization of the Hsf gene family is available for this crop plant. Results A genome-wide analysis was carried out in Malus domestica to identify heat shock transcriptional factor (Hsf genes, named MdHsfs. Twenty five MdHsfs were identified and classified in three main groups (class A, B and C according to the structural characteristics and to the phylogenetic comparison with Arabidopsis thaliana and Populus trichocarpa. Chromosomal duplications were analyzed and segmental duplications were shown to have occurred more frequently in the expansion of Hsf genes in the apple genome. Furthermore, MdHsfs transcripts were detected in several apple organs, and expression changes were observed by quantitative real-time PCR (qRT-PCR analysis in developing flowers and fruits as well as in leaves, harvested from trees grown in the field and exposed to the naturally increased temperatures. Conclusions The apple genome comprises 25 full length Hsf genes. The data obtained from this investigation contribute to a better understanding of the complexity of the Hsf gene family in apple, and provide the basis for further studies to dissect Hsf function during development as well as in response to environmental stimuli.

  10. Molecular detection and antimicrobial resistance of Aeromonas from houseflies (Musca domestica in Iran

    Directory of Open Access Journals (Sweden)

    Davood Ommi


    Full Text Available Objective. This study aimed to report the molecular detection and antimicrobial resistance of Aeromonas among houseflies (Musca domestica in Shahrekord and Isfahan provinces of Iran. Materials and methods. Flies were caught from household kitchens, cattle farms, animal hospitals, human hospitals, slaughter house and poultry farms and put in collection separate sterile tubes. Isolation was accomplished by culture of flies in alkaline peptone water followed by identification with Aeromonas-specific Polymerase Chain Reaction (PCR. Results. Out of 600 houseflies 73 (12.2% were infected with Aeromonas spp. Significantly higher frequencies of Aeromonas were isolated in Shahrekord province (13.0%; 39/300 than in Isfahan province (11.3%; 34/300. The recovery frequencies of the organisms were significantly lower in kitchens as compared to those in cattle farms and hospital wards which were similar. Higher proportions of infected flies were obtained during summer whereas low proportions were obtained during winter. Conclusions. It is concluded that houseflies do harbor diarrheagenic pathogens, including Aeromonas especially during summer. The carried organisms are resistant to a number of antimicrobials at different levels. Thus, future plans aimed at stemming infections caused by these organisms should take flies into account. Control efforts of infections caused by this particular bacterium should therefore take into account Musca domestica.

  11. Evaluation of cold shock-induced cytotoxicity and genotoxicity in the house fly Musca domestica

    Directory of Open Access Journals (Sweden)

    Nidhi Mishra


    Full Text Available Background: Low temperature affects the survival, growth and development of invertebrates, especially insects, based on the severity of cold and the duration of exposure. Although the effects of cold shock or direct chilling were previously analysed in terms of development patterns and defects, morphological changes, cold hardiness, cryopreservation and diapause in insects, very little information is available regarding the effects of cold shock at the chromosomal level. Material and Methods: Late third instar larvae of the house fly Musca domestica were exposed to low temperatures (10, 4, 0 and -5°C for different durations, in order to assess genotoxicity and cytotoxicity in the present study. The chromosomal aberration assay and micronucleus test were used as genotoxic end points. Cytotoxicity was evaluated by the mitotic index and the extent of tissue damage was observed using the Trypan blue staining method. Results: A significant (P<0.05, P<0.01 and P<0.001 increase in chromosome aberrations and micronucleus frequency was observed in all of the exposed groups compared to the control. The mitotic index showed a dose-dependent increase; however, it was lower in comparison to the control. The developmental patterns in exposed larvae exhibited an increase in larval mortality and a delay in adult emergence. Extensive tissue damage was observed at -5°C by Trypan blue staining. Conclusions: The present work suggests that cold shock induces chromosome aberrations and cytotoxicity and affects the developmental pattern in house fly, M. domestica.

  12. Boron Toxicity Causes Multiple Effects on Malus domestica Pollen Tube Growth (United States)

    Fang, Kefeng; Zhang, Weiwei; Xing, Yu; Zhang, Qing; Yang, Liu; Cao, Qingqin; Qin, Ling


    Boron is an important micronutrient for plants. However, boron is also toxic to cells at high concentrations, although the mechanism of this toxicity is not known. This study aimed to evaluate the effect of boron toxicity on Malus domestica pollen tube growth and its possible regulatory pathway. Our results showed that a high concentration of boron inhibited pollen germination and tube growth and led to the morphological abnormality of pollen tubes. Fluorescent labeling coupled with a scanning ion-selective electrode technique detected that boron toxicity could decrease [Ca2+]c and induce the disappearance of the [Ca2+]c gradient, which are critical for pollen tube polar growth. Actin filaments were therefore altered by boron toxicity. Immuno-localization and fluorescence labeling, together with fourier-transform infrared analysis, suggested that boron toxicity influenced the accumulation and distribution of callose, de-esterified pectins, esterified pectins, and arabinogalactan proteins in pollen tubes. All of the above results provide new insights into the regulatory role of boron in pollen tube development. In summary, boron likely plays a structural and regulatory role in relation to [Ca2+]c, actin cytoskeleton and cell wall components and thus regulates Malus domestica pollen germination and tube polar growth. PMID:26955377


    Directory of Open Access Journals (Sweden)

    Pedro Ivan Fazio Junior


    Full Text Available The activity of the insecticide thiamethoxam on populationsof Musca domestica was assessed through in vitro tests, controlledenvironment and field conditions. The flies were gathered from a colony maintained by the Laboratory of Parasitic Diseases, Department of Epidemiology and Public Health, Universidade Federal Rural do Rio de Janeiro, and from the landfill of the city of Seropédica-RJ, Brazil. Regarding the in vitro assay, thiamethoxan was previously diluted in acetone, resulting in concentrations of 5, 7.5, 10, 12.5, 15, 17.5, 20, 22.5, 25, 27, 5 and 30 mg/ml. Then, filter paper discs were impregnated with 1 ml of each of these dilutions. Thus, the test was conducted with adult flies maintained in Petri dishes. For the controlled environment and field conditions, trial baits were used with the active or a placebo (control group. The lethal concentration 50 (LC50 of thiamethoxam on M. domestica found in the in vitro assay was 0.2612 mg / cm ². The efficacy of thiamethoxan baits on the controlled environment and field conditionstrials was 94.06 % and 98.09 %, respectively.

  14. Evaluation of the house fly Musca domestica as a mechanical vector for an anthrax.

    Directory of Open Access Journals (Sweden)

    Antonio Fasanella

    Full Text Available Anthrax is a disease of human beings and animals caused by the encapsulated, spore-forming, Bacillus anthracis. The potential role of insects in the spread of B. anthracis to humans and domestic animals during an anthrax outbreak has been confirmed by many studies. Among insect vectors, the house fly Musca domestica is considered a potential agent for disease transmission. In this study, laboratory-bred specimens of Musca domestica were infected by feeding on anthrax-infected rabbit carcass or anthrax contaminated blood, and the presence of anthrax spores in their spots (faeces and vomitus was microbiologically monitored. It was also evaluated if the anthrax spores were able to germinate and replicate in the gut content of insects. These results confirmed the role of insects in spreading anthrax infection. This role, although not major, given the huge size of fly populations often associated with anthrax epidemics in domestic animals, cannot be neglected from an epidemiological point of view and suggest that fly control should be considered as part of anthrax control programs.

  15. Evaluation of the House Fly Musca domestica as a Mechanical Vector for an Anthrax (United States)

    Fasanella, Antonio; Scasciamacchia, Silvia; Garofolo, Giuliano; Giangaspero, Annunziata; Tarsitano, Elvira; Adone, Rosanna


    Anthrax is a disease of human beings and animals caused by the encapsulated, spore-forming, Bacillus anthracis. The potential role of insects in the spread of B. anthracis to humans and domestic animals during an anthrax outbreak has been confirmed by many studies. Among insect vectors, the house fly Musca domestica is considered a potential agent for disease transmission. In this study, laboratory-bred specimens of Musca domestica were infected by feeding on anthrax-infected rabbit carcass or anthrax contaminated blood, and the presence of anthrax spores in their spots (faeces and vomitus) was microbiologically monitored. It was also evaluated if the anthrax spores were able to germinate and replicate in the gut content of insects. These results confirmed the role of insects in spreading anthrax infection. This role, although not major, given the huge size of fly populations often associated with anthrax epidemics in domestic animals, cannot be neglected from an epidemiological point of view and suggest that fly control should be considered as part of anthrax control programs. PMID:20808920

  16. Temperature and population density effects on locomotor activity of Musca domestica (Diptera: Muscidae). (United States)

    Schou, T M; Faurby, S; Kjærsgaard, A; Pertoldi, C; Loeschcke, V; Hald, B; Bahrndorff, S


    The behavior of ectotherm organisms is affected by both abiotic and biotic factors. However, a limited number of studies have investigated the synergistic effects on behavioral traits. This study examined the effect of temperature and density on locomotor activity of Musca domestica (L.). Locomotor activity was measured for both sexes and at four densities (with mixed sexes) during a full light and dark (L:D) cycle at temperatures ranging from 10 to 40°C. Locomotor activity during daytime increased with temperature at all densities until reaching 30°C and then decreased. High-density treatments significantly reduced the locomotor activity per fly, except at 15°C. For both sexes, daytime activity also increased with temperature until reaching 30 and 35°C for males and females, respectively, and thereafter decreased. Furthermore, males showed a significantly higher and more predictable locomotor activity than females. During nighttime, locomotor activity was considerably lower for all treatments. Altogether the results of the current study show that there is a significant interaction of temperature and density on daytime locomotor activity of M. domestica and that houseflies are likely to show significant changes in locomotor activity with change in temperature.

  17. Cloning, expression, and purification of a new antimicrobial peptide gene from Musca domestica larva. (United States)

    Pei, Zhihua; Sun, Xiaoning; Tang, Yan; Wang, Kai; Gao, Yunhang; Ma, Hongxia


    Musca domestica (Diptera: Muscidae), the housefly, exhibits unique immune defences and can produce antimicrobial peptides upon stimulation with bacteria. Based on the cDNA library constructed using the suppression subtractive hybridization (SSH) method, a 198-bp antimicrobial peptide gene, which we named MDAP-2, was amplified by rapid amplification of cDNA ends (RACE) from M. domestica larvae stimulated with Salmonella pullorum (Enterobacteriaceae: Salmonella). In the present study, the full-length MDAP-2 gene was cloned and inserted into a His-tagged Escherichia coli prokaryotic expression system to enable production of the recombinant peptide. The recombinant MDAP-2 peptide was purified using Ni-NTA HisTrap FF crude column chromatography. The bacteriostatic activity of the recombinant purified MDAP-2 protein was assessed. The results indicated that MDAP-2 had in vitro antibacterial activity against all of the tested Gram- bacteria from clinical isolates, including E. coli (Enterobacteriaceae: Escherichia), one strain of S. pullorum (Enterobacteriaceae: Salmonella), and one strain of Pasteurella multocida. DNA sequencing and BLAST analysis showed that the MDAP-2 antimicrobial peptide gene was not homologous to any other antimicrobial peptide genes in GenBank. The antibacterial mechanisms of the newly discovered MDAP-2 peptide warrant further study.

  18. Chlorophyll Catabolites in Senescent Leaves of the Plum Tree (Prunus domestica). (United States)

    Erhart, Theresia; Mittelberger, Cecilia; Vergeiner, Clemens; Scherzer, Gerhard; Holzner, Barbara; Robatscher, Peter; Oberhuber, Michael; Kräutler, Bernhard


    In cold extracts of senescent leaves of the plum tree (Prunus domestica ssp. domestica), six colorless non-fluorescent chlorophyll catabolites (NCCs) were characterized, named Pd-NCCs. In addition, several minor NCC fractions were tentatively classified. The structure of the most polar one of the NCCs, named Pd-NCC-32, featured an unprecedented twofold glycosidation pattern. Three of the NCCs are also functionalized at their 3(2) -position by a glucopyranosyl group. In addition, two of these glycosidated NCCs carry a dihydroxyethyl group at their 18-position. In the polar Pd-NCC-32, the latter group is further glycosidated at the terminal 18(2) -position. Four other major Pd-NCCs and one minor Pd-NCC were identified with five NCCs from higher plants known to belong to the 'epi'-series. In addition, tentative structures were derived for two minor fractions, classified as yellow chlorophyll catabolites, which represented (formal) oxidation products of two of the observed Pd-NCCs. The chlorophyll catabolites in leaves of plum feature the same basic structural pattern as those found in leaves of apple and pear trees.

  19. Geometric correlation of cultural landscape patterns and Prunus domestica L. species leaf

    Directory of Open Access Journals (Sweden)

    Jović Biljana


    Full Text Available This paper provides the basics for more detailed research on the structures of bionic forms of different plant species and their application in the domain of landscape planning. The aim of this type of research is to expand knowledge of landscape planning with a deeper understanding of different geometric relations present in the existing natural forms. The correlation between structures in nature and structures that are present in contemporary landscape architecture could be established by the congruence with the geometric models from landscape. This paper is focused solely on the geometry of natural forms. The Voronoi diagram was used in order to examine the similarities and to perform a comparative analysis of the Prunus domestica L. leaf geometry and the geometry of cultural landscapes of Central Serbia. The resulting Voronoi diagram shows the similarity based on closed fields, Voronoi cells, which correspond to the nervation of Prunus domestica L. leaf by form. Using the comparative analysis, the geometric interpretation of cultural landscape examples could be linked to the geometric structure of the most frequent fruit tree species.

  20. The larval development of Habronema muscae (Nematoda: Habronematidae) affects its intermediate host, Musca domestica (Diptera: Muscidae). (United States)

    Schuster, Rolf Karl; Sivakumar, Saritha


    Although the life cycle of the equid stomach parasite Habronema muscae was disclosed more than 100 years ago, little is known about the effect of the developing nematode larvae in its intermediate host, Musca domestica. In a series of experiments, freshly hatched M. domestica larvae were exposed to H. muscae eggs contained in a faecal sample of a naturally infected horse. In daily intervals, 50 fly larvae were removed and transferred on a parasite-free larval rearing medium where they completed their development. Hatched flies were examined for the presence of Habronema third-stage larvae. In two subsequent control groups, flies spend their entire larval life in contaminated horse faeces and in a parasite-free larval rearing medium, respectively. Out of the 700 fly larvae used in the infection experiments, 304 developed into adult flies of which 281 were infected. The average nematode larval burden rose from 3.6 in the group with the shortest exposure to more than 25 in the groups with the longest exposure. The proportion of larvae that developed into the adult insect fell from 82 % in the uninfected control group to 27 % in the positive control group. The pupae of the positive control group were smaller and lighter than those of the uninfected control group. Lower pupal size and weight in the positive control group as well as a lower insect developing rate might be attributed to the destruction of adipose cells in the maggots by Habronema larvae.

  1. Expression and Enzyme Activity Detection of a Sepiapterin Reductase Gene from Musca domestica Larva. (United States)

    Tang, Yan; Pei, Zhihua; Liu, Lei; Wang, Dongfang; Kong, Lingcong; Liu, Shuming; Jiang, Xiuyun; Gao, Yunhang; Ma, Hongxia


    Tetrahydrobiopterin (BH4) is an essential cofactor for aromatic acid hydroxylases and nitric oxide synthase. Sepiapterin reductase (SPR) catalyzes the final steps of BH4 biosynthesis. Studies on SPR from several insects and other organisms have been reported. However, thus far, enzyme activity of SPR in Musca domestica is kept unknown. In this study, 186 differentially expressed genes including SPR gene from Musca domestica (MDSPR) were screened in subtractive cDNA library. The MDSPR gene was cloned, and the recombinant MDSPI16 protein was expressed as a 51-kDa protein in soluble form. The MDSPR exhibited strong activity to the substrate sepiapterin (SP). The values of Vmax and Km of the MDSPR for SP were 6.83 μM/min and 23.48 μM, and the optimum temperature and pH of MDSPR were 50 °C and 4.0, respectively. This study provides new hypotheses and methods for the production of BH4 using insect-derived SPR.

  2. Boron toxicity causes multiple effects on Malus domestica pollen tube growth

    Directory of Open Access Journals (Sweden)

    Kefeng eFang


    Full Text Available Boron is an essential micronutrient for plants. However, boron is also toxic to cells at high concentrations, although the mechanism of this stress is not known. This study aimed to evaluate the effect of boron stress on Malus domestica pollen tube growth and its possible regulatory pathway. Our results show that a high concentration of boron inhibited pollen germination and tube growth and led to the morphological abnormality of pollen tubes. Fluorescent labeling coupled with a scanning ion-selective electrode technique detected that boron stress could decrease [Ca2+]c and induce the disappearance of the [Ca2+]c gradient, which are critical for pollen tube polar growth. Actin filaments were therefore altered by boron stress. Immuno-localization and fluorescence labeling, together with Fourier-transform infrared analysis (FTIR, suggested that boron stress influenced the accumulation and distribution of callose, de-esterified pectins, esterified pectins and arabinogalactan proteins in pollen tubes. All of the above results provide new insights into the regulatory role of boron in pollen tube development. In summary, boron likely plays a structural and regulatory role in relation to [Ca2+]c, actin cytoskeleton and cell wall components and thus regulates Malus domestica pollen germination and tube polar growth.

  3. Resistance of Malus domestica fruit to Botrytis cinerea depends on endogenous ethylene biosynthesis. (United States)

    Akagi, Aya; Dandekar, Abhaya M; Stotz, Henrik U


    The plant hormone ethylene regulates fruit ripening, other developmental processes, and a subset of defense responses. Here, we show that 1-aminocyclopropane-1-carboxylic acid synthase (ACS)-silenced apple (Malus domestica) fruit that express a sense construct of ACS were more susceptible to Botrytis cinerea than untransformed apple, demonstrating that ethylene strengthens fruit resistance to B. cinerea infection. Because ethylene response factors (ERFs) are known to contribute to resistance against B. cinerea via the ethylene-signaling pathway, we cloned four ERF cDNAs from fruit of M. domestica: MdERF3, -4, -5, and -6. Expression of all four MdERF mRNAs was ethylene dependent and induced by wounding or by B. cinerea infection. B. cinerea infection suppressed rapid induction of wound-related MdERF expression. MdERF3 was the only mRNA induced by wounding and B. cinerea infection in ACS-suppressed apple fruit, although its induction was reduced compared with wild-type apple. Promoter regions of all four MdERF genes were cloned and putative cis-elements were identified in each promoter. Transient expression of MdERF3 in tobacco increased expression of the GCC-box containing gene chitinase 48.

  4. Genetic characterization of the domestic pig (Sus scrofa domestica in Cerete-Colombia, using microsatellite markers

    Directory of Open Access Journals (Sweden)

    Iván Meléndez G.


    Full Text Available Objective. The purpose of this study was to characterize a population of domestic pig (Sus scrofa domestica in Cereté, Córdoba, using 20 microsatellite; calculate heterozygosity per locus and average heterozygosity. Materials and methods. Hair samples were collected from 62 specimens. DNA was extracted by proteinase K digestion and phenol-chloroform purification. Information from 20 microsatellites was selected out of those recommended for swine biodiversity studies. PCR products were separated by a vertical polyacrylamide gel electrophoresis. The bands were visualized by staining with silver nitrate. Results. All microsatellites used were polymorphic. Between 3 (SW1067 and 15 (IFNG alleles were detected with an average number of 6.7 and a total de 134 alleles. The average expected and observed heterozygosities were 0.5278 and 0.5479, respectively. PIC values ranged between 0.1999 and 0.8300 for loci SW1067 and SW911, respectively. Conclusions. Levels of observed and expected heterozygosity found in the present study indicate that the domestic pig (Sus scrofa domestica in Córdoba Cereté show high degree of genetic variability

  5. Characterisation of Sorbus domestica L. Bark, Fruits and Seeds: Nutrient Composition and Antioxidant Activity

    Directory of Open Access Journals (Sweden)

    Boris Majić


    Full Text Available The aim of this work is to assess the nutritional value of service tree (Sorbus domestica L. bark, fruit exocarp and mesocarp, and seeds by establishing the levels of macro- and microelements, total phenolics, flavonoids and tannins. Our results revealed that all of the tested service tree samples were rich in potassium. Bark was the best source of calcium and zinc, while seeds were the best source of magnesium. Compared to the bark and seeds, fruit exocarp and mesocarp contained significantly lower amounts of these three elements. Immature exocarp and bark contained the highest amounts of total phenolics and showed the highest antioxidant activity. Maturation significantly decreased the amount of total phenolics in fruits, as well as the antioxidant activity of total phenolics and total tannins from exocarp, but not from mesocarp. Exocarp was the richest in total flavonoids. Based on the obtained data, we have concluded that the under-utilised species S. domestica L. could serve as an important source of mineral elements and antioxidants in the human diet.

  6. A novel bioconversion for value-added products from food waste using Musca domestica. (United States)

    Niu, Yi; Zheng, Dong; Yao, Binghua; Cai, Zizhe; Zhao, Zhimin; Wu, Shengqing; Cong, Peiqing; Yang, Depo


    Food waste, as a major part of the municipal solid waste has been generated increasingly worldwide. Efficient and feasible utilization of this waste material for productivity process is significant for both economical and environmental reasons. In the present study, Musca domestica larva was used as the carrier to conduct a bioconversion with food waste to get the value-added maggot protein, oil and organic fertilizers. Methods of adult flies rearing, culture medium adjuvant selection, maggot culture conditions, stocking density and the valorization of the waste have been explored. From the experimental results, every 1000g culture mediums (700g food waste and 300g adjuvant) could be disposed by 1.5g M. domestica eggs under proper culture conditions after emergence in just 4days, 42.95±0.25% of which had been consumed and the culture medium residues could be used as good organic fertilizers, accompanying with the food waste consumption, ∼53.08g dried maggots that contained 57.06±2.19% protein and 15.07±2.03% oil had been produced. The maggot protein for its outstanding pharmacological activities is regarded as a good raw material in the field of medicine and animal feeding. Meanwhile, the maggot oil represents a potential alternative feedstock for biodiesel production. In our study, the maggot biodiesel was obtained after the procedure of transesterification reaction with methanol and the productivity was 87.71%.

  7. The aphrodisiac effect and toxicity of combination Piper retrofractum L, Centella asiatica, and Curcuma domestica infusion

    Directory of Open Access Journals (Sweden)

    Nuning Rahmawati


    Full Text Available Abstrak Latar belakang: Cabe jawa (Piper retrofractum L merupakan salah satu tanaman yang diketahui memiliki efek stimulan pada tubuh. Dari penelitian pendahuluan diketahui bahwa dalam bentuk infusa, LD50 nya rendah dan termasuk bahan yang tidak toksik. Infusa pada tikus putih dengan dosis 2,1 mg/10 gram berat badan mempunyai efek androgenik dan anabolik. Alkaloid utama dalam buah cabe jawa yang diduga merupakan senyawa aktif berkhasiat afrodisiaka adalah piperin. Pegagan (Centella asiatica dan temulawak (Curcuma domestica berfungsi sebagai bahan tambahan pendukung. Penelitian ini bertujuan untuk mengetahui toksisitas dan efek afrodisiaka infus ramuan buah cabe jawa, pegagan, dan temulawak pada tikus jantan. Metode: Parameter efek afrodisiaka dilihat dari frekuensi introduction, climbing, dan coitus tikus jantan dibandingkan kontrol serta kadar hormon testosteron sebelum dan sesudah perlakuan. Toksisitas subkronik ditentukan dari kadar SGOT, SGPT, ureum, dan kreatinin sebelum dan sesudah pemberian infusa ramuan selama 3 bulan.Hasil: Terdapat perbedaan yang signifi kan parameter frekuensi climbing dan coitus antara kelompok kontrol dan kelompok yang diberi infusa ramuan (P=0,032. Sementara pemberian infusa ramuan Piper retrofractum L., Centella asiatica, dan Curcuma domestica tidak menyebabkan perbedaan yang signifi kan kadar hormon testosteron tikus jantan sebelum dan sesudah perlakuan. Pemberian infusa ramuan dosis tinggi (5000 mg/200g BB menyebabkan perubahan yang signifi kan kadar SGOT, SGPT dan ureum tikus kelompok perlakuan.Kesimpulan: Infusa ramuan cabe jawa, pegagan, dan temulawak memiliki efek afrodisiaka pada libido tikus jantan galur SD dan pemberian ramuan dosis 5000mg/200g BB tikus setiap hari selama 3 bulan berturut-turut menyebabkan peningkatan yang signifi kan kadar SGOT, SGPT, dan ureum tikus. (Health Science Indones 2012;1:19-22 Kata kunci: afrodisiaka, toksisitas, Piper retrofractum LAbstractIntroduction: Piper retrofractum L

  8. The blow fly, Chrysomya megacephala, and the house fly, Musca domestica, as mechanical vectors of pathogenic bacteria in Northeast Thailand. (United States)

    Chaiwong, T; Srivoramas, T; Sueabsamran, P; Sukontason, K; Sanford, M R; Sukontason, K L


    The Oriental latrine fly, Chrysomya megacephala (Fabricius) (Diptera: Calliphoridae) and the house fly, Musca domestica L., (Diptera: Muscidae) are synanthropic flies which are adapted to live in close association with human habitations, thereby making them likely mechanical vectors of several pathogens to humans. There were two main aims of this study. The first aim was to determine the prevalence of these two fly species from five types of human habitations including: fresh-food markets, garbage piles, restaurants, school cafeterias and paddy fields, in the Muang Ubon Ratchathani and Warinchamrap districts of Ubon Ratchathani province of Northeast Thailand. Flies collection were conducted monthly from September 2010-October 2011 using a reconstructable funnel trap, containing 1 day-tainted beef offal as bait. A total of 7 750 flies (6 401 C. megacephala and 1 349 M.domestica) were collected. The second aim was to examine the potential of these flies to carry pathogenic bacteria. Bacteria were isolated from 994 individual flies collected using a sweep net (555 C. megacephala and 439 M. domestica). A total of 15 bacterial genera were isolated from the external surfaces, comprising ten genera of gram-negative bacteria and five gram-positive bacteria. The most common bacteria isolated from both species were coagulase-negative staphylococci, followed by Streptococcus group D non-enterococci. Human pathogenic enteric bacteria isolated were Salmonella sp., Shigella sp., Escherichia coli O157:H7, Salmonella typhi, Bacillus sp., and Enterococcus sp., of which S. typhi is the first report of isolation from these fly species. Other human pathogens included Staphylococcus aureus and Pseudomonas aeruginosa. Not only were the number of C. megacephala positive for bacteria significantly higher than for M. domestica, but they were also carrying ~11-12 times greater bacterial load than M. domestica. These data suggest that both fly species should be considered potential

  9. The cellular composition of the marsupial neocortex. (United States)

    Seelke, Adele M H; Dooley, James C; Krubitzer, Leah A


    In the current investigation we examined the number and proportion of neuronal and non-neuronal cells in the primary sensory areas of the neocortex of a South American marsupial, the short-tailed opossum (Monodelphis domestica). The primary somatosensory (S1), auditory (A1), and visual (V1) areas were dissected from the cortical sheet and compared with each other and the remaining neocortex using the isotropic fractionator technique. We found that although the overall sizes of V1, S1, A1, and the remaining cortical regions differed from each other, these divisions of the neocortex contained the same number of neurons, but the remaining cortex contained significantly more non-neurons than the primary sensory regions. In addition, the percent of neurons was higher in A1 than in the remaining cortex and the cortex as a whole. These results are similar to those seen in non-human primates. Furthermore, these results indicate that in some respects, such as number of neurons, the neocortex is homogenous across its extent, whereas in other aspects of organization, such as non-neuronal number and percentage of neurons, there is non-uniformity. Whereas the overall pattern of neuronal distribution is similar between short-tailed opossums and eutherian mammals, short-tailed opossum have a much lower cellular and neuronal density than other eutherian mammals. This suggests that the high neuronal density cortices of mammals such as rodents and primates may be a more recently evolved characteristic that is restricted to eutherians, and likely contributes to the complex behaviors we see in modern mammals.

  10. Thaumasioscolex didelphidis n. gen., n. sp. (Eucestoda: Proteocephalidae) from the black-eared opossum Didelphis marsupialis from Mexico, the first proteocephalidean tapeworm from a mammal. (United States)

    Cañeda-Guzmán, I C; de Chambrier, A; Scholz, T


    Thaumasioscolex didelphidis n. gen., n. sp. is described from the intestine of the black-eared opossum Didelphis marsupialis L. (Marsupialia: Didelphidae) from Los Tuxtlas, Veracruz, Mexico. The new genus differs from all proteocephalidean genera in the morphology of the scolex that is formed by 4 well separated lobes each containing 1 noncircular sucker opening laterally inside the exterolateral cavity, a large-sized body (length up to 1 m), a large number of testes, the shape of gravid proglottids that are inversely craspedote (the anterior border of a proglottid overlaps the posterior border of a preceding proglottid), eggs in groups mostly of 4-6 eggs each, and an embryophore bearing digitiform projections on its external surface. This is the first tapeworm of the Proteocephalidea, the members of which were previously reported exclusively from poikilotherm vertebrates (freshwater fishes, amphibians, and reptiles), found in a homoiotherm vertebrate.

  11. Turgida turgida (Nematoda: Physalopteridae parasitic in white-bellied opossum, Didelphis albiventris (Marsupialia: Didelphidae, state of Mato Grosso do Sul, Brazil

    Directory of Open Access Journals (Sweden)

    Roberta M.P. Humberg


    Full Text Available Turgida turgida have been largely reported parasitizing Didelphis species in North and South America based on light microscopy observation. However, the features that differentiate T. turgida from other physalopterid species should be observed using scanning electron microscopy (SEM. A female white-bellied opossum, Didelphis albiventris, arrived dead at the Centro de Reabilitação de Animais Silvestres (CRAS in the municipality of Campo Grande, state of Mato Grosso do Sul, Brazil. During the necropsy, adult nematodes were collected from stomach and intestine. The nematodes were determined to be adult specimens and submitted to SEM for the species determination. This is the first report of T. turgida confirmed by SEM in the Neotropical region and the first report in an urban area in the state of Mato Grosso do Sul, Brazil.

  12. Genetics and realized heritability of resistance to imidacloprid in a poultry population of house fly, Musca domestica L. (Diptera: Muscidae) from Pakistan. (United States)

    Khan, Hussnain; Abbas, Naeem; Shad, Sarfraz Ali; Afzal, Muhammad Babar Shahzad


    Imidacloprid, a post-synaptic, nicotinic insecticide, has been commonly used for the management of different pests including Musca domestica worldwide. Many pests have developed resistance to this insecticide. A 16-fold imidacloprid-resistant population of M. domestica infesting poultry was selected using imidacloprid for 13 continuous generations to study the inheritance and realized heritability of resistance. Toxicological bioassay at G14 showed that the imidacloprid-selected population developed 106-fold resistance when compared to the susceptible population. Reciprocal crosses of susceptible and resistant populations showed an autosomal trait of resistance to imidacloprid in M. domestica. There was incompletely recessive resistance in F1 (Imida-SEL ♂ × Susceptible ♀) and F1(†) (Imida-SEL ♀ × Susceptible ♂) having dominance value 0.53 and 0.31, respectively. Monogenic model of inheritance showed that imidacloprid resistance was controlled by multiple factors. The realized heritability value was 0.09 in the imidacloprid-selected population of M. domestica. It was concluded that imidacloprid resistance in M. domestica was autosomally inherited, incompletely recessive and polygenic. These findings should be helpful for better and more successful management of M. domestica.

  13. RNA interference silencing of CHS greatly alters the growth pattern of apple (Malus x domestica). (United States)

    Dare, Andrew P; Hellens, Roger P


    Plants produce a vast array of phenolic compounds which are essential for their survival on land. One major class of polyphenols are the flavonoids and their formation is dependent on the enzyme chalcone synthase (CHS). In a recent study we silenced the CHS genes of apple (Malus × domestica Borkh.) and observed a loss of pigmentation in the fruit skin, flowers and stems. More surprisingly, highly silenced lines were significantly reduced in size, with small leaves and shortened internode lengths. Chemical analysis also revealed that the transgenic shoots contained greatly reduced concentrations of flavonoids which are known to modulate auxin flow. An auxin transport study verified this, with an increased auxin transport in the CHS-silenced lines. Overall, these findings suggest that auxin transport in apple has adapted to take place in the presence of high endogenous concentrations of flavonoids. Removal of these compounds therefore results in abnormal auxin movement and a highly disrupted growth pattern.

  14. Analysis of phenolic compounds in six Norwegian plum cultivars (Prunus domestica L.). (United States)

    Slimestad, Rune; Vangdal, Eivind; Brede, Cato


    Six European plum cultivars ( Prunus domestica L.) grown in Norway have been studied with respect to phenolic composition. Neochlorogenic acid was found to be the most important phenolic acid in all cultivars. Together with other phenolic acids, this compound varied significantly in amount among the cultivars. Cyanidin 3-rutinoside was found to account for >60% of the total anthocyanin content. Minor amounts of flavonols (rutin and quercetin 3-glucoside) were detected in all cultivars. Total antioxidant capacity varied from 814 to 290 micromol of Trolox 100 g(-1) of fresh weight. Measurement of total phenolic content in terms of Prussian blue complex formation revealed a method failure of magnitude order compared to results obtained by HPLC. Comparison of the response factors of a range of phenolic compounds obtained upon analysis by the Prussian blue and Folin-Ciocalteu assays revealed that the latter method returned higher yields in terms of gallic acid (GAE).

  15. Physical and Chemical Properties of Some European Plum Cultivars (Prunus domestica L.

    Directory of Open Access Journals (Sweden)

    Mira Elena IONICA


    Full Text Available Fruits from twelve plum cultivars (Prunus domestica L., were analyzed in terms of physical and chemical characteristics. The fruits trees were grown in a trial at University of Craiova - Fruit Growing Research Station (SCDP Valcea, which is located in Bujoreni, an important Romanian plum production area. Fruits were picked at harvest maturity. Several analyzes were performed, such as fruit linear dimensions, size index, fruit weight, dry matter, soluble solids content, titratable acidity, total anthocyanins, malic, tartaric and citric acids content. The best features in terms of physical and chemical properties proved to be found in ‘Alina’, ‘Alutus’, ‘Tuleu Timpuriu’, ‘Oltenal’ and ‘Renclod Althan’.

  16. Cytochrome P450 monooxygenase-mediated neonicotinoid resistance in the house fly Musca domestica L

    DEFF Research Database (Denmark)

    Markussen, Mette D K; Kristensen, Michael


    Neonicotinoids play an essential role in the control of house flies Musca domestica. The development of neonicotinoid resistance was found in two field populations. 766b was 130- and 140-fold resistant to imidacloprid and 17- and 28-fold resistant to thiamethoxam in males and females, respectively....... 791a was 22- and 20-fold resistant to imidacloprid and 9- and 23-fold resistant to thiamethoxam in males and females, respectively. Imidacloprid selection of 791a increased imidacloprid resistance to 75- and 150-fold in males and females, respectively, whereas selection with thiamethoxam had minimum...... impact. Neonicotinoid resistance was in all cases suppressed by PBO. The cytochrome P450 genes CYP6A1, CYP6D1 and CYP6D3 were constitutively over-expressed in resistant strains and CYP6D1 and CYP6D3 differentially expressed between sexes. The highest level of CYP6A1 expression was observed in both gender...

  17. Unusual behavior of growing pollen tubes in the ovary of plum culture (Prunus domestica L.

    Directory of Open Access Journals (Sweden)

    Đorđević Milena


    Full Text Available Unusual behavior of growing pollen tubes in different combinations of pollination was observed in the ovary of the plum (Prunus domestica L. cv 'Čačanska Lepotica'. It primarily refers to several issues, i.e. the curling up of pollen tubes within the micropyle, the growth of two pollen tubes into the nucellus of an ovule, the occurrence of a bundle above the nucellar cap and fluorescence of the part of the embryo sac containing the egg apparatus. Upon the growth of pollen tubes into the nucellus of the ovule, subsequently penetrating pollen tubes form a bundle either above the micropyle entrance or above the nucellus. Branching and bending of pollen tubes by 180o upon their growth into the micropyle was also observed.

  18. Differential distribution of glutamate- and GABA-gated chloride channels in the housefly Musca domestica. (United States)

    Kita, Tomo; Ozoe, Fumiyo; Azuma, Masaaki; Ozoe, Yoshihisa


    l-Glutamic acid (glutamate) mediates fast inhibitory neurotransmission by affecting glutamate-gated chloride channels (GluCls) in invertebrates. The molecular function and pharmacological properties of GluCls have been well studied, but not much is known about their physiological role and localization in the insect body. The distribution of GluCls in the housefly (Musca domestica L.) was thus compared with the distribution of γ-aminobutyric acid (GABA)-gated chloride channels (GABACls). Quantitative PCR and ligand-binding experiments indicate that the GluCl and GABACl transcripts and proteins are predominantly expressed in the adult head. Intense GluCl immunostaining was detected in the lamina, leg motor neurons, and legs of adult houseflies. The GABACl (Rdl) immunostaining was more widely distributed, and was found in the medulla, lobula, lobula plate, mushroom body, antennal lobe, and ellipsoid body. The present findings suggest that GluCls have physiological roles in different tissues than GABACls.

  19. Unusual pseudomyiasis with Musca domestica (housefly larvae in a child with chronic otitis media

    Directory of Open Access Journals (Sweden)

    Zafar Iqbal


    Full Text Available Myiasis is a disease caused by fly larvae and aural myiasis is a rare clinic condition often occurring in children or mentally retarded people. We report the case of an unusual presentation of a unilateral aural myiasis in a 3-year-old female child patient belonging to a slum with unilateral chronic otitis media caused by Musca domestica (housefly larvae. Eight larvae were removed from the external auditory canal while five more larvae were located in the middle ear cavity and were removed through perforation of the tympanic membrane. Management of ear myiasis is based on removal of the maggots and cleansing of the ear with ethanol, chloroform, or physiological saline. Physiological saline is preferred in patients who have tympanic membrane perforation. Myiasis is related to personal hygiene. Therefore, to decrease the incidence of these infestations, care, and hygiene standards should be carried out for those at risk through information, education, and communication.

  20. Swine manure vermicomposting via housefly larvae (Musca domestica): the dynamics of biochemical and microbial features. (United States)

    Zhang, ZhiJian; Wang, Hang; Zhu, Jun; Suneethi, Sundar; Zheng, JianGuo


    Improper handling of animal manure generated from concentrated swine operations greatly deteriorates water ecosystems. In this study, a full-scale vermireactor using housefly larvae (Musca domestica) was designed to investigate the effectiveness and efficiency of swine manure reduction, and to explore the associated biochemical-biological mechanisms. The one-week larvae vermireactor resulted in a total weight reduction rate of 106±17 kg/(m(3) d) and moisture reduction of 80.2%. Microbial activities in manure decreased by 45% after vermicomposting, while the activities of cellulose, proteases, and phosphatases in the vermicompost were significantly 69 times, 48%, and 82% lower than those in raw manure, respectively. The vermicompost was exclusively dominated by Entomoplasma somnilux, Proteobacterium, and Clostridiaceae bacterium where the microbial diversity was decreased from 2.57 in raw manure to 1.77. Correlation coefficients statistic showed that organic C might be a key indicator of the biochemical features and microbial functions of the larvae vermireactor.

  1. Antioxidant, antifungal and antiviral activities of chitosan from the larvae of housefly, Musca domestica L. (United States)

    Ai, Hui; Wang, Furong; Xia, Yuqian; Chen, Xiaomin; Lei, Chaoliang


    Antioxidant activity of the chitosan from the larvae of Musca domestica L. was evaluated in two different reactive oxygen species assays, and inhibitory effects against seven fungi were also tested. The results showed that the chitosan had scavenging activity for hydroxyl and superoxide radicals which were similar to that of ascorbic acid. Also the chitosan exhibited excellent antifungal activity, especially in the low concentration, it could significantly inhibit the growth of Rhizopus stolonifer. Besides, antiviral results demonstrated that the chitosan could effectively inhibit the infection of AcMNPV and BmNPV. These results suggested that the chitosan from the larvae of housefly could be effectively used as a natural antioxidant to protect the human body from free radicals and retard the progress of many chronic diseases. Furthermore, the chitosan with antiviral and antifungal activity might provide useful information for antiviral breeding technology of economic insect and development of plant pathological control.

  2. Hormones and Sex-Specific Transcription Factors Jointly Control Yolk Protein Synthesis in Musca domestica

    Directory of Open Access Journals (Sweden)

    Christina Siegenthaler


    Full Text Available In the housefly Musca domestica, synthesis of yolk proteins (YPs depends on the level of circulating ecdysteroid hormones. In female houseflies, the ecdysterone concentration in the hemolymph oscillates and, at high levels, is followed by expression of YP. In male houseflies, the ecdysterone titre is constantly low and no YP is produced. In some strains, which are mutant in key components of the sex-determining pathway, males express YP even though their ecdysterone titre is not significantly elevated. However, we find that these males express a substantial amount of the female variant of the Musca doublesex homologue, Md-dsx. The dsx gene is known to sex-specifically control transcription of yp genes in the fat body of Drosophila melanogaster. Our data suggest that Md-dsx also contributes to the regulation of YP expression in the housefly by modulating the responsiveness of YP-producing cells to hormonal stimuli.

  3. Accumulation and depletion of polychlorinated biphenyl (PCB) congeners in the housefly (musca domestica, L. )

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, L.G. (Univ. of Illinois, Urbana (United States)); Storr-Hansen, E. (National Environmental Research Inst., Soeborg (Denmark))


    Polychlorinated biphenyl (PCB) residues in food chains and in the environment are dynamic complex mixtures and there is considerable interest in the disposition as well as toxicities of individual congeners. The persistence and biological activities of PCBs are intimately associated with microsomal monooxygenases. The house fly, Musca domestica (L.), has long been a standard organism for studies of pesticide toxicology and has an active and well-defined microsomal monooxygenase system. These oxidases in the fly can be induced by PCBs. It was considered of interest to provide data which may indicate whether or not the relatively large and mobile biomass of insects in general may play a role in the global disposition of PCBs. It was also of interest to determine if the house fly could serve as a model for determining the relative accumulation, elimination, and toxicities of individual PCB congeners.

  4. Ophthalmomyiasis externa by Musca domestica in a case of orbital metastasis. (United States)

    Tomy, Rose Mary; Prabhu, Padma B


    Infestation of the living tissues of the eye, ocular adnexae or orbit by larvae of flies of the order Diptera is known as ophthalmomyiasis. Ophthalmomyiasis externa is a limited superficial infestation of external ocular structures such as conjunctiva and adnexae. A case of follicular carcinoma thyroid with orbital metastasis presenting as ophthalmomyiasis externa is reported. The patient presented with foul smelling ulcers of the medial and lateral orbital walls of the right eye extending into the lids and nose, teeming with maggots. Computerized Tomography (CT) showed widespread bone destruction with extension into surrounding sinuses. Over 200 maggots were manually removed after immobilisation with turpentine oil instillation. Entomological examination showed it to be a case of accidental myiasis caused by the common housefly Musca domestica. The patient was managed conservatively and the ulcer cavities filled up with healthy granulation tissue. This case is presented on account of its rarity.

  5. Efficacy of herbal essential oils as insecticides against the housefly, Musca domestica L. (United States)

    Sinthusiri, Jirisuda; Soonwera, Mayura


    The insecticidal effects of 20 essential oils derived from herbs, were tested against the housefly species Musca domestica L. using a susceptibility test. Each was applied in ethyl alcohol at concentrations of 1, 5 and 10% (v/v). Ten percent concentrations of Cymbopogon citratus (lemongrass), Mentha piperita (peppermint) and Lavandula angustifolia (lavender) oils were the most effective, showing 100% knockdown at 30 and 60 minutes. The KT50 values for C. citratus, M. piperita and L. angustifolia were 5.14, 5.36 and 8.23 minutes, respectively. These essential oils caused 100% mortality among houseflies 24 hours after exposure. The LC50 values for C. citratus, M. piperita and L. angustifolia were 2.22, 2.62 and 3.26 minutes, respectively. This study reveals lemongrass, peppermint and lavender essential oils have the potential to control housefly populations and should be further studied for field applications.

  6. Optimizing dehydration of apples Malus Domestica with fructo-oligosaccharide incorporation

    Directory of Open Access Journals (Sweden)

    Mariana Buranelo Egea


    Full Text Available The objective of the present study was to study the effect of the variables of the osmotic dehydration process on sliced Fuji apples (Malus domestica using a 2 x 3² factorial design. The variables studied in the apple slices were the pretreatment (blanching or acidification, the temperatures (30, 45 and 60ºC and the FOS concentration (40%, 50% and 60% m/v of the osmotic solution. There was no difference among the pretreatments for the water activity and titratable acidity. The slices pre-treated by the acidification presented less enzymatic browning (greatest luminosity L* value combined with a greater soluble solid contents (thus, this treatment was selected. Treatments T4 (45ºC and 40% m/v and T7 (60ºC and 40%m/v, using the acidification presented responses within the recommended standards and FOS were validated by the repetition.

  7. Ophthalmomyiasis externa by Musca domestica in a case of orbital metastasis

    Directory of Open Access Journals (Sweden)

    Rose Mary Tomy


    Full Text Available Infestation of the living tissues of the eye, ocular adnexae or orbit by larvae of flies of the order Diptera is known as ophthalmomyiasis. Ophthalmomyiasis externa is a limited superficial infestation of external ocular structures such as conjunctiva and adnexae. A case of follicular carcinoma thyroid with orbital metastasis presenting as ophthalmomyiasis externa is reported. The patient presented with foul smelling ulcers of the medial and lateral orbital walls of the right eye extending into the lids and nose, teeming with maggots. Computerized Tomography (CT showed widespread bone destruction with extension into surrounding sinuses. Over 200 maggots were manually removed after immobilisation with turpentine oil instillation. Entomological examination showed it to be a case of accidental myiasis caused by the common housefly Musca domestica. The patient was managed conservatively and the ulcer cavities filled up with healthy granulation tissue. This case is presented on account of its rarity.

  8. Helminth-bacteria interaction in the gut of domestic pigeon Columba livia domestica. (United States)

    Biswal, Debraj; Nandi, Anadi Prasad; Chatterjee, Soumendranath


    The present paper is an attempt to study the interaction between the helminth parasite and bacteria residing in the gut of domestic pigeon, Columba livia domestica. Biochemical and molecular characterization of the gut bacterial isolate were done and the isolate was identified as Staphylococcus sp. DB1 (JX442510). The interaction of Staphylococcus sp. with Cotugnia cuneata, an intestinal helminth parasite of domestic pigeon was studied on the basis of the difference between 'mean worm burden' of antibiotic treated infected pigeons and infected pigeons without any antibiotic treatment. The ANOVA and Tukey tests of the data obtained showed that antibiotic treatment reduced the mean worm burden significantly. The biochemical properties of Staphylococcus sp. DB1 (JX442510) also showed a mutualistic relationship with the physiology of C. cuneata.

  9. A Case for Sequencing the Genome of Musca domestica (Diptera: Muscidae)

    DEFF Research Database (Denmark)

    Scott, J G; Liu, N; Kristensen, M


    biology of this species. Sequencing of the house fly genome will provide important inroads to the discovery of novel target sites for house fly control, understanding of the house fly immune response, rapid elucidation of insecticide resistance genes,and understanding of numerous aspects of the basic...... biology of this insect pest. The ability of the house fly to prosper in it remarkably septic environment motivates analysis of its innate immune system. Its polymorphic sex determination system, with male-determining factors on either the autosomes or the Y chromosome, is ripe for a genomic analysis...... been sequenced (including several mosquito and Drosophila species). The community of researchers investigating Musca domestica are well prepared and highly motivated to apply genomic analyses to their widely varied research programs....

  10. In silico analysis of the polygalacturonase inhibiting protein 1 from apple, Malus domestica. (United States)

    Matsaunyane, Lerato Bt; Oelofse, Dean; Dubery, Ian A


    The Malus domestica polygalacturonase inhibiting protein 1 (MdPGIP1) gene, encoding the M. domestica polygalacturonase inhibiting protein 1 (MdPGIP1), was isolated from the Granny Smith apple cultivar (GenBank accession no. DQ185063). The gene was used to transform tobacco and potato for enhanced resistance against fungal diseases. Analysis of the MdPGIP1 nucleotide sequence revealed that the gene comprises 993 nucleotides that encode a 330 amino acid polypeptide. In silico characterization of the MdPGIP1 polypeptide revealed domains typical of PGIP proteins, which include a 24 amino acid putative signal peptide, a potential cleavage site [Alanine-Leucine-Serine (ALS)] for the signal peptide, a 238 amino acid leucine-rich repeat (LRR) domain, a 46 amino acid N-terminal domain and a 22 amino acid C-terminal domain. The hydropathic evaluation of MdPGIP1 indicated a repetitive hydrophobic motif in the LRR domain and a hydrophilic surface area consistent with a globular protein. The typical consensus glycosylation sequence of Asn-X-Ser/Thr was identified in MdPGIP1, indicating potential N-linked glycosylation of MdPGIP1. The molecular mass of non-glycosylated MdPGIP1 was calculated as 36.615 kDa and the theoretical isoelectric point as 6.98. Furthermore, the secondary and tertiary structure of MdPGIP1 was modelled, and revealed that MdPGIP1 is a curved and elongated molecule that contains sheet B1, sheet B2 and 310-helices on its LRR domain. The overall properties of the MdPGIP1 protein is similar to that of the prototypical Phaseolus vulgaris PGIP 2 (PvPGIP2), and the detected differences supported its use in biotechnological applications as an inhibitor of targeted fungal polygalacturonases (PGs).

  11. Cloning, purification and comparative characterization of two digestive lysozymes from Musca domestica larvae

    Directory of Open Access Journals (Sweden)

    F.C. Cançado


    Full Text Available cDNA coding for two digestive lysozymes (MdL1 and MdL2 of the Musca domestica housefly was cloned and sequenced. MdL2 is a novel minor lysozyme, whereas MdL1 is the major lysozyme thus far purified from M. domestica midgut. MdL1 and MdL2 were expressed as recombinant proteins in Pichia pastoris, purified and characterized. The lytic activities of MdL1 and MdL2 upon Micrococcus lysodeikticus have an acidic pH optimum (4.8 at low ionic strength (μ = 0.02, which shifts towards an even more acidic value, pH 3.8, at a high ionic strength (μ = 0.2. However, the pH optimum of their activities upon 4-methylumbelliferyl N-acetylchitotrioside (4.9 is not affected by ionic strength. These results suggest that the acidic pH optimum is an intrinsic property of MdL1 and MdL2, whereas pH optimum shifts are an effect of the ionic strength on the negatively charged bacterial wall. MdL2 affinity for bacterial cell wall is lower than that of MdL1. Differences in isoelectric point (pI indicate that MdL2 (pI = 6.7 is less positively charged than MdL1 (pI = 7.7 at their pH optima, which suggests that electrostatic interactions might be involved in substrate binding. In agreement with that finding, MdL1 and MdL2 affinities for bacterial cell wall decrease as ionic strength increases.

  12. In vitro Conservation and Cryopreservation of Nandina domestica, an Outdoor Ornamental Shrub

    Directory of Open Access Journals (Sweden)

    Aylin OZUDOGRU


    Full Text Available The study focused on an economically-important ornamental outdoor shrub, Nandina domestica, with the aims to (i optimize an effective in vitro conservation method, and (ii develop a cryopreservation protocol for shoot tips by the PVS2 vitrification and droplet-vitrification techniques. For in vitro conservation of shoot cultures, the tested parameters were sucrose content in the storage medium (30, 45, 60 g/L and storage temperature (4 °C or 8 °C. Cryopreservation was performed by applying the PVS2 vitrification solution, in 2-ml cryovials or in drops over aluminum foil strips, for 15, 30, 60 or 90 min at 0 °C, followed by the direct immersion in liquid nitrogen of shoot tips. Results show that N. domestica shoots can be conserved successfully for 6 months at both the temperatures tested, especially when 60 g/L sucrose is used in the storage medium. However, conservation at 4 °C showed to be more appropriate, as hyperhydricity was observed in post-conservation of shoots coming from storage at 8 °C. As for cryopreservation, a daily gradual increase of sucrose concentration (from 0.25 to 1.0 M produced better protection to the samples that were stored in liquid nitrogen. Indeed, with this sucrose treatment method, a 30-min PVS2 incubation time was enough to produce, 60 days after thawing, the best recovery (47% and 50% of shoot tips, cryopreserved with PVS2 vitrification and droplet-vitrification, respectively.

  13. House Fly (Musca domestica L.) (Diptera Muscidae) Development in Different Types of Manure Desarrollo de la Mosca Doméstica (Musca domestica L.) (Díptera Muscidae) en Distintos Tipos de Estiércol


    Patricia Larraín S; Claudio Salas F


    Animal production units with different management systems can be found along the Huasco Valley, Region of Atacama, Chile. These constitute sources of house flies (Musca domestica L.) and other vector fly species that cause damage to animals and nuisance problems in urban areas. In order to asses the importance of fly breeding sources, an experiment was carried out under laboratory conditions to evaluate different types of animal manure and composted swine manure. Time of larval development, l...

  14. Efficacy and safety of Curcuma domestica extracts compared with ibuprofen in patients with knee osteoarthritis: a multicenter study

    Directory of Open Access Journals (Sweden)

    Kuptniratsaikul V


    Full Text Available Vilai Kuptniratsaikul,1 Piyapat Dajpratham,1 Wirat Taechaarpornkul,2 Montana Buntragulpoontawee,3 Pranee Lukkanapichonchut,4 Chirawan Chootip,5 Jittima Saengsuwan,6 Kesthamrong Tantayakom,7 Supphalak Laongpech8 1Department of Rehabilitation Medicine, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok, Thailand; 2Sirindhorn National Medical Rehabilitation Center, Ministry of Public Health, Nonthaburi, Thailand; 3Department of Rehabilitation Medicine, Faculty of Medicine, Chiang Mai University, Chiang Mai, Thailand; 4Department of Rehabilitation Medicine, Ratchaburi Hospital, Ministry of Public Health, Ratchaburi, Thailand; 5Department of Rehabilitation Medicine, Songkhla Hospital, Ministry of Public Health, Songkhla, Thailand; 6Department of Rehabilitation Medicine, Faculty of Medicine, Khon Kaen University, Khon Kaen, Thailand; 7Department of Rehabilitation Medicine, Rajvithi Hospital, Ministry of Public Health, Bangkok, Thailand; 8Department of Rehabilitation Medicine, Vachira Phuket Hospital, Ministry of Public Health, Phuket, Thailand Objective: To determine the efficacy and safety of Curcuma domestica extracts in pain reduction and functional improvement. Methods: 367 primary knee osteoarthritis patients with a pain score of 5 or higher were randomized to receive ibuprofen 1,200 mg/day or C. domestica extracts 1,500 mg/day for 4 weeks. The main outcomes were Western Ontario and McMaster Universities Osteoarthritis Index (WOMAC total, WOMAC pain, WOMAC stiffness, and WOMAC function scores. Adverse events (AEs were also recorded. Results: 185 and 182 patients were randomly assigned into C. domestica extracts and ibuprofen groups, respectively. The baseline characteristics were no different between groups. The mean of all WOMAC scores at weeks 0, 2, and 4 showed significant improvement when compared with the baseline in both groups. After using the noninferiority test, the mean difference (95% confidence interval of WOMAC total

  15. Ganancia de peso del depredador Podisus distinctus (Heteroptera: Pentatomidae en combinaciones de las presas Tenebrio molitor (Coleoptera: Tenebrionidae y Musca domestica (Diptera: Muscidae

    Directory of Open Access Journals (Sweden)

    Fausto da Costa Matos Neto


    Full Text Available Entre las ninfas de los asopíneos usados para el control de gusanos desfoliadores en plantaciones de eucalipto, Podisus distinctus (Stal (Heteroptera: Pentatomidae representa un potencial agente de control biológico, sin embargo esta especie ha sido poco estudiada. El presente trabajo evaluó el efecto de las diferentes combinaciones de las presas Musca domestica L. (Diptera: Muscidae y Tenebrio molitor L. (Coleoptera: Tenebrionidae sobre el peso de ninfas de P. distinctus. El experimento se realizó en laboratorio do "Instituto de Biotecnologia Aplicada à Agropecuaria (BIOAGRO", a 25 ± 0.5ºC, 60 ± 10% de humedad relativa y 14 horas de fotoperiodo. Las ninfas de P. distinctus fueron individualizadas en cajas de Petri y alimentadas de acuerdo con los siguientes tratamientos: T1- larvas de M. domestica durante toda la fase ninfal; T2- larvas de M. domestica en el II estadio y de T. molitor en los III, IV y V estadios; T3- larvas de M. domestica en el II y III estadios y de T. molitor en los IV y V estadios; T4- larvas de M. domestica en el II, III y IV estadios y de T. molitor en el V estadio; T5- larvas de T. molitor en todos los estadios. Los mejores resultados de peso y ganancia de peso fueron encontrados cuando P. distinctus fue alimentado alternadamente con larvas de M. domestica y T. molitor. Cuando esse depredador fue solamente alimentado con larvas de M. domestica, presentó pesos menoresLitlle is known about Podisus distinctus (Stal (Heteroptera: Pentatomidae one of the Asopinae species with good possibilities for mass rearing and releasing against defoliator caterpillars in eucalyptus reforested areas in Brazil. We evaluated the impact of prey combinations on weight of nymphs and adults of P. distinctus. The prey were Musca domestica L. (Diptera: Muscidae and Tenebrio molitor L. (Coleoptera: Tenebrionidae. The experiment was developed under 25 ± 0.5ºC, 60 ± 10% R.H. and photophase of 14 hr, with nymphs of P. distinctus

  16. Phenolic Compounds in Apple (Malus x domestica Borkh.: Compounds Characterization and Stability during Postharvest and after Processing

    Directory of Open Access Journals (Sweden)

    Alessandra Francini


    Full Text Available This paper summarizes the information on the occurrence of phenolic compounds in apple (Malus x domestica Borkh. fruit and juice, with special reference to their health related properties. As phytochemical molecules belonging to polyphenols are numerous, we will focus on the main apples phenolic compounds with special reference to changes induced by apple cultivar, breeding approaches, fruit postharvest and transformation into juice.

  17. Analysis of the morphology and distribution of argentaffin, argyrophil and insulin-immunoreactive endocrine cells in the small intestine of the adult opossum Didelphis aurita (Wied-Neuwied, 1826). (United States)

    Basile, D R S; Novaes, R D; Marques, D C S; Fialho, M C Q; Neves, C A; Fonseca, C C


    The aim of this study was to identify and quantify the argyrophil, argentaffin and insulin-immunoreactive cells (IIC) in the small intestine of the opossum Didelphis aurita. Seven adult male specimens of opossums were investigated. The animals were captured, and their blood insulin levels were determined. After euthanasia, fragments of the small intestine were processed for light microscopy and transmission electron microscopy, and submitted to histochemistry and immunohistochemistry for identification of argyrophil and argentaffin endocrine cells, and IIC. Argyrophil and argentaffin cells were identified in the intestinal villi and Liberkühn crypts, whereas IIC were present exclusively in the crypts. Ultrastructure of the IIC revealed cytoplasmic granules of different sizes and electron densities. The numbers of IIC per mm(2) in the duodenum and jejunum were higher than in the ileum (psmall intestine. The IIC presented secretory granules, elongated and variable morphology. It is believed that insulin secretion by the IIC may influence the proliferation of cells in the Liberkühn crypts, and local glucose homeostasis, primarily in animals with low serum insulin levels, such as the opossum.

  18. Cross-resistance, stability, and fitness cost of resistance to imidacloprid in Musca domestica L., (Diptera: Muscidae). (United States)

    Abbas, Naeem; Khan, Hussnain; Shad, Sarfraz Ali


    Imidacloprid, a neonicotinoid insecticide, has been used frequently for the management of Musca domestica L., (Diptera: Muscidae) worldwide. To design the strategy for resistance management, life history traits were established for imidacloprid-resistant, susceptible counterpart, and reciprocal crosses M. domestica strains based on laboratory observations. Bioassay results showed that the imidacloprid-selected strain developed a resistance ratio of 106-fold to imidacloprid, 19-fold to nitenpyram, 29-fold to chlorpyrifos, and 3.8-fold to cypermethrin compared to that of the susceptible counterpart strain. The imidacloprid-selected strain showed very low cross-resistance against nitenpyram and cypermethrin and a lack of cross-resistance to chlorpyrifos. Resistance to imidacloprid, nitenpyram, and chlorpyrifos was unstable, while resistance to cypermethrin was stable in Imida-SEL strain of M. domestica. The imidacloprid-selected strain had a relative fitness of 0.61 and lower fecundity, hatchability, number of next-generation larvae, and net reproductive rate compared with the susceptible counterpart strain. Mean population growth rates, such as intrinsic rate of population increase and biotic potential, were lower for the imidacloprid-selected strain compared with the susceptible counterpart strain. Development of resistance can cost considerable fitness for the imidacloprid-selected strain. The present study provided useful information for making potential management strategies to overcome development of resistance.

  19. Larvicidal activity of medicinal plant extracts and lignan identified in Phryma leptostachya var. asiatica roots against housefly (Musca domestica L.). (United States)

    Seo, Seon-Mi; Park, Il-Kwon


    Medicinal plant extracts from 27 plant species in 20 families were tested for their larvicidal activity against housefly, Musca domestica (L.). Responses varied with plant material and concentration. Among plant species tested, Phryma leptostachya var. asiatica showed 100% larvicidal activity against M. domestica at 10 mg/g concentration. Larvicidal activities of Atractylodes japonica, Saussurea lappa, Asiasarum sieboldi, and Gleditsia japonica var. koraiensis were 89.3%, 85.3%, 93.3%, and 96.6% at 10 mg/g concentration, respectively. Extracts of Prunus persica, Curcuma longa, and Paeonia moutan produced moderate activity. Larvicidal activity of other plant extracts was less than 50%. Among test plant species, P. leptostachya var. asiatica showed the most potent larvicidal activity. The active constituent of P. leptostachya var. asiatica roots was identified as the leptostachyol acetate by spectroscopic analysis. The LC(50) values of leptostachyol acetate against M. domestica larvae were 0.039 mg/g. Naturally occurring medicinal plant extracts and P. leptostachya var. asiatica root-derived compounds merit further study as potential housefly larval control agents or lead compounds.

  20. Isolation and genetic characterisation of Toxoplasma gondii from a red-handed howler monkey (Alouatta belzebul), a jaguarundi (Puma yagouaroundi), and a black-eared opossum (Didelphis aurita) from Brazil. (United States)

    Pena, H F J; Marvulo, M F V; Horta, M C; Silva, M A; Silva, J C R; Siqueira, D B; Lima, P-A C P; Vitaliano, S N; Gennari, S M


    Toxoplasma gondii isolates are highly diverse in domestic animals from Brazil. However, little is known about the genetics of this parasite from wild mammals in the same region. Reveal genetic similarity or difference of T. gondii among different animal populations is necessary for us to understand transmission of this parasite. Here we reported isolation and genetic characterisation of three T. gondii isolates from wild animals in Brazil. The parasite was isolated by bioassay in mice from tissues of a young male red handed howler monkey (Alouatta belzebul), an adult male jaguarundi (Puma yagouaroundi), and an adult female black-eared opossum (Didelphis aurita). The monkey and the jaguarundi had inhabited the Zoo of Parque Estadual Dois Irmãos, Pernambuco State, Northeastern Brazil, for 1 year and 8 years, respectively. The wild black-eared opossum was captured in São Paulo State, Southeastern Brazil, and euthanised for this study because it was seropositive for T. gondii (titre 1:100 by the modified agglutination test, MAT). Ten PCR-RFLP (Polymerase Chain Reaction-Restriction Fragment Length Polymorphism) markers, SAG1, SAG2, SAG3, BTUB, GRA6, c22-8, c29-2, L358, PK1 and Apico, were used to genotype the isolates. T. gondii was isolated from the brain and heart homogenate of the monkey, the muscle homogenate of the jaguarundi, and the heart homogenate of the black-eared opossum. This was the first isolation of T. gondii from a neotropical felid from Brazil. The isolate from the monkey (TgRhHmBr1) was not virulent in mice, whereas the isolates from the jaguarundi (TgJagBr1) and the black-eared opossum (TgOpBr1) were virulent in mice. The genotype of the isolate from the monkey has been identified in isolates from a goat and ten chickens in the same region of Brazil, suggesting that it may be a common lineage circulating in this region. The genotypes of the isolates from the jaguarundi and the black-eared opossum have not been previously reported. Although there

  1. Evaluación de Spalangia endius y Muscidifurax sp. (Hymenoptera, Pteromalidae como controladores de Musca domestica en el Perú

    Directory of Open Access Journals (Sweden)

    Edgar Inciso


    Full Text Available En el presente trabajo se comparó la actividad parasitoide de las microavispas Spalangia endius y Muscidifurax sp. sobre el estadio pupal de Musca domestica. La mejor temperatura para la crianza fue de 25 °C. El ciclo de S. endius se completó en 22,6 días, mientras en Muscidifurax sp. en 14,8 días. La duración del ciclo fue inversamente relacionada con la temperatura, siendo mayor en las hembras que en los machos. La longevidad fue similar en ambas especies de microavispas (20,7 días en S. endius y 18,6 días en Muscifurax sp..La oviposicion de S. endius a los 15 días fue sobre 175 pupas de M. domestica, valor mayor que Muscidifurax que parasitó 140 pupas en 16 días. En ambas especies la mayor postura ocurrió al tercer día. Las pupas de M. domestica de dos días de maduración fueron las mas parasitadas con 66,4% de parasitismo efectivo por S. endius y 60,2% por Muscidifurax sp. El número óptimo de pupas de M. domestica fue 10 (10:1. Se concluye que en condiciones de laboratorio, Spalangia endius puede ser un eficiente controlador biológico de pupas de Musca domestica.

  2. Responses of the Housefly, Musca domestica, to the Hytrosavirus Replication: Impacts on Host's Vitellogenesis and Immunity. (United States)

    Kariithi, Henry M; Yao, Xu; Yu, Fahong; Teal, Peter E; Verhoeven, Chelsea P; Boucias, Drion G


    Hytrosaviridae family members replicate in the salivary glands (SGs) of their adult dipteran hosts and are transmitted to uninfected hosts via saliva during feeding. Despite inducing similar gross symptoms (SG hypertrophy; SGH), hytrosaviruses (SGHVs) have distinct pathobiologies, including sex-ratio distortions in tsetse flies and refusal of infected housefly females to copulate. Via unknown mechanism(s), SGHV replication in other tissues results in reduced fecundity in tsetse flies and total shutdown of vitellogenesis and sterility in housefly females. We hypothesized that vitellogenesis shutdown was caused by virus-induced modulation of hormonal titers. Here, we used RNA-Seq to investigate virus-induced modulation of host genes/pathways in healthy and virus-infected houseflies, and we validated expression of modulated genes (n = 23) by RT-qPCR. We also evaluated the levels and activities of hemolymph AMPs, levels of endogenous sesquiterpenoids, and impacts of exogenous hormones on ovarian development in viremic females. Of the 973 housefly unigenes that were significantly modulated (padj ≤ 0.01, log2FC ≤ -2.0 or ≥ 2.0), 446 and 527 genes were downregulated and upregulated, respectively. While the most downregulated genes were related to reproduction (embryogenesis/oogenesis), the repertoire of upregulated genes was overrepresented by genes related to non-self recognition, ubiquitin-protease system, cytoskeletal traffic, cellular proliferation, development and movement, and snRNA processing. Overall, the virus, Musca domestica salivary gland hytrosavirus (MdSGHV), induced the upregulation of various components of the siRNA, innate antimicrobial immune, and autophagy pathways. We show that MdSGHV undergo limited morphogenesis in the corpora allata/corpora cardiaca (CA/CC) complex of M. domestica. MdSGHV replication in CA/CC potentially explains the significant reduction of hemolymph sesquiterpenoids levels, the refusal to mate, and the complete shutdown of

  3. Sarcocystis neurona infections in sea otter (Enhydra lutris): evidence for natural infections with sarcocysts and transmission of infection to opossums (Didelphis virginiana) (United States)

    Dubey, J.P.; Rosypal, A.C.; Rosenthal, B.M.; Thomas, N.J.; Lindsay, D.S.; Stanek, J.F.; Reed, S.M.; Saville, W.J.A.


    Although Sarcocystis neurona has been identified in an array of terrestrial vertebrates, recent recognition of its capacity to infect marine mammals was unexpected. Here, sarcocysts from 2 naturally infected sea otters (Enhydra lutris) were characterized biologically, ultrastructurally, and genetically. DNA was extracted from frozen muscle of the first of these sea otters and was characterized as S. neurona by polymerase chain reation (PCR) amplification followed by restriction fragment length polymorphism analysis and sequencing. Sarcocysts from sea otter no. 1 were up to 350 I?m long, and the villar protrusions on the sarcocyst wall were up to 1.3 I?m long and up to 0.25 I?m wide. The villar protrusions were tapered towards the villar tip. Ultrastructurally, sarcocysts were similar to S. neurona sarcocysts from the muscles of cats experimentally infected with S. neurona sporocysts. Skeletal muscles from a second sea otter failed to support PCR amplification of markers considered diagnostic for S. neurona but did induce the shedding of sporocysts when fed to a laboratory-raised opossum (Didelphis virginiana). Such sporocysts were subsequently fed to knockout mice for the interferon-gamma gene, resulting in infections with an agent identified as S. neurona on the basis of immunohistochemistry, serum antibodies, and diagnostic sequence detection. Thus, sea otters exposed to S. neurona may support the development of mature sarcocysts that are infectious to competent definitive hosts.

  4. Insecticidal properties of several essential oils on the house fly (Musca domestica L.). (United States)

    Pavela, Roman


    The insecticidal activity of 34 essential oils, extracted from plants, was screened against the house fly, Musca domestica L. under laboratory conditions. Essential oils from Pogostemon cablin proved to be the most efficient at a lethal dose of 3 microg/fly after topical application. Eight oils (P. roseum, O. vulgare, O. compactum, M. pulegium, O. basilicum, O. majorana, T. vulgaris and P. graveolens) were lethal in doses ranging from 10 to 20 microg (10, 13, 13, 13, 15, 17, 18 and 19 microg/fly, respectively). The lethal doses of another 13 oils were ascertained in the range 20-50 microg/fly, nine oils had lethal doses of 50-100 microg. For two oils, the lethal dose could not be for the topical application. In the fumigant test, the most efficient proved to be Mentha pulegium oil (4.7 microg/cm(2)). For 10 oils, a lethal dose between 5 and 10 microg/cm(2) was ascertained (T. bipinata, C. aurantifolia, T. occidentalis, T. matschiana, S. officinalis, T. vulgaris, M. quinquenervia, O. compactum, C. limonum and R. officinalis, respectively). For the other 10 oils a lethal dose from 10 but to 80 microg/cm(2) was ascertained, and for 13 oils the lethal dose was higher than the highest dose in the tests.

  5. Toxicity and resistance of field collected Musca domestica (Diptera: Muscidae) against insect growth regulator insecticides. (United States)

    Khan, Hafiz Azhar Ali; Akram, Waseem; Arshad, Muhammad; Hafeez, Faisal


    The house fly, Musca domestica, is a serious pest of public health importance with the ability to develop insecticide resistance. The focus of the present study was to evaluate toxicity and resistance of the field collected house flies from Punjab, Pakistan, against insect growth regulator (IGR) insecticides. House flies collected from six different localities exhibited very low levels of resistance to cyromazine, triflumuron, and methoxyfenozide compared with the Lab-susceptible reference strain, with resistance ratios (RRs) ranging between 3.56- to 8.19-fold, 1.45- to 3.68-fold, and 2.20- to 8.60-fold, respectively. However, very low to low levels of resistance were observed for pyriproxyfen and very low to moderate levels for lufenuron with RRs ranged from 4.13- to 11.63-fold to 8.57- to 22.75-fold, respectively. There was a significant correlation between RRs of cyromazine and triflumuron (r = 0.976, p insecticides tested will continue unless resistance management practices are followed.

  6. Repellent, larvicidal and pupicidal properties of essential oils and their formulations against the housefly, Musca domestica. (United States)

    Kumar, P; Mishra, S; Malik, A; Satya, S


    The essential oils of six plant species [peppermint, Mentha piperita, and bergamot mint, Mentha citrata (both, Lamiales: Lamiaceae); blue gum, Eucalyptus globulus (Myrtales: Myrtaceae); lemongrass, Cymbopogon citratus, and khus grass, Vetiver zizanoides (both, Poales: Poaceae), and turmeric, Curcuma longa (Ziniberales: Zingiberaceae)] were screened for repellent, larvicidal and pupicidal activities against the housefly, Musca domestica L. (Diptera: Muscidae). Subsequently, emulsifiable concentrate (EC) formulations of the two most effective oils were prepared and tested in the laboratory as well as in the field. In repellency bioassays, M. piperita (RC(84) , 61.0 µg/cm(2) ) was found to be most effective, followed by E. globulus (RC(84) , 214.5 µg/cm(2) ) and C. citratus (RC(84) , 289.2 µg/cm(2) ). Formulated M. piperita and E. globulus showed RC(84) values of 1.6 µg/cm(2) and 4.1 µg/cm(2) , respectively. Formulated M. piperita and E. globulus achieved larval mortality (LC(50) ) in 72 h at 5.12 µg/cm(2) and 6.09 µg/cm(2) , respectively. In pupicidal bioassays, crude oils of M. piperita and E. globulus suppressed the emergence of adult flies by 100%. Field experiments with the M. piperita formulation showed reductions in fly density (number of flies/h) of 96% on treated cattle and 98% on treated plots. This study demonstrates the effectiveness of EC formulations of selected essential oils in reducing housefly populations in field conditions.

  7. Composition of pectic polysaccharides in a Portuguese apple (Malus domestica Borkh. cv Bravo de Esmolfe

    Directory of Open Access Journals (Sweden)

    Ana S. Silva


    Full Text Available Malus domestica Borkh. cv Bravo de Esmolfe is a typical Portuguese apple cultivar classified as Protected Designation and Origin (PDO. It is a traditional product produced under strict conditions and labelled with a specific law protected designation. This cultivar presents quite good sweetness and flavor. The monosaccharide composition of the pectic polysaccharides from this traditional apple is herein reported for the first time. Based on the molar ratios obtained from the sugar composition, the presumable pectin structure could be inferred. The cell-wall polysaccharides present in the alcohol-insoluble residue (AIR of unpeeled BE apple were sequentially fractionated. In addition, pectic material was also extracted by citric acid treatment prior to heat extraction at acidic pH. The water soluble pectin, imidazole soluble pectin and sodium carbonate soluble pectin account for 44, 16 and 40 % of the AIR, respectively. The pectic polysaccharides extracted in the presence of citric acid had lower galacturonic acid content and higher neutral sugars content. The homogalacturonan (HG and less-substituted rhamnogalacturonan (RG domains are extracted first. Pectin treated with citric acid has been shown to contain more substituted polymers, especially RG-I. In addition, the relatively higher Xylose/Galacturonic acid ratio found in the citric acid extract demonstrates that the xylogalacturonan (XG domain presumably is present in the pectic material of the unpeeled BE apple.

  8. Genomewide analysis of ABCBs with a focus on ABCB1 and ABCB19 in Malus domestica

    Indian Academy of Sciences (India)

    Juan Juan Ma; Mingyu Han


    The B subfamily of ATP-binding cassette (ABC) proteins (ABCB) plays a vital role in auxin efflux. However, no systematic study has been done in apple. In this study, we performed genomewide identification and expression analyses of the ABCB family in Malus domestica for the first time. We identified a total of 25 apple ABCBs that were divided into three clusters based on the phylogenetic analysis. Most ABCBs within the same cluster demonstrated a similar exon–intron organization. Additionally, the digital expression profiles of ABCB genes shed light on their functional divergence. ABCB1 and ABCB19 are two well-studied auxin efflux carrier genes, and we found that their expression levels are higher in young shoots of M106 than in young shoots of M9. Since young shoots are the main source of auxin synthesis and auxin efflux involves in tree height control. This suggests that ABCB1 and ABCB19 may also take a part in the auxin efflux and tree height control in apple.

  9. Effects of Foliar Treatments of Salicylic Acid on Apple (Malus domestica L. Against Freezing

    Directory of Open Access Journals (Sweden)

    Bengü Türkyılmaz Ünal


    Full Text Available In our study we aim to increase frost resistance and improve the yield and quality of apple is important in Turkey and world economy. Phenological and morphological observations, physiological and biochemical analyzes were carried out in apple (Malus domestica L. plants. It was studied to determine the effects of foliar Salicylic acid (0, 500 ppm/plant and 1000 ppm/plant on adaptation of this plant when exposed to freezing stress, the quality and yield. Leaf photosynthetic pigment contents, total protein amount, proline amount, superoxide dismutase and peroxidase enzymatic activities were measured. The study planned by random experimental design and statistical analysis of data with SPSS program (LSD test were made. It was determined that fruit and shoot numbers were increased in samples exposed to 500 ppm salicylic acid and while fruit weights were increased in samples exposed to 500 ppm and 1000 ppm salicylic acid compared to the control. Also, colour of plants were darkened. Chla, chlb, total chl, proline, superoxide dismutase and peroxidase amounts were increased significantly compared to the control group. Increases occured in the carotenoid and the protein amounts are not significant statistically. In the light of obtained data, foliar application of salicylic acid were found to reduce the effects of freezing stress and to increase the yield and quality of apple plants.

  10. Avoidance of harvesting and sampling artefacts in hydraulic analyses: a protocol tested on Malus domestica. (United States)

    Beikircher, Barbara; Mayr, Stefan


    A prerequisite for reliable hydraulic measurements is an accurate collection of the plant material. Thereby, the native hydraulic state of the sample has to be preserved during harvesting (i.e., cutting the plant or plant parts) and preparation (i.e., excising the target section). This is particularly difficult when harvesting has to be done under transpiring conditions. In this article, we present a harvesting and sampling protocol designed for hydraulic measurements on Malus domestica Borkh. and checked for possible sampling artefacts. To test for artefacts, we analysed the percentage loss of hydraulic conductivity, maximum specific conductivity and water contents of bark and wood of branches, taking into account conduit length, time of day of harvesting, different shoot ages and seasonal effects. Our results prove that use of appropriate protocols can avoid artefactual embolization or refilling even when the xylem is under tension at harvest. The presented protocol was developed for Malus but may also be applied for other angiosperms with similar anatomy and refilling characteristics.

  11. Phenotypic changes associated with RNA interference silencing of chalcone synthase in apple (Malus × domestica). (United States)

    Dare, Andrew P; Tomes, Sumathi; Jones, Midori; McGhie, Tony K; Stevenson, David E; Johnson, Ross A; Greenwood, David R; Hellens, Roger P


    We have identified in apple (Malus × domestica) three chalcone synthase (CHS) genes. In order to understand the functional redundancy of this gene family RNA interference knockout lines were generated where all three of these genes were down-regulated. These lines had no detectable anthocyanins and radically reduced concentrations of dihydrochalcones and flavonoids. Surprisingly, down-regulation of CHS also led to major changes in plant development, resulting in plants with shortened internode lengths, smaller leaves and a greatly reduced growth rate. Microscopic analysis revealed that these phenotypic changes extended down to the cellular level, with CHS-silenced lines showing aberrant cellular organisation in the leaves. Fruit collected from one CHS-silenced line was smaller than the 'Royal Gala' controls, lacked flavonoids in the skin and flesh and also had changes in cell morphology. Auxin transport experiments showed increased rates of auxin transport in a CHS-silenced line compared with the 'Royal Gala' control. As flavonoids are well known to be key modulators of auxin transport, we hypothesise that the removal of almost all flavonoids from the plant by CHS silencing creates a vastly altered environment for auxin transport to occur and results in the observed changes in growth and development. © 2013 The Authors The Plant Journal © 2013 Blackwell Publishing Ltd.

  12. Trehalose 6-phosphate signal is closely related to sorbitol in apple (Malus domestica Borkh. cv. Gala) (United States)

    Zhang, Wen; Lunn, John E.; Feil, Regina; Wang, Yufei; Zhao, Jingjing; Tao, Hongxia; Zhao, Zhengyang


    ABSTRACT Trehalose-6-phosphate (Tre6P) is a precursor of trehalose, which is widespread in nature and greatly influences plant growth and development. Tre6P acts as a signal of carbon availability in many plants, but little is known about the function of Tre6P in rosaceous plants, which have specific sorbitol biosynthesis and transportation pathways. In the present study, Tre6P levels and Sorbitol:Tre6P ratios were analyzed in apple (Malus domestica, Borkh. cv. Gala). Tre6P levels were positively correlated with sorbitol content but negatively correlated with sucrose, glucose, and fructose content in developing fruit. However, under sorbitol-limited conditions, Tre6P levels were positively correlated with both sorbitol and sucrose. In the presence of different exogenous sugar supply, Tre6P levels increased corresponding with sorbitol, but this was not the case with sucrose. In addition, Tre6P content and sorbitol:Tre6P ratios were more highly correlated with ADP-glucose levels under sorbitol-limited conditions and fruit development stages, respectively. These results suggest that Tre6P is more closely related to sorbitol than other soluble sugars and has an important role in influencing carbon metabolism in apple. PMID:28069587

  13. [Effect of processing on the antioxidant capacity of the plum (Prunus domestica)]. (United States)

    Valero, Yolmar; Colina, Jhoana; Ineichen, Emilio


    Fruits are considered sources of antioxidant compounds whose properties could impair due to processing. The objective of this work was to determine the effect of blanching and osmotic dehydration on the total polyphenols content, tannins and antioxidant capacity of plums (Prunus domestica) in yellow and red varieties. The total phenolic content in plums was determined according to the Folin-Ciocalteu assay and tannins were determined by vanillin assay. The antiradical efficiency (AE) and ferric reducing power (FRP) were used to estimate the total antioxidant capacity. The content of total polyphenols and tannins were higher in the red plum. The content of polyphenols in the pulp was higher that the peel while for tannins the opposite was observed in both varieties. The red plum had higher antioxidant capacity. The AE was low and slow kinetics for the two varieties. There was a linear correlation between polyphenols and tannins with antiradical efficiency; however, there was no correlation with the reducing power. The total polyphenols content was increased with blanching, while the tannins and the AE decreased, ferric reducing power is unaffected. For osmotic dehydration, the tannins and the AE were decreased, while the total polyphenols content and ferric reducing power are unaffected. It is recommended the blanched as an alternative to consumption and conservation in the plum.

  14. Transcriptomic analysis of Prunus domestica undergoing hypersensitive response to plum pox virus infection. (United States)

    Rodamilans, Bernardo; San León, David; Mühlberger, Louisa; Candresse, Thierry; Neumüller, Michael; Oliveros, Juan Carlos; García, Juan Antonio


    Plum pox virus (PPV) infects Prunus trees around the globe, posing serious fruit production problems and causing severe economic losses. One variety of Prunus domestica, named 'Jojo', develops a hypersensitive response to viral infection. Here we compared infected and non-infected samples using next-generation RNA sequencing to characterize the genetic complexity of the viral population in infected samples and to identify genes involved in development of the resistance response. Analysis of viral reads from the infected samples allowed reconstruction of a PPV-D consensus sequence. De novo reconstruction showed a second viral isolate of the PPV-Rec strain. RNA-seq analysis of PPV-infected 'Jojo' trees identified 2,234 and 786 unigenes that were significantly up- or downregulated, respectively (false discovery rate; FDR≤0.01). Expression of genes associated with defense was generally enhanced, while expression of those related to photosynthesis was repressed. Of the total of 3,020 differentially expressed unigenes, 154 were characterized as potential resistance genes, 10 of which were included in the NBS-LRR type. Given their possible role in plant defense, we selected 75 additional unigenes as candidates for further study. The combination of next-generation sequencing and a Prunus variety that develops a hypersensitive response to PPV infection provided an opportunity to study the factors involved in this plant defense mechanism. Transcriptomic analysis presented an overview of the changes that occur during PPV infection as a whole, and identified candidates suitable for further functional characterization.

  15. Transcriptomic analysis of Prunus domestica undergoing hypersensitive response to plum pox virus infection.

    Directory of Open Access Journals (Sweden)

    Bernardo Rodamilans

    Full Text Available Plum pox virus (PPV infects Prunus trees around the globe, posing serious fruit production problems and causing severe economic losses. One variety of Prunus domestica, named 'Jojo', develops a hypersensitive response to viral infection. Here we compared infected and non-infected samples using next-generation RNA sequencing to characterize the genetic complexity of the viral population in infected samples and to identify genes involved in development of the resistance response. Analysis of viral reads from the infected samples allowed reconstruction of a PPV-D consensus sequence. De novo reconstruction showed a second viral isolate of the PPV-Rec strain. RNA-seq analysis of PPV-infected 'Jojo' trees identified 2,234 and 786 unigenes that were significantly up- or downregulated, respectively (false discovery rate; FDR≤0.01. Expression of genes associated with defense was generally enhanced, while expression of those related to photosynthesis was repressed. Of the total of 3,020 differentially expressed unigenes, 154 were characterized as potential resistance genes, 10 of which were included in the NBS-LRR type. Given their possible role in plant defense, we selected 75 additional unigenes as candidates for further study. The combination of next-generation sequencing and a Prunus variety that develops a hypersensitive response to PPV infection provided an opportunity to study the factors involved in this plant defense mechanism. Transcriptomic analysis presented an overview of the changes that occur during PPV infection as a whole, and identified candidates suitable for further functional characterization.

  16. Inheritance of Propoxur Resistance in a Near-Isogenic Line of Musca domestica (Diptera: Muscidae). (United States)

    Shan, Chao; Zhang, Yi; Ma, Zhuo; Gao, Xiwu


    Propoxur, a carbamate insecticide, has been used worldwide for the control of house flies (Musca domestica L.) for many decades. Resistance levels to propoxur have been detected in field populations of house flies in many parts of the world, including China. In this study, a near-isogenic house fly line (N-PRR) resistant to propoxur was used to determine the mode of inheritance. Bioassay results showed no significant differences in LD50 values or in the slope of log dose-probit lines between the reciprocal F1 and F1’ progenies, and the degree of dominance (D) was more than −1 and less than 0. Chi-square analysis of the responses of self-bred (F2, F2’) and backcross progenies (BC1, BC2, BC1’, and BC2’) indicated that a single gene was responsible for resistance. Propoxur resistance in the N-PRR strain of house fly was inherited as a single, major, autosomal, and incompletely recessive factor. These results should be useful to reveal the mode of inheritance and the development trend of propoxur resistance and develop a systematic strategy for the resistance management in house flies.

  17. The influence of housefly Musca domestica embryo age on viability in water and at low temperatures. (United States)

    Cičková, H; Kozánek, M; Takáč, P


    The sensitivity of housefly Musca domestica L. (Diptera: Muscidae) embryos to storage at low temperatures (5 and 10 °C on moist sponges in Petri dishes) and in water at 26 °C was investigated to develop suitable protocols for the storage and transport of housefly eggs. The youngest embryos (aged 0-3 h) were the most sensitive to storage at 5 °C, with 45% survival after storage for 24 h. Storage of embryos aged 3-12 h at 5 °C for 24 h had no negative effect; longer storage resulted in significantly decreased larval survival (30-34% after 48-72 h, compared with 61% in the control group) and reduced hatching rates (83% after 72 h storage). No negative effects were observed when embryos aged 0-9 h were stored at 10 °C for 24 h, but this temperature did not completely inhibit development and eggs began to hatch if stored for longer than 24 h. All age groups of embryos showed high mortality after storage in water at 26 °C for 24 h, with the youngest embryos being least resistant to submersion.

  18. Biocontrol potential of essential oil monoterpenes against housefly, Musca domestica (Diptera: Muscidae). (United States)

    Kumar, Peeyush; Mishra, Sapna; Malik, Anushree; Satya, Santosh


    Housefly (Musca domestica L.), one of the most common insects in human settlements, has been associated as vectors for various food-borne pathogens, causing food spoilage and disease transmission. The control of housefly was attempted using plant monoterpenes; menthone, menthol, menthyl acetate, limonene, citral and 1,8-cineole, against different life stages of housefly. Bioefficacy against housefly adults revealed highest repellent activity by menthol (95.6 percent) and menthone (83.3 percent). Against housefly larvae, menthol with an LC90 of 0.02 µl/cm(2) in contact toxicity assay and menthone with a LC90 value of 5.4 µl/L in fumigation assay were found to be most effective control agent. With respect to pupicidal activity, superior performance was shown by menthol, citral and 1,8-cineole in contact toxicity assay and citral and 1,8-cineole in fumigation assay. Limonene was found to be the poorest performer in all the assays. Overall, highest efficacy observed for menthol and menthone in various bioassays was in agreement with the results of essential oil activity obtained previously. Significant activity of monoterpenes against various life stages of housefly demonstrates their potential as excellent insecticides with prospects of monoterpenes being developed into eco-friendly and acceptable products for housefly control.

  19. Metabolic and gene expression analysis of apple (Malus x domestica) carotenogenesis. (United States)

    Ampomah-Dwamena, Charles; Dejnoprat, Supinya; Lewis, David; Sutherland, Paul; Volz, Richard K; Allan, Andrew C


    Carotenoid accumulation confers distinct colouration to plant tissues, with effects on plant response to light and as well as health benefits for consumers of plant products. The carotenoid pathway is controlled by flux of metabolites, rate-limiting enzyme steps, feed-back inhibition, and the strength of sink organelles, the plastids, in the cell. In apple (Malus × domestica Borkh), fruit carotenoid concentrations are low in comparison with those in other fruit species. The apple fruit flesh, in particular, begins development with high amounts of chlorophylls and carotenoids, but in all commercial cultivars a large proportion of this is lost by fruit maturity. To understand the control of carotenoid concentrations in apple fruit, metabolic and gene expression analysis of the carotenoid pathway were measured in genotypes with varying flesh and skin colour. Considerable variation in both carotenoid concentrations and compound profile was observed between tissues and genotypes, with carotenes and xanthophylls being found only in fruit accumulating high carotenoid concentrations. The study identified potential rate-limiting steps in carotenogenesis, which suggested that the expression of ZISO, CRTISO, and LCY-ε, in particular, were significant in predicting final carotenoid accumulation in mature apple fruit.

  20. Organization, complexity and allelic diversity of the porcine (Sus scrofa domestica) immunoglobulin lambda locus. (United States)

    Schwartz, John C; Lefranc, Marie-Paule; Murtaugh, Michael P


    We have characterized the organization, complexity, and expression of the porcine (Sus scrofa domestica) immunoglobulin lambda (IGL) light chain locus, which accounts for about half of antibody light chain usage in swine, yet is nearly totally unknown. Twenty-two IGL variable (IGLV) genes were identified that belong to seven subgroups. Nine genes appear to be functional. Eight possess stop codons, frameshifts, or both, and one is missing the V-EXON. Two additional genes are missing an essential cysteine residue and are classified as ORF (open reading frame). The IGLV genes are organized in two distinct clusters, a constant (C)-proximal cluster dominated by genes similar to the human IGLV3 subgroup, and a C-distal cluster dominated by genes most similar to the human IGLV8 and IGLV5 subgroups. Phylogenetic analysis reveals that the porcine IGLV8 subgroup genes have recently expanded, suggesting a particularly effective role in immunity to porcine-specific pathogens. Moreover, expression of IGLV genes is nearly exclusively restricted to the IGLV3 and IGLV8 genes. The constant locus comprises three tandem cassettes comprised of a joining (IGLJ) gene and a constant (IGLC) gene, whereas a fourth downstream IGLJ gene has no corresponding associated IGLC gene. Comparison of individual BACs generated from the same individual revealed polymorphisms in IGLC2 and several IGLV genes, indicating that allelic variation in IGLV further expands the porcine antibody light chain repertoire.

  1. Protein Changes during the Stratification of Malus domestica Borkh. Seed 1 (United States)

    Eichholtz, David A.; Robitaille, Henry A.; Herrmann, Klaus M.


    Apple seeds (Malus domestica Borkh. cv Golden Delicious) were stratified at 5 and 15°C for various lengths, weighed, and soluble protein of axis and cotyledon tissue was analyzed by sodium dodecyl sulfate-polyacrylamide gel electrophoresis. Only seeds treated at 5°C germinated; seeds treated at 15°C did not germinate. Optimal germination required 63 days of stratification. Excised embryos required less stratification time for germination than intact seeds. When stratification was less than 35 days, the resulting seedlings from 5°C stratified embryos were dwarfed and epinastic. After 63 days of stratification, axes from 5 and 15°C treated intact seeds had increased in fresh weight by 72 and 28% (w/w), respectively. The dry weights of the axes did not change significantly and both fresh and dry weights of cotyledons remained unchanged during stratification. Total soluble protein in axes and cotyledons changed very little during stratification. However, axis polypeptide profiles changed. Most obvious was the occurrence of a new polypeptide and the increase of four other clearly identifiable polypeptides during 5°C treatment. The levels of the five most predominant axis proteins decreased at the same time. We observed no changes in the profiles of soluble cotyledon proteins. Control seeds kept at −10°C showed none of the reported changes. Images Fig. 2 PMID:16663079

  2. Characterization of three chalcone synthase-like genes from apple (Malus x domestica Borkh.). (United States)

    Yahyaa, Mosaab; Ali, Samah; Davidovich-Rikanati, Rachel; Ibdah, Muhammad; Shachtier, Alona; Eyal, Yoram; Lewinsohn, Efraim; Ibdah, Mwafaq


    Apple (Malus x domestica Brokh.) is a widely cultivated deciduous tree species of significant economic importance. Apple leaves accumulate high levels of flavonoids and dihydrochalcones, and their formation is dependent on enzymes of the chalcone synthase family. Three CHS genes were cloned from apple leaves and expressed in Escherichia coli. The encoded recombinant enzymes were purified and functionally characterized. In-vitro activity assays indicated that MdCHS1, MdCHS2 and MdCHS3 code for proteins exhibiting polyketide synthase activity that accepted either p-dihydrocoumaroyl-CoA, p-coumaroyl-CoA, or cinnamoyl-CoA as starter CoA substrates in the presence of malonyl-CoA, leading to production of phloretin, naringenin chalcone, and pinocembrin chalcone. MdCHS3 coded a chalcone-dihydrochalcone synthase enzyme with narrower substrate specificity than the previous ones. The apparent Km values of MdCHS3 for p-dihydrocoumaryl-CoA and p-coumaryl-CoA were both 5.0 μM. Expression analyses of MdCHS genes varied according to tissue type. MdCHS1, MdCHS2 and MdCHS3 expression levels were associated with the levels of phloretin accumulate in the respective tissues. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Homing pigeons ( Columba livia f. domestica) can use magnetic cues for locating food (United States)

    Thalau, Peter; Holtkamp-Rötzler, Elke; Fleissner, Gerta; Wiltschko, Wolfgang


    An experimental group of homing pigeons ( Columba livia f. domestica) learned to associate food with a magnetic anomaly produced by bar magnets that were fixed to the bowl in which they received their daily food ration in their home loft; the control group lacked this experience. Both groups were trained to search for two hidden food depots in a rectangular sand-filled arena without obvious visual cues; for the experimental birds, these depots were also marked with three 1.15 × 106 μT bar magnets. During the tests, there were two food depots, one marked with the magnets, the other unmarked; their position within the arena was changed from test to test. The experimental birds searched within 10 cm of the magnetically marked depot in 49% of the test sessions, whereas the control birds searched there in only 11% of the sessions. Both groups searched near the control depot in 11 and 13% of the sessions, respectively. The significant preference of the magnetically marked food depot by the experimental birds shows that homing pigeons cannot only detect a magnetic anomaly but can also use it as a cue for locating hidden food in an open arena.

  4. Pathologic findings in racing pigeons (Columba livia domestica) with "young bird sickness". (United States)

    Scullion, Francis T; Scullion, Mary Geraldine


    "Young bird sickness" is a term used by racing pigeon fanciers to describe a condition that has occurred regularly in recent years and affects pigeons (Columba livia domestica) in their first year of life. It is characterized by slow crop emptying, regurgitation, diarrhea, weight loss, poor performance, and occasionally death. Little scientific information is known about this syndrome to differentiate it from other diseases that occur in young pigeons. In this study, 1 bird from each of 9 lofts where "young bird sickness" was reported was euthanatized for cytologic and postmortem examination. Lesions of the lymphoreticular system, alimentary tract, and respiratory system were the most common findings. Lesions of the lymphoreticular system were present in all birds examined, and 3 birds had histopathologic findings consistent with circovirus infection. Combinations of protozoal, fungal, and mixed bacterial infections were associated with ingluvitis in 7 birds and enteritis in 6 birds. Pneumonitis was found in 5 birds that tested positive for Chlamydophila by polymerase chain reaction. Although "young bird sickness" appears to be a multifactorial condition, a pattern of lesions that involved the lymphoreticular, gastrointestinal, and respiratory systems was evident, whereas diseases of other organ systems were uncommon. These findings suggest that "young bird sickness" may have a common etiology, and circovirus infection is proposed as a possible initiating cause of this syndrome in young racing pigeons in Northern Ireland.

  5. Identification and characterization of mutations in housefly (Musca domestica) acetylcholinesterase involved in insecticide resistance

    DEFF Research Database (Denmark)

    Walsh, Sinead B.; Dolden, Tracey A.; Moores, Graham D.


    Acetylcholinesterase (AChE) insensitive to organophosphate and carbamate insecticides has been identified as a major resistance mechanism in numerous arthropod species. However, the associated genetic changes have been reported in the AChE genes from only three insect species; their role in confe......Acetylcholinesterase (AChE) insensitive to organophosphate and carbamate insecticides has been identified as a major resistance mechanism in numerous arthropod species. However, the associated genetic changes have been reported in the AChE genes from only three insect species; their role...... in conferring insecticide insensitivity has been confirmed, using functional expression, only for those in Drosophila melanogaster. The housefly, Musca domestica, was one of the first insects shown to have this mechanism; here we report the occurrence of five mutations (Val-180 Leu, Gly-262 Ala, Gly-262 Val......, Phe-327 Tyr and Gly-365 Ala) in the AChE gene of this species that, either singly or in combination, confer different spectra of insecticide resistance. The baculovirus expression of wild-type and mutated housefly AChE proteins has confirmed that the mutations each confer relatively modest levels...

  6. Pertumbuhan dan perkembangan larva Musca domestica Linnaeus (Diptera: Muscidae dalam beberapa jenis kotoran ternak

    Directory of Open Access Journals (Sweden)

    Ramadhani Eka Putra


    Full Text Available House fly (Musca domestica is an important urban insect that can transmit various infectious diseases. This insect usually utilized organic wastes as nutrition source for their larvae. One of the main sources of organic wastes is livestock manure produced by animal farming located near human dwelling area. Thus, appropriate house fly population control program at animal farm is needed,based on information on the house fly’s life history. The research is focused on the development of house fly larvae reared with different livestock manures, such as cow, chicken, and horse. As comparison, rice bran were used as control. Results showed that larvae reared with horse manure has the shortest development time (5 days, with lowest larval survival rate (30%, pupal weight (6.8 ± 0.141 g, and weight of female imago (4.9 ± 0.14 g. This finding indicates the lowest nutrition value of horse manure for house flies larvae. Further research is needed to find the effect of manure to variables that directly influence population growth, such as fecundity of female flies and egg survivorship. These additional information on life history will help the design of appropriate house fly population management program for animal farm.

  7. Trehalose 6-phosphate signal is closely related to sorbitol in apple (Malus domestica Borkh. cv. Gala

    Directory of Open Access Journals (Sweden)

    Wen Zhang


    Full Text Available Trehalose-6-phosphate (Tre6P is a precursor of trehalose, which is widespread in nature and greatly influences plant growth and development. Tre6P acts as a signal of carbon availability in many plants, but little is known about the function of Tre6P in rosaceous plants, which have specific sorbitol biosynthesis and transportation pathways. In the present study, Tre6P levels and Sorbitol:Tre6P ratios were analyzed in apple (Malus domestica, Borkh. cv. Gala. Tre6P levels were positively correlated with sorbitol content but negatively correlated with sucrose, glucose, and fructose content in developing fruit. However, under sorbitol-limited conditions, Tre6P levels were positively correlated with both sorbitol and sucrose. In the presence of different exogenous sugar supply, Tre6P levels increased corresponding with sorbitol, but this was not the case with sucrose. In addition, Tre6P content and sorbitol:Tre6P ratios were more highly correlated with ADP-glucose levels under sorbitol-limited conditions and fruit development stages, respectively. These results suggest that Tre6P is more closely related to sorbitol than other soluble sugars and has an important role in influencing carbon metabolism in apple.

  8. Nutritional optimization of a native Beauveria bassiana isolate (HQ917687) pathogenic to housefly, Musca domestica L. (United States)

    Mishra, Sapna; Malik, Anushree


    A new Beauveria bassiana isolate, showing high activity against Musca domestica L. (Diptera: Muscidae) adults (mortality-100.0 %), larvae (mortality-72.3 %) and pupae (Infection in emerged flies-96.7 %) was used. The isolate was subjected to a combinational approach towards selection of process parameters for its growth optimization. Initial screening of several carbon and nitrogen sources revealed glucose and NaNO3 as the most suitable source for optimal biomass and spore production. Further, optimization through Placket-Burman and a 2(5) full factorial central composite design revealed highly significant effect of glucose and pH. The optimum composition for maximum biomass yield was (g/l): glucose 28; NaNO3 2.43; KH2PO4 1.32; MgSO4 0.60; and pH 7.00. Glucose concentration showed almost linear relationship with biomass yield, indicating its significant contribution in medium composition for fungal growth. Highly significant interactions were observed between glucose and pH, followed by glucose and NaNO3 concentration.

  9. Genomewide analysis of TCP transcription factor gene family in Malus domestica

    Indian Academy of Sciences (India)

    Ruirui Xu; Peng Sun; Fengjuan Jia; Longtao Lu; Yuanyuan Li; Shizhong Zhang; Jinguang Huang


    Teosinte branched1/cycloidea/proliferating cell factor1 (TCP) proteins are a large family of transcriptional regulators in angiosperms. They are involved in various biological processes, including development and plant metabolism pathways. In this study, a total of 52 TCP genes were identified in apple (Malus domestica) genome. Bioinformatic methods were employed to predicate and analyse their relevant gene classification, gene structure, chromosome location, sequence alignment and conserved domains of MdTCP proteins. Expression analysis from microarray data showed that the expression levels of 28 and 51 MdTCP genes changed during the ripening and rootstock–scion interaction processes, respectively. The expression patterns of 12 selected MdTCP genes were analysed in different tissues and in response to abiotic stresses. All of the selected genes were detected in at least one of the tissues tested, and most of them were modulated by adverse treatments indicating that the MdTCPs were involved in various developmental and physiological processes. To the best of our knowledge, this is the first study of a genomewide analysis of apple TCP gene family. These results provide valuable information for studies on functions of the TCP transcription factor genes in apple.

  10. Photoreceptor-like outer segments in the pineal organ of the lovebird, Uroloncha domestica (Aves: passeriformes). A scanning electron microscopic study. (United States)

    Ueck, M; Ohnishi, R; Wake, K


    In the pineal organ of the lovebird, Uroloncha domestica, bulbous, cup-shaped and elongated outer segments of photoreceptor-like pinealocytes are demonstrated by scanning electron microscopy. These scarce outer segments, 4-11 micron in length, extend into the pineal lumen. The present structural observations speak in favor of photosensitive pinealocytes in the pineal organ of Uroloncha domestica. The relation of the photoreceptor-like pinealocytes to acetylcholinesterase-positive nerve cells and a nervous connection between the pineal and the brain indicate that the pineal organ of this passeriform species may be the site of neuroendocrine and photoreceptive functions.

  11. Phenotypic variation of the housefly, Musca domestica: amounts and patterns of wing shape asymmetry in wild populations and laboratory colonies. (United States)

    Ludoški, J; Djurakic, M; Pastor, B; Martínez-Sánchez, A I; Rojo, S; Milankov, V


    Musca domestica L. (Diptera: Muscidae) is a vector of a range variety of pathogens infecting humans and animals. During a year, housefly experiences serial population bottlenecks resulted in reduction of genetic diversity. Population structure has also been subjected to different selection regimes created by insect control programs and pest management. Both environmental and genetic disturbances can affect developmental stability, which is often reflected in morphological traits as asymmetry. Since developmental stability is of great adaptive importance, the aim of this study was to examine fluctuating asymmetry (FA), as a measure of developmental instability, in both wild populations and laboratory colonies of M. domestica. The amount and pattern of wing shape FA was compared among samples within each of two groups (laboratory and wild) and between groups. Firstly, the amount of FA does not differ significantly among samples within the group and neither does it differ between groups. Regarding the mean shape of FA, contrary to non-significant difference within the wild population group and among some colonies, the significant difference between groups was found. These results suggest that the laboratory colonies and wild samples differ in buffering mechanisms to perturbations during development. Hence, inbreeding and stochastic processes, mechanisms dominating in the laboratory-bred samples contributed to significant changes in FA of wing shape. Secondly, general patterns of left-right displacements of landmarks across both studied sample groups are consistent. Observed consistent direction of FA implies high degrees of wing integration. Thus, our findings shed light on developmental buffering processes important for population persistence in the environmental change and genetic stress influence on M. domestica.

  12. Estudio preliminar del potencial bioactivo de la Annona cherimola (anona) y Prunus domestica (ciruelo) cultivadas en Costa Rica


    Mirtha Navarro-Hoyos; Ileana Moreira-González; Elizabeth Arnáez-Serrano; Renato Murillo-Masís; Silvia Quesada-Mora; William Zamora-Ramírez; Meliza Cordero-Hernández


    Los efectos beneficiosos de principios activos como alcaloides, triterpenos y más recientemente de los polifenoles en la nutrición y la salud han incrementado a nivel internacional el consumo de productos naturales reconocidos como fuentes de los mismos, así como la importancia de su caracterización estructural en cuanto a la correlación con su bioactividad. Las especies Annona cherimola (anona) y Prunus domestica (ciruelo), cultivadas en Costa Rica, fueron objeto de la presente investigación...

  13. Isospora serinuse n. sp. (Apicomplexa: Eimeriidae) from a domestic canary (Serinus canaria forma domestica) (Passeriformes: Fringillidae) in Western Australia. (United States)

    Yang, Rongchang; Brice, Belinda; Elliot, Aileen; Ryan, Una


    A new species, Isospora serinuse n. sp., (Apicomplexa:Eimeriidae) is described from a single domestic canary (Serinus canaria forma domestica) (subspecies S. c. domestica) in Western Australia. Sporulated oocysts of Isospora serinuse n. sp. are spherical or subspherical, 25.5 (24.4-27.0) × 23.5 (22.0-24.8) μm, with a shape index (length/width) of 1.09; and a smooth bilayered oocyst wall, 1.2 μm thick (outer layer 0.9 μm, inner 0.3 μm). A polar granule is present, but a micropyle and oocyst residuum are absent. The sporocysts are lemon-shaped, 18.9 (17.8-20.2) × 11.8 (10.6-13.0) μm, with a shape index of 1.6. Stieda and substieda bodies are present, the Stieda body being a small crescent shape and the substieda being indistinct. Each sporocyst with four vermiform sporozoites arranged head to tail. A sporocyst residuum is present and composed of numerous granules of different sizes that are scattered among the sporozoites. Morphologically, the oocysts of Isospora serinuse n. sp. were different from those of all known valid Isospora spp. Molecular analysis was conducted at 3 loci: the 18S and 28S ribosomal RNA and two separate regions of subunit I of the mitochondrial cytochrome oxidase (COI) gene (designated COIa and COIb). At the 18S locus, Isospora serinuse n. sp. exhibited 97.5% similarity to Isospora sp. Tokyo from a domestic pigeon (Columba livia domestica) in Japan. At the 28S locus, I. serinuse n. sp. exhibited 94.9% similarity to Isospora anthochaerae n. sp. from a red wattlebird (Anthochaera carunculata) in Australia. At the COIa locus, I. serinuse n. sp. exhibited 95.7% similarity to Isospora sospora sp. ex Apodemus flavicollis from a yellow-necked mouse and Isospora gryphoni from an American goldfinch (Carduelis tristis) respectively. At the COIb locus, I. serinuse n. sp. exhibited 96.7% similarity to an Isospora (iSAT4) from a European pied flycatcher (Ficedula hypoleuca). Based on morphological and molecular data, this isolate is a new

  14. Sources of blood meals of sylvatic Triatoma guasayana near Zurima, Bolivia, assayed with qPCR and 12S cloning. (United States)

    Lucero, David E; Ribera, Wilma; Pizarro, Juan Carlos; Plaza, Carlos; Gordon, Levi W; Peña, Reynaldo; Morrissey, Leslie A; Rizzo, Donna M; Stevens, Lori


    In this study we compared the utility of two molecular biology techniques, cloning of the mitochondrial 12S ribosomal RNA gene and hydrolysis probe-based qPCR, to identify blood meal sources of sylvatic Chagas disease insect vectors collected with live-bait mouse traps (also known as Noireau traps). Fourteen T. guasayana were collected from six georeferenced trap locations in the Andean highlands of the department of Chuquisaca, Bolivia. We detected four blood meals sources with the cloning assay: seven samples were positive for human (Homo sapiens), five for chicken (Gallus gallus) and unicolored blackbird (Agelasticus cyanopus), and one for opossum (Monodelphis domestica). Using the qPCR assay we detected chicken (13 vectors), and human (14 vectors) blood meals as well as an additional blood meal source, Canis sp. (4 vectors). We show that cloning of 12S PCR products, which avoids bias associated with developing primers based on a priori knowledge, detected blood meal sources not previously considered and that species-specific qPCR is more sensitive. All samples identified as positive for a specific blood meal source by the cloning assay were also positive by qPCR. However, not all samples positive by qPCR were positive by cloning. We show the power of combining the cloning assay with the highly sensitive hydrolysis probe-based qPCR assay provides a more complete picture of blood meal sources for insect disease vectors.

  15. Sources of blood meals of sylvatic Triatoma guasayana near Zurima, Bolivia, assayed with qPCR and 12S cloning.

    Directory of Open Access Journals (Sweden)

    David E Lucero


    Full Text Available In this study we compared the utility of two molecular biology techniques, cloning of the mitochondrial 12S ribosomal RNA gene and hydrolysis probe-based qPCR, to identify blood meal sources of sylvatic Chagas disease insect vectors collected with live-bait mouse traps (also known as Noireau traps. Fourteen T. guasayana were collected from six georeferenced trap locations in the Andean highlands of the department of Chuquisaca, Bolivia.We detected four blood meals sources with the cloning assay: seven samples were positive for human (Homo sapiens, five for chicken (Gallus gallus and unicolored blackbird (Agelasticus cyanopus, and one for opossum (Monodelphis domestica. Using the qPCR assay we detected chicken (13 vectors, and human (14 vectors blood meals as well as an additional blood meal source, Canis sp. (4 vectors.We show that cloning of 12S PCR products, which avoids bias associated with developing primers based on a priori knowledge, detected blood meal sources not previously considered and that species-specific qPCR is more sensitive. All samples identified as positive for a specific blood meal source by the cloning assay were also positive by qPCR. However, not all samples positive by qPCR were positive by cloning. We show the power of combining the cloning assay with the highly sensitive hydrolysis probe-based qPCR assay provides a more complete picture of blood meal sources for insect disease vectors.

  16. Feeding preferences of Lutzomyia longipalpis (Diptera: Psychodidae), the sand fly vector, for Leishmania infantum (Kinetoplastida: Trypanosomatidae). (United States)

    Macedo-Silva, Virgínia P; Martins, Daniella R A; De Queiroz, Paula Vivianne Souza; Pinheiro, Marcos Paulo G; Freire, Caio C M; Queiroz, José W; Dupnik, Kathryn M; Pearson, Richard D; Wilson, Mary E; Jeronimo, Selma M B; Ximenes, Maria De Fátima F M


    Leishmania infantum, the causative agent of visceral leishmaniasis (VL) in Brazil, is spread mostly by the bite of the sand fly Lutzomyia longipalpis (Lutz & Neiva). We trapped sand flies in endemic neighborhoods near Natal, Brazil, where cases of human and dog VL were documented. Amplification of species-specific cytochrome b (Cyt b) genes by polymerase chain reaction revealed that sand flies from rural and periurban areas harbored blood from different sources. The most common source ofbloodmeal was human, but blood from dog, chicken, and armadillo was also present. We tested the preference for a source of bloodmeal experimentally by feeding L. longipalpis F1 with blood from different animals. There were significant differences between the proportion of flies engorged and number of eggs laid among flies fed on different sources, varying from 8.4 to 19 (P sand fly oviposition, but human blood also supported sand fly oviposition well. No sand flies fed on cats, and sand flies feeding on the opossum Monodelphis domestica Wagner produced no eggs. These data support the hypothesis that L. longipalpis is an eclectic feeder, and humans are an important source of blood for this sand fly species in periurban areas of Brazil.

  17. Distribution and ultrastructure of neurons in opossum piriform cortex displaying immunoreactivity to GABA and GAD and high-affinity tritiated GABA uptake

    Energy Technology Data Exchange (ETDEWEB)

    Haberly, L.B.; Hansen, D.J.; Feig, S.L.; Presto, S.


    GABAergic neurons have been identified in the piriform cortex of the opossum at light and electron microscopic levels by immunocytochemical localization of GABA and the GABA-synthesizing enzyme glutamic acid decarboxylase and by autoradiographic visualization of high-affinity /sup 3/H-GABA uptake. Four major neuron populations have been distinguished on the basis of soma size, shape, and segregation at specific depths and locations: large horizontal cells in layer Ia of the anterior piriform cortex, small globular cells with thin dendrites concentrated in layers Ib and II of the posterior piriform cortex, and multipolar and fusiform cells concentrated in the deep part of layer III in anterior and posterior parts of the piriform cortex and the subjacent endopiriform nucleus. All four populations were well visualized with both antisera, but the large layer Ia horizontal cells displayed only very light /sup 3/H-GABA uptake, thus suggesting a lack of local axon collaterals or lack of high-affinity GABA uptake sites. The large, ultrastructurally distinctive somata of layer Ia horizontal cells receive a very small number of symmetrical synapses; the thin, axonlike dendrites of small globular cells are exclusively postsynaptic and receive large numbers of both symmetrical and asymmetrical synapses, in contrast to somata which receive a small number of both types; and the deep multipolar and fusiform cells receive a highly variable number of symmetrical and asymmetrical synapses on somata and proximal dendrites. Labeled puncta of axon terminal dimensions were found in large numbers in the neuropil surrounding pyramidal cell somata in layer II and in the endopiriform nucleus. Moderately large numbers of labeled puncta were found in layer I at the depth of pyramidal cell apical dendrites with greater numbers in layer Ia at the depth of distal apical segments than in layer Ib.

  18. Potassium transport in opossum kidney cells: effects of Na-selective and K-selective ionizable cryptands, and of valinomycin, FCCP and nystatin. (United States)

    Loiseau, A; Leroy, C; Castaing, M


    The effects of two ionizable cryptands, the Na-selective (221)C10 and the K-selective (222)C10, and of valinomycin, FCCP and nystatin on K+ fluxes in opossum kidney (OK) cells have been quantified. The Na,K-ATPase (ouabain-sensitive 86Rb influx) was stimulated by nystatin (> or = 20%), and inhibited by the other ionophores (50-80%), by barium (K-channel blocker) (61%) and by amiloride (Na entry blocker) (34%). The Vmax of the Na,K-ATPase phosphatase activity was unmodified by the ionophores, indicating the absence of direct interaction with the enzyme. The ATPi content was unmodified by the inhibitors and nystatin, but was lowered by (221)C10 (47%), (222)C10 (75%), valinomycin (72%) and FCCP (88%). Amiloride was found to partially remove the inhibition caused by (222)C10 (51%) and valinomycin (49%). Rb efflux was stimulated by nystatin (32%), unmodified by valinomycin, and was inhibited by (221)C10 (19%), (222)C10 (19%) and FCCP (10%). Barium (39%) and amiloride (32%) inhibited this efflux and, in their presence, the nystatin effect persisted, whereas that of the other ionophores vanished. At pH 6.4, the Rb efflux decreased by 14% of its value at pH 7.4, with no additional inhibition by cryptands. Cryptands are shown to inhibit the pH-sensitive K+-conductance, probably by inducing a K+-H+ exchange at the plasma membrane, and by uncoupling oxidative phosphorylation by inducing the entry of K+ and H+ (and possibly Ca2+) ions into the mitochondria.

  19. Transforming growth factor-beta1 reduces megalin- and cubilin-mediated endocytosis of albumin in proximal-tubule-derived opossum kidney cells. (United States)

    Gekle, Michael; Knaus, Petra; Nielsen, Rikke; Mildenberger, Sigrid; Freudinger, Ruth; Wohlfarth, Verena; Sauvant, Christoph; Christensen, Erik I


    Transforming growth factor (TGF)-beta1 is a member of a superfamily of multifunctional cytokines involved in several pathological processes of the kidney, including fibrogenesis, apoptosis and epithelial-mesenchymal transition. These events lead to tubulointerstitial fibrosis and glomerulosclerosis. Less is known about TGF-beta1-induced alterations of cell function. An important function of proximal tubular cells is reabsorption of filtered proteins, including albumin, via megalin-cubilin-dependent receptor-mediated endocytosis. In this study we used a well established cell culture model (proximal-tubule-derived opossum kidney (OK) cells) in order to test the hypothesis that TGF-beta1 reduces megalin-cubilin-mediated endocytosis. Previously we have shown that albumin endocytosis in OK cells is mediated by megalin/cubulin. TGF-beta1 led to a time- and dose-dependent downregulation of megalin-cubilin-mediated endocytosis without affecting two other transport systems tested. Binding, internalization and intracellular trafficking of the ligand albumin were affected. Decreased binding resulted from reduced cubilin and megalin expression in the 200 000 g membrane fraction. The underlying mechanism of TGF-beta1 action does not involve mitogen-activated protein kinases, protein kinase C or A, or reactive oxygen species. In contrast, TGF-beta1-induced downregulation of megalin-cubilin-mediated endocytosis was sensitive to inhibition of translation and transcription and was preceded by Smad2 and 3 phosphorylation. Dominant negative Smad2/3 constructs prevented the effect of TGF-beta1. In conclusion our data indicate that enhanced levels of TGF-beta1 occurring in various nephropathies can lead to downregulation of megalin-cubilin-dependent endocytosis. Probably, TGF-beta1 leads to Smad2- and Smad3-dependent expression of negative regulators of receptor-mediated endocytosis.

  20. Initial and final fruit set in some plum (Prunus domestica L. hybrids under different pollination types

    Directory of Open Access Journals (Sweden)

    Glišić Ivana


    Full Text Available The paper presents results of two-year study (2009-2010 of initial and final fruit set in promising plum (Prunus domestica L. hybrids developed at Fruit Research Institute - Čačak, under different pollination conditions. The following hybrids were studied: 38/62/70 (‘Hall’ x ‘California Blue’, 32/21/87 (‘Stanley’ x ‘Scoldus’, IV/63/81 (‘Large Sugar Prune’ x ‘Scoldus’, 22/17/87 (‘Čačanska Najbolja’ x ‘Zh'lta Butilcovidna’, 29/29/87 (‘Stanley’ x ‘Scoldus’ and 34/41/87 (‘Valjevka’ x ‘Čačanska Lepotica’. Each of the hybrids was studied both under self- pollination and open pollination. In vitro pollen germination was also performed as well as characteristics of flowering phenophase and flowering abundance. Generally, the results suggest lower flowering abundance in the second year of the study. Pollen germination ranged from averagely 25.31% (29/29/87 to 40.01% (38/62/70. With averagely 31.59% final fruit set under self-pollination and 29.38% under open pollination variants, respectively, hybrid 34/41/87 gave the best results. The lowest performance was observed in hybrid 32/21/87 with 1.61% and 7.69% final fruit set under self- and open pollination variants, respectively. [Projekat Ministarstva nauke Republike Srbije, br. TR-31064

  1. Is Multifactorial Sex Determination in the House Fly, Musca domestica (L.), Stable Over Time? (United States)

    Meisel, Richard P; Davey, Taira; Son, Jae Hak; Gerry, Alec C; Shono, Toshio; Scott, Jeffrey G


    Sex determination pathways evolve rapidly, usually because of turnover of master regulatory genes at the top of the developmental pathway. Polygenic sex determination is expected to be a transient state between ancestral and derived conditions. However, polygenic sex determination has been observed in numerous animal species, including the house fly, Musca domestica House fly males carry a male-determining factor (M) that can be located on any chromosome, and an individual male may have multiple M factors. Females lack M and/or have a dominant allele of the Md-tra gene (Md-tra (D) ) that acts as a female-determining locus even in the presence of multiple copies of M. We found the frequency and linkage of M in house flies collected in Chino, CA (USA) was relatively unchanged between 1982 and 2014. The frequency of females with Md-tra (D) in the 2014 collection was 33.6% (n = 140). Analysis of these results, plus previously published data, revealed a strong correlation between the frequencies of Md-tra (D) and multiple M males, and we find that these populations are expected to have balanced sex ratios. We also find that fitness values that allow for the invasion and maintenance of multiple sex determining loci suggest that sexually antagonistic selection could be responsible for maintaining polygenic sex determination in house fly populations. The stability over time and equilibrium frequencies within populations suggest the house fly polygenic sex determination system is not in transition, and provide guidance for future investigations on the factors responsible for the polymorphism.

  2. Compositional analysis and insecticidal activity of Eucalyptus globulus (family: Myrtaceae) essential oil against housefly (Musca domestica). (United States)

    Kumar, Peeyush; Mishra, Sapna; Malik, Anushree; Satya, Santosh


    The essential oil of Eucalyptus globulus (Myrtales: Myrtaceae) was evaluated for its chemical composition and insecticidal activity against the housefly, Musca domestica L. (Diptera: Muscidae). Chemical composition of E. globulus oil revealed 1,8-cineole (33.6%), α-pinene (14.2%) and d-limonene (10.1%) as major constituents, while vapour profile of E. globulus oil determined through solid phase microextraction (SPME) analysis showed 1,8-cineole (56.5%), α-pinene (16.9%), d-limonene (5.5%) and linalool acetate (3.4%) as principal components. Vapour phase of the oil showed increase in the contents of oxygenated monoterpenes. Insecticidal activity of E. globulus oil was assessed against larvae and pupae of housefly, through two different bioassays: contact toxicity and fumigation. Contact toxicity assay with larva showed lethal concentration, LC(50), between 2.73 and 0.60μl/cm(2) for different observation days while lethal time, LT(50), varied between 6.0 and 1.7 days. In fumigant assay for housefly larvae, LC(50) values of 66.1 and 50.1μl/l were obtained in 24h and 48h, respectively. Oil treated larvae showed surface shrinkage, spinous cells proliferation and bleb formation in scanning electron microscopy (SEM) observation. Pupicidal effectivity was measured in terms of percentage inhibition rate (PIR) which was 36.0-93.0% for contact toxicity and 67.9-100% for fumigation toxicity assay. Considerable activity of E. globulus oil against larvae and pupae of housefly demonstrates its potentiality as a viable option for the development of eco-friendly product for housefly control.

  3. Venom of the ectoparasitoid, Nasonia vitripennis, influences gene expression in Musca domestica hemocytes. (United States)

    Qian, Cen; Liu, Yang; Fang, Qi; Min-Li, Yan; Liu, Shu-Sheng; Ye, Gong-Yin; Li, Yan-Min


    Insect hosts have evolved potent innate immunity against invasion by parasitoid wasps. Host/parasitoids live in co-evolutionary relationships. Nasonia vitripennis females inject venom into their dipteran hosts just prior to laying eggs on the host's outer integument. The parasitoid larvae are ectoparasitoids because they feed on their hosts within the puparium, but do not enter the host body. We investigated the influence of N. vitripennis venom on the gene expression profile of hemocytes of their hosts, pupae of the housefly, Musca domestica. We prepared venom by isolating venom glands and treated experimental host pupae with venom. We used suppression subtractive hybridization (SSH) to determine the influence of venom on hemocyte gene expression. At 1 h post treatment, we recorded decreases in transcript levels of 133 EST clones derived from forward a subtractive library of host hemocytes and upregulation in transcript levels of 111 EST clones from the reverse library. These genes are related to immune and stress response, cytoskeleton, cell cycle and apoptosis, metabolism, transport, and transcription/translation regulation. We verified the reliability of our data with reverse transcription quantitative real-time PCR analysis of randomly selected genes, and with assays of enzyme activities. These analyses showed that the expression level of all selected genes were downregulated after venom treatment. Outcomes of our experiments support the hypothesis that N. vitripennis venom influences the gene expression in host hemocytes. We conclude that the actions of venom on host gene expression influence host biology in ways that benefit the development and emergence of the next generation of parasitoids.

  4. Structural analysis of an epsilon-class glutathione transferase from housefly, Musca domestica. (United States)

    Nakamura, Chihiro; Yajima, Shunsuke; Miyamoto, Toru; Sue, Masayuki


    Glutathione transferases (GSTs) play an important role in the detoxification of insecticides, and as such, they are a key contributor to enhanced resistance to insecticides. In the housefly (Musca domestica), two epsilon-class GSTs (MdGST6A and MdGST6B) that share high sequence homology have been identified, which are believed to be involved in resistance against insecticides. The structural determinants controlling the substrate specificity and enzyme activity of MdGST6s are unknown. The aim of this study was to crystallize and perform structural analysis of the GST isozyme, MdGST6B. The crystal structure of MdGST6B complexed with reduced glutathione (GSH) was determined at a resolution of 1.8 Å. MdGST6B was found to have a typical GST folding comprised of N-terminal and C-terminal domains. Arg113 and Phe121 on helix 4 were shown to protrude into the substrate binding pocket, and as a result, the entrance of the substrate binding pocket was narrower compared to delta- and epsilon-class GSTs from Africa malaria vector Anopheles gambiae, agGSTd1-6 and agGSTe2, respectively. This substrate pocket narrowing is partly due to the presence of a π-helix in the middle of helix 4. Among the six residues that donate hydrogen bonds to GSH, only Arg113 was located in the C-terminal domain. Ala substitution of Arg113 did not have a significant effect on enzyme activity, suggesting that the Arg113 hydrogen bond does not play a crucial role in catalysis. On the other hand, mutation at Phe108, located just below Arg113 in the binding pocket, reduced the affinity and catalytic activity to both GSH and the electrophilic co-substrate, 1-chloro-2,4-dinitrobenzene.

  5. Juvenile domestic pigs (Sus scrofa domestica) use human-given cues in an object choice task. (United States)

    Nawroth, Christian; Ebersbach, Mirjam; von Borell, Eberhard


    Research on the comprehension of human-given cues by domesticated as well as non-domesticated species has received considerable attention over the last decade. While several species seem to be capable of utilizing these cues, former work with domestic pigs (Sus scrofa domestica) has shown inconclusive results. In this study, we investigated the use of human-given cues in an object choice task by young domestic pigs (N = 17; 7 weeks of age) who had very limited human contact prior to the experiments. Subjects had to choose between two bowls of which only one was baited with a reward. Over the course of five experiments, pigs were able to use proximal and, with some constraints, also distal pointing cues presented in both a dynamic-sustained and in a momentary manner. When the experimenter was pointing from the incorrect bowl towards the correct one, most of the subjects had problems solving the task-indicating that some form of stimulus/local enhancement affected pigs' decision making. Interestingly, pigs were able to utilize the body and head orientation of a human experimenter to locate the hidden reward but failed to co-orient when head or body orientation of the experimenter was directed into distant space with no bowls present. Control trials ruled out the possibility that other factors (e.g. odour cues) affected subjects' choice behaviour. Learning during experiments played a minor role and only occurred in three out of twelve test conditions. We conclude that domestic pigs, even at a very young age, are skilful in utilizing various human-given cues in an object choice task-raising the question whether pigs only used stimulus/local enhancement and associative learning processes or whether they were able to comprehend the communicative nature of at least some of these cues.

  6. Syringeal specialization of frequency control during song production in the Bengalese finch (Lonchura striata domestica). (United States)

    Secora, Kristen R; Peterson, Jennifer R; Urbano, Catherine M; Chung, Boah; Okanoya, Kazuo; Cooper, Brenton G


    Singing in songbirds is a complex, learned behavior which shares many parallels with human speech. The avian vocal organ (syrinx) has two potential sound sources, and each sound generator is under unilateral, ipsilateral neural control. Different songbird species vary in their use of bilateral or unilateral phonation (lateralized sound production) and rapid switching between left and right sound generation (interhemispheric switching of motor control). Bengalese finches (Lonchura striata domestica) have received considerable attention, because they rapidly modify their song in response to manipulations of auditory feedback. However, how the left and right sides of the syrinx contribute to acoustic control of song has not been studied. Three manipulations of lateralized syringeal control of sound production were conducted. First, unilateral syringeal muscular control was eliminated by resection of the left or right tracheosyringeal portion of the hypoglossal nerve, which provides neuromuscular innervation of the syrinx. Spectral and temporal features of song were compared before and after lateralized nerve injury. In a second experiment, either the left or right sound source was devoiced to confirm the role of each sound generator in the control of acoustic phonology. Third, air pressure was recorded before and after unilateral denervation to enable quantification of acoustic change within individual syllables following lateralized nerve resection. These experiments demonstrate that the left sound source produces louder, higher frequency, lower entropy sounds, and the right sound generator produces lower amplitude, lower frequency, higher entropy sounds. The bilateral division of labor is complex and the frequency specialization is the opposite pattern observed in most songbirds. Further, there is evidence for rapid interhemispheric switching during song production. Lateralized control of song production in Bengalese finches may enhance acoustic complexity of song

  7. Manipulation of primary sex ratio in birds: lessons from the homing pigeon (Columba livia domestica). (United States)

    Goerlich-Jansson, Vivian C; Müller, Martina S; Groothuis, Ton G G


    Across various animal taxa not only the secondary sex ratio but also the primary sex ratio (at conception) shows significant deviations from the expected equal proportions of sons and daughters. Birds are especially intriguing to study this phenomenon as avian females are the heterogametic sex (ZW); therefore sex determination might be under direct control of the mother. Avian sex ratios vary in relation to environmental or maternal condition, which can also affect the production of maternal steroids that in turn are involved in reproduction and accumulate in the developing follicle before meiosis. As the proximate mechanisms underlying biased primary sex ratio are largely elusive, we explored how, and to what extent, maternal steroid hormones may be involved in affecting primary or secondary sex ratio in clutches of various species of pigeons. First we demonstrated a clear case of seasonal change in sex ratio in first eggs both in the Rock Pigeon (Columba livia) and in a related species, the Wood Pigeon (Columba palumbus), both producing clutches of two eggs. In the Homing Pigeon (Columba livia domestica), domesticated from the Rock Pigeon, testosterone treatment of breeding females induced a clear male bias, while corticosterone induced a female bias in first eggs and we argue that this is in line with sex allocation theory. We next analyzed treatment effects on follicle formation, yolk mass, and yolk hormones, the latter both pre- and post-ovulatory, in order to test a diversity of potential mechanisms related to both primary and secondary sex ratio manipulation. We conclude that maternal plasma hormone levels may affect several pre-ovulatory mechanisms affecting primary sex ratio, whereas egg hormones are probably involved in secondary sex ratio manipulation only.

  8. Genomic selection for fruit quality traits in apple (Malus×domestica Borkh..

    Directory of Open Access Journals (Sweden)

    Satish Kumar

    Full Text Available The genome sequence of apple (Malus×domestica Borkh. was published more than a year ago, which helped develop an 8K SNP chip to assist in implementing genomic selection (GS. In apple breeding programmes, GS can be used to obtain genomic breeding values (GEBV for choosing next-generation parents or selections for further testing as potential commercial cultivars at a very early stage. Thus GS has the potential to accelerate breeding efficiency significantly because of decreased generation interval or increased selection intensity. We evaluated the accuracy of GS in a population of 1120 seedlings generated from a factorial mating design of four females and two male parents. All seedlings were genotyped using an Illumina Infinium chip comprising 8,000 single nucleotide polymorphisms (SNPs, and were phenotyped for various fruit quality traits. Random-regression best liner unbiased prediction (RR-BLUP and the Bayesian LASSO method were used to obtain GEBV, and compared using a cross-validation approach for their accuracy to predict unobserved BLUP-BV. Accuracies were very similar for both methods, varying from 0.70 to 0.90 for various fruit quality traits. The selection response per unit time using GS compared with the traditional BLUP-based selection were very high (>100% especially for low-heritability traits. Genome-wide average estimated linkage disequilibrium (LD between adjacent SNPs was 0.32, with a relatively slow decay of LD in the long range (r(2 = 0.33 and 0.19 at 100 kb and 1,000 kb respectively, contributing to the higher accuracy of GS. Distribution of estimated SNP effects revealed involvement of large effect genes with likely pleiotropic effects. These results demonstrated that genomic selection is a credible alternative to conventional selection for fruit quality traits.

  9. Syringeal specialization of frequency control during song production in the Bengalese finch (Lonchura striata domestica.

    Directory of Open Access Journals (Sweden)

    Kristen R Secora

    Full Text Available BACKGROUND: Singing in songbirds is a complex, learned behavior which shares many parallels with human speech. The avian vocal organ (syrinx has two potential sound sources, and each sound generator is under unilateral, ipsilateral neural control. Different songbird species vary in their use of bilateral or unilateral phonation (lateralized sound production and rapid switching between left and right sound generation (interhemispheric switching of motor control. Bengalese finches (Lonchura striata domestica have received considerable attention, because they rapidly modify their song in response to manipulations of auditory feedback. However, how the left and right sides of the syrinx contribute to acoustic control of song has not been studied. METHODOLOGY: Three manipulations of lateralized syringeal control of sound production were conducted. First, unilateral syringeal muscular control was eliminated by resection of the left or right tracheosyringeal portion of the hypoglossal nerve, which provides neuromuscular innervation of the syrinx. Spectral and temporal features of song were compared before and after lateralized nerve injury. In a second experiment, either the left or right sound source was devoiced to confirm the role of each sound generator in the control of acoustic phonology. Third, air pressure was recorded before and after unilateral denervation to enable quantification of acoustic change within individual syllables following lateralized nerve resection. SIGNIFICANCE: These experiments demonstrate that the left sound source produces louder, higher frequency, lower entropy sounds, and the right sound generator produces lower amplitude, lower frequency, higher entropy sounds. The bilateral division of labor is complex and the frequency specialization is the opposite pattern observed in most songbirds. Further, there is evidence for rapid interhemispheric switching during song production. Lateralized control of song production in

  10. Campylobacter jejuni in Musca domestica: An examination of survival and transmission potential in light of the innate immune responses of the house flies

    DEFF Research Database (Denmark)

    Gill, Carson; Bahrndorff, Simon; Lowenberger, Carl


    The house fly, Musca domestica, has been implicated as a vector of Campylobacter spp., a major cause of human disease. Little is known whether house flies serve as biological amplifying hosts or mechanical vectors for Campylobacter jejuni. We investigated the period after C. jejuni had been inges...

  11. Quantitative Prediction of Cell Wall Polysaccharide Composition in Grape (Vitis vinifera L.) and Apple (Malus domestica) Skins from Acid Hydrolysis Monosaccharide Profiles

    DEFF Research Database (Denmark)

    Arnous, Anis; Meyer, Anne S.


    On the basis of monosaccharide analysis after acid hydrolysis of fruit skin samples of three wine grape cultivars, Vitis vinifera L. Cabernet Sauvignon, Merlot, and Shiraz, and of two types of apple, Malus domestica Red Delicious and Golden Delicious, an iterative calculation method is reported...

  12. Ectopic expression of class 1 KNOX genes induce and adventitious shoot regeneration and alter growth and development of tobacco (Nicotiana tabacum L) and European plum (Prunus domestica L) (United States)

    Transgenic plants of tobacco (Nicotiana tabacum L) and plum (Prunus domestica L) were produced by transforming with apple class 1 KNOX genes (MdKN1 and MdKN2) or corn KN1 gene. Transgenic tobacco plants were regenerated in vitro from transformed leaf discs cultured in a tissue medium lacking cytoki...

  13. The Effects of Temperature and Innate Immunity on Transmission of Campylobacter jejuni (Campylobacterales: Campylobacteraceae) Between Life Stages of Musca domestica (Diptera: Muscidae)

    DEFF Research Database (Denmark)

    Bahrndorff, Simon; Gill, C.; Lowenberger, C.


    The house fly (Musca domestica L.) is a well-established vector of human pathogens, including Campylobacter spp., which can cause infection of broiler chicken flocks, and through contaminated broiler meat can cause outbreaks of campylobacteriosis in humans. We investigated whether Campylobacter j...

  14. Reproduction and longevity of Supputius cincticeps (Het.: Pentatomidae fed with larvae of Zophobas confusa, Tenebrio molitor (Col.: Tenebrionidae or Musca domestica (Dip.: Muscidae

    Directory of Open Access Journals (Sweden)

    José Cola Zanuncio


    Full Text Available Reproduction and longevity of Supputius cincticeps (Stål (Heteroptera: Pentatomidae fed on Zophobas confusa Gebien, Tenebrio molitor L. (Coleoptera: Tenebrionidae or Musca domestica (L. (Diptera: Muscidae larvae were studied during two generations at 24.7 ± 1.1ºC, 70 ± 10% R.H. and 12 h of photophase. Body weight of newly-emerged adults, oviposition period, number of egg masses, total number of eggs and longevity of S. cincticeps were higher when fed on Z. confusa or T. molitor larvae than on M. domestica larvae. Regardless of diet, S. cincticeps showed better reproduction and longevity in the second generation in laboratory conditions.Foram avaliadas, em duas gerações, a reprodução e a longevidade de Supputius cincticeps (Stål (Heteroptera: Pentatomidae alimentado com larvas de Zophobas confusa Gebien, Tenebrio molitor L. (Coleoptera: Tenebrionidae ou Musca domestica (L. (Diptera: Muscidae a 24,7 ± 1,1ºC, 70 ± 10% de U.R. e fotofase de 12 h. O peso de adultos recém emergidos, o período de oviposição, o número de posturas, de ovos totais e a longevidade de fêmeas de S. cincticeps foram maiores com larvas de Z. confusa ou T. molitor que com M. domestica. Independentemente do tipo de presa, S. cincticeps mostrou melhor performance reprodutiva e longevidade na segunda geração.


    Directory of Open Access Journals (Sweden)

    Priscila Maria da Silva Gomes


    Full Text Available The synanthropic animals of a particular locality corresponds to some species of wild native fauna that have adapted either temporary or permanently, the new environment modified by human action. Musca domestica and Chrysomya megacephala have a eusinantropico behavior, or their life cycle occurs in anthropized environment. So the article aims to contribute to the characterization of Musca domestica L. (Diptera: Muscidae and Chrysomya megacephala (Fabricius (Diptera: Calliphoridae among the main species of harmful synanthropic flies food health importance. The control populations of harmful synanthropic species requires knowledge of the bionomics of the species. The adoption of advertising campaigns, environmental and health education projects, citizenship, to the biological vector control should be focused on: food waste reduction; Promotion programs (and expansion of existing ones of basic separation of organic waste, inorganic and risk of domestic origin, commercial and various public and private service activities; Mapping of special areas of risk to public health, especially areas with most polluting activity by human excreta and secretions and domestic animals, organic waste and wastewater focuses exposed to open air, aimed at implementing a continuous system of hygiene and sanitation, integrating the activities of various sectors of society in these areas DOI:

  16. Characterization of resistance gene analogues (RGAs in apple (Malus × domestica Borkh. and their evolutionary history of the Rosaceae family.

    Directory of Open Access Journals (Sweden)

    Michele Perazzolli

    Full Text Available The family of resistance gene analogues (RGAs with a nucleotide-binding site (NBS domain accounts for the largest number of disease resistance genes and is one of the largest gene families in plants. We have identified 868 RGAs in the genome of the apple (Malus × domestica Borkh. cultivar 'Golden Delicious'. This represents 1.51% of the total number of predicted genes for this cultivar. Several evolutionary features are pronounced in M. domestica, including a high fraction (80% of RGAs occurring in clusters. This suggests frequent tandem duplication and ectopic translocation events. Of the identified RGAs, 56% are located preferentially on six chromosomes (Chr 2, 7, 8, 10, 11, and 15, and 25% are located on Chr 2. TIR-NBS and non-TIR-NBS classes of RGAs are primarily exclusive of different chromosomes, and 99% of non-TIR-NBS RGAs are located on Chr 11. A phylogenetic reconstruction was conducted to study the evolution of RGAs in the Rosaceae family. More than 1400 RGAs were identified in six species based on their NBS domain, and a neighbor-joining analysis was used to reconstruct the phylogenetic relationships among the protein sequences. Specific phylogenetic clades were found for RGAs of Malus, Fragaria, and Rosa, indicating genus-specific evolution of resistance genes. However, strikingly similar RGAs were shared in Malus, Pyrus, and Prunus, indicating high conservation of specific RGAs and suggesting a monophyletic origin of these three genera.

  17. Molecular detection and antimicrobial resistance of Klebsiella pneumoniae from house flies (Musca domestica) in kitchens, farms, hospitals and slaughterhouses. (United States)

    Ranjbar, Reza; Izadi, Morteza; Hafshejani, Taghi T; Khamesipour, Faham


    Identifying disease vectors and pathogens is one of the key steps in controlling vector-borne diseases. This study investigated the possible role of house flies (Musca domestica) as vectors in the transmission of Klebsiella pneumoniae in Chaharmahal VA Bakhtiari and Isfahan provinces of Iran. House flies were captured from household kitchens, cattle farms, chicken farms, animal hospitals, human hospitals and slaughterhouses. Isolation of K. pneumoniae from external surfaces and guts of the flies was performed using MacConkey agar (MA) and thioglycollate broth (TGB). Identification of the isolates was performed with phenotypic techniques and polymerase chain reaction (PCR). A total of 600 house flies were sampled during the study period from different locations in four different seasons. Overall, 11.3% of the captured house flies were positive for K. pneumoniae. In Chaharmahal VA Bakhtiari province, the prevalence was 12.7%, while in Isfahan province, 10.0% of the sampled house flies were infected with K. pneumoniae. Season-wise, the highest prevalence of infections among the house flies was in summer. The organisms were highly resistant to ampicillin, amoxicillin, cefotaxime and piperacillin. A lowest level of resistance was observed for imipenem/cilastatin. The findings of this study demonstrated that house flies are potential vectors of antibiotic-resistant K. pneumoniae in Isfahan and Chaharmahal provinces, Iran. Control efforts for infections caused by this particular bacterium should take M. domestica into account.

  18. Apple ring rot-responsive putative microRNAs revealed by high-throughput sequencing in Malus × domestica Borkh. (United States)

    Yu, Xin-Yi; Du, Bei-Bei; Gao, Zhi-Hong; Zhang, Shi-Jie; Tu, Xu-Tong; Chen, Xiao-Yun; Zhang, Zhen; Qu, Shen-Chun


    MicroRNAs (miRNAs) are small non-coding RNAs, which silence target mRNA via cleavage or translational inhibition to function in regulating gene expression. MiRNAs act as important regulators of plant development and stress response. For understanding the role of miRNAs responsive to apple ring rot stress, we identified disease-responsive miRNAs using high-throughput sequencing in Malus × domestica Borkh.. Four small RNA libraries were constructed from two control strains in M. domestica, crabapple (CKHu) and Fuji Naga-fu No. 6 (CKFu), and two disease stress strains, crabapple (DSHu) and Fuji Naga-fu No. 6 (DSFu). A total of 59 miRNA families were identified and five miRNAs might be responsive to apple ring rot infection and validated via qRT-PCR. Furthermore, we predicted 76 target genes which were regulated by conserved miRNAs potentially. Our study demonstrated that miRNAs was responsive to apple ring rot infection and may have important implications on apple disease resistance.

  19. Phenology of Spalangia endius Walker (Hymenoptera, Pteromalidae in pupae of Musca domestica Linnaeus (Diptera, Muscidae under laboratory conditions

    Directory of Open Access Journals (Sweden)

    Dani Furtado de Araújo


    Full Text Available This work describes the phenology of Spalangia endius Walker in pupae of Musca domestica Linnaeus under laboratory conditions. In order to understand the developmental cycle of Spalangia endius under laboratory conditions, 360 Musca domestica pupae aged from 24 to 48 hours were exposed to 15 S. endius pairs for a period of 24 hours at 26 ± 2ºC. These pupae were kept in a BOD incubator at the same temperature, with a relative humidity of <70%, and 12 hours photophase. Fifteen hymenopteran specimens were dissected daily to evaluate their stage and development time. The phenology concluded that S. endius had a development cycle of 19 days with an incubation period of 24 hours. The development of the larvae of S. endius occurred in the subsequent eight days, during which a series of morphological alterations were observed. The pre-pupal stage occurred on the tenth day, where the movement ceased and elimination of the meconium started. The pupal stage occurred from the 11th to the 19th day, with emergence of males first, followed by female emergence approximately 24 hours later. These results allowed the evaluation of aspects of the detailed bionomics of the development of S. endius in order to record and program production of this parasitoid, thus optimizing its utilization as a biological control agent.

  20. Characterization of resistance gene analogues (RGAs) in apple (Malus × domestica Borkh.) and their evolutionary history of the Rosaceae family. (United States)

    Perazzolli, Michele; Malacarne, Giulia; Baldo, Angela; Righetti, Laura; Bailey, Aubrey; Fontana, Paolo; Velasco, Riccardo; Malnoy, Mickael


    The family of resistance gene analogues (RGAs) with a nucleotide-binding site (NBS) domain accounts for the largest number of disease resistance genes and is one of the largest gene families in plants. We have identified 868 RGAs in the genome of the apple (Malus × domestica Borkh.) cultivar 'Golden Delicious'. This represents 1.51% of the total number of predicted genes for this cultivar. Several evolutionary features are pronounced in M. domestica, including a high fraction (80%) of RGAs occurring in clusters. This suggests frequent tandem duplication and ectopic translocation events. Of the identified RGAs, 56% are located preferentially on six chromosomes (Chr 2, 7, 8, 10, 11, and 15), and 25% are located on Chr 2. TIR-NBS and non-TIR-NBS classes of RGAs are primarily exclusive of different chromosomes, and 99% of non-TIR-NBS RGAs are located on Chr 11. A phylogenetic reconstruction was conducted to study the evolution of RGAs in the Rosaceae family. More than 1400 RGAs were identified in six species based on their NBS domain, and a neighbor-joining analysis was used to reconstruct the phylogenetic relationships among the protein sequences. Specific phylogenetic clades were found for RGAs of Malus, Fragaria, and Rosa, indicating genus-specific evolution of resistance genes. However, strikingly similar RGAs were shared in Malus, Pyrus, and Prunus, indicating high conservation of specific RGAs and suggesting a monophyletic origin of these three genera.

  1. Cloning, expression, and purification of a new antibacterial substance gene from larvae of Musca domestica (Diptera: Muscidae). (United States)

    Pei, Zhihua; Bian, Lu; Zhang, Hui; Gao, Yunhang; Ma, Hongxia


    Musca domestica L. (Diptera: Muscidae), the housefly, exhibits unique immune defenses and can produce antibacterial substances upon stimulation with bacteria. On the basis of the cDNA library constructed using the suppression subtractive hybridization method, a 1188-bp antibacterial substance gene, which we named AS566, was amplified by rapid amplification of cDNA ends from M. domestica larva stimulated with Salmonella pullorum (Enterobacteriaceae: Salmonella). In this study, the full-length AS566 gene was cloned and inserted into a His-tagged Escherichia coli (Enterobacteriaceae: Escherichia) prokaryotic expression system to enable production of the recombinant protein. The recombinant AS566 protein was purified in denatured form from inclusion bodies and renatured to obtain functionally active AS566 protein. The bacteriostatic activity of the recombinant purified AS566 protein was assessed using the Oxford plate assay system and the results indicated that AS566 had antibacterial activity against six bacteria, including an E. coli clinical isolate, S. pullorum, Streptococcus bovis (Streptococcaceae: Streptococcus), Streptococcus suis, and Staphylococcus aureus (Staphylococcaceae: Staphylococcus) in vitro. The antibacterial activity of AS566 toward Gram- bacteria was two times greater than that against Gram+ bacteria. The sequencing results and BLAST analysis showed that the antibacterial substance gene AS566 was not homologous to any other antibacterial substance genes in GenBank. The antibacterial mechanisms of the newly discovered AS566 protein warrant further study.

  2. Transmission Electron Microscopic Morphological Study and Flow Cytometric Viability Assessment of Acinetobacter baumannii Susceptible to Musca domestica cecropin

    Directory of Open Access Journals (Sweden)

    Shuiqing Gui


    Full Text Available Multidrug-resistant (MDR Acinetobacter baumannii infections are difficult to treat owing to the extremely limited armamentarium. Expectations about antimicrobial peptides' use as new powerful antibacterial agents have been raised on the basis of their unique mechanism of action. Musca domestica cecropin (Mdc, a novel antimicrobial peptide from the larvae of Housefly (Musca domestica, has potently active against Gram-positive and Gram-negative bacteria standard strain. Here we evaluated the antibacterial activity of Mdc against clinical isolates of MDR-A. baumannii and elucidate the related antibacterial mechanisms. The minimal inhibitory concentration (MIC of Mdc was 4 μg/mL. Bactericidal kinetics of Mdc revealed rapid killing of A. baumannii (30 min. Flow cytometry using viability stain demonstrated that Mdc causes A. baumannii membrane permeabilization in a concentration- and time-dependent process, which correlates with the bactericidal action. Moreover, transmission electron microscopic (TEM examination showed that Mdc is capable of disrupting the membrane of bacterial cells, resulting in efflux of essential cytoplasmic components. Overall, Mdc could be a promising antibacterial agent for MDR-A. baumannii infections.

  3. A xenodiagnostic method using Musca domestica for the diagnosis of gastric habronemosis and examining the anthelmintic efficacy of moxidectin. (United States)

    Schuster, Rolf K; Sivakumar, Saritha


    Equine habronematidosis has a global distribution and is caused by three spirurid species, Habronema muscae, Habronema microstoma and Draschia megastoma. A case of cutaneous habronematidosis in a stallion in a stable in Dubai, UAE gave occasion to investigate the parasite situation on the farm. Patent H. muscae infections were diagnosed in 18 out of 49 horses in a stable in Dubai, UAE with a xenodiagnostic test using houseflies as indicator host. All horses in the stable were treated with a single dose of moxidectin administered orally as 2% gel in a dosage of 0.4 mg/kg body weight and the efficacy of this targeted treatment was studied. Habronema infection was terminated in all horses. A fly survey conducted at the farm prior and after treatment revealed two muscid species: Musca domestica and Stomoxys calcitrans. Only M. domestica caught at the farm showed a natural infection with Habronema larvae prior and shortly after anthelmintic treatment. Later, examination of flies caught at the farm in monthly intervals up to the end of observation (8 months after treatment) gave negative results. The absence of infection in the intermediate host was an indication of the eradication of stomach worms. The described xenodiagnostic test is a useful tool to diagnose H. muscae infections and can be used to evaluate the efficacy of nematocides in equines.

  4. Sustainable production of housefly (Musca domestica) larvae as a protein-rich feed ingredient by utilizing cattle manure (United States)

    Hussein, Mahmoud; Pillai, Viju V.; Goddard, Joshua M.; Park, Hui G.; Kothapalli, Kumar S.; Ross, Deborah A.; Ketterings, Quirine M.; Brenna, J. Thomas; Milstein, Mark B.; Marquis, Helene; Johnson, Patricia A.; Nyrop, Jan P.


    The common housefly, Musca domestica, is a considerable component of nutrient recycling in the environment. Use of housefly larvae to biodegrade manure presents an opportunity to reduce waste disposal while the rapidly assimilated insect biomass can also be used as a protein rich animal feed. In this study, we examine the biodegradation of dairy cattle manure using housefly larvae, and the nutritional value of the resulting larva meal as a feed ingredient. Our results demonstrated that dairy cattle manure presents a balanced substrate for larval growth, and the spent manure showed reductions in concentration of total nitrogen (24.9%) and phosphorus (6.2%) with an overall reduction in mass. Larva yield at an optimum density was approximately 2% of manure weight. Nutritional analysis of M. domestica larva meal showed values comparable to most high protein feed ingredients. Larva meal was 60% protein with a well-balanced amino acid profile, and 20% fat with 57% monounsaturated fatty acids, and 39% saturated fatty acids. Larva meal lacked any significant amount of omega-3 fatty acids. Evaluation of micronutrients in larva meal suggested that it is a good source of calcium and phosphorus (0.5% and 1.1% respectively). The nutritional value of larva meal closely matches that of fishmeal, making it a potentially attractive alternative for use as a protein-rich feed ingredient for livestock and aquaculture operations. PMID:28170420

  5. The Impact of Different Water Regime on Chlorophyll Fluorescence of Pyrus pyraster L. and Sorbus domestica L

    Directory of Open Access Journals (Sweden)

    Viera Šajbidorová


    Full Text Available The water deficit is considered to be significant cause of photosynthesis defects. Measuring of chlorophyll fluorescence is one of the methods revealing defects in the photosynthetic apparatus. The experiment was established with two woody plant (Pyrus pyraster L. and Sorbus domestica L. cultivated in two different regimes of the substrate saturation. The measurement of the modulated fluorescence of chlorophyll a was done by FMS1 fluorometer during three-week period between June and September (2012 and 2013. There were analysed selected parameters of chlorophyll fluorescence: Fv/Fm – maximum quantum efficiency of PSII, ΦPSII – effective quantum yield of PSII and RFD – chlorophyll fluorescence decrease ratio. According to the obtained results, Pyrus pyraster has probably higher potential for adaptation to water deficiency. There were recorded the significant decreases mainly in the values of parameter RFD and ΦPSII for Sorbus domestica within duration of experiment with different water regime in both growing seasons 2012 and 2013. The results document a weak sensitivity of the parameter Fv/Fm on changes in the amount of available water in the substrate in both taxa.

  6. Adaptation of Musca domestica L. field population to laboratory breeding causes transcriptional alterations.

    Directory of Open Access Journals (Sweden)

    Dorte H Højland

    Full Text Available BACKGROUND: The housefly, Musca domestica, has developed resistance to most insecticides applied for its control. Expression of genes coding for detoxification enzymes play a role in the response of the housefly when encountered by a xenobiotic. The highest level of constitutive gene expression of nine P450 genes was previously found in a newly-collected susceptible field population in comparison to three insecticide-resistant laboratory strains and a laboratory reference strain. RESULTS: We compared gene expression of five P450s by qPCR as well as global gene expression by RNAseq in the newly-acquired field population (845b in generation F1, F13 and F29 to test how gene expression changes following laboratory adaption. Four (CYP6A1, CYP6A36, CYP6D3, CYP6G4 of five investigated P450 genes adapted to breeding by decreasing expression. CYP6D1 showed higher female expression in F29 than in F1. For males, about half of the genes accessed in the global gene expression were up-regulated in F13 and F29 in comparison with the F1 population. In females, 60% of the genes were up-regulated in F13 in comparison with F1, while 33% were up-regulated in F29. Forty potential P450 genes were identified. In most cases, P450 gene expression was decreased in F13 flies in comparison with F1. Gene expression then increased from F13 to F29 in males and decreased further in females. CONCLUSION: The global gene expression changes massively during adaptation to laboratory breeding. In general, global expression decreased as a result of laboratory adaption in males, while female expression was not unidirectional. Expression of P450 genes was in general down-regulated as a result of laboratory adaption. Expression of hexamerin, coding for a storage protein was increased, while gene expression of genes coding for amylases decreased. This suggests a major impact of the surrounding environment on gene response to xenobiotics and genetic composition of housefly strains.

  7. A comparative examination of odontogenic gene expression in both toothed and toothless amniotes (United States)

    Lainoff, Alexis J.; Moustakas-Verho, Jacqueline E.; Hu, Diane; Kallonen, Aki; Marcucio, Ralph S.; Hlusko, Leslea J.


    A well-known tenet of murine tooth development is that BMP4 and FGF8 antagonistically initiate odontogenesis, but whether this tenet is conserved across amniotes is largely unexplored. Moreover, changes in BMP4-signaling have previously been implicated in evolutionary tooth loss in Aves. Here we demonstrate that Bmp4, Msx1, and Msx2 expression is limited proximally in the red-eared slider turtle (Trachemys scripta) mandible at stages equivalent to those at which odontogenesis is initiated in mice, a similar finding to previously reported results in chicks. To address whether the limited domains in the turtle and the chicken indicate an evolutionary molecular parallelism, or whether the domains simply constitute an ancestral phenotype, we assessed gene expression in a toothed reptile (the American alligator, Alligator mississippiensis) and a toothed non-placental mammal (the gray short-tailed opossum, Monodelphis domestica). We demonstrate that the Bmp4 domain is limited proximally in M. domestica and that the Fgf8 domain is limited distally in A. mississippiensis just preceding odontogenesis. Additionally, we show that Msx1 and Msx2 expression patterns in these species differ from those found in mice. Our data suggest that a limited Bmp4 domain does not necessarily correlate with edentulism, and reveal that the initiation of odontogenesis in non-murine amniotes is more complex than previously imagined. Our data also suggest a partially conserved odontogenic program in T. scripta, as indicated by conserved Pitx2, Pax9, and Barx1 expression patterns and by the presence of a Shh-expressing palatal epithelium, which we hypothesize may represent potential dental rudiments based on the Testudinata fossil record. PMID:25678399

  8. A comparative examination of odontogenic gene expression in both toothed and toothless amniotes. (United States)

    Lainoff, Alexis J; Moustakas-Verho, Jacqueline E; Hu, Diane; Kallonen, Aki; Marcucio, Ralph S; Hlusko, Leslea J


    A well-known tenet of murine tooth development is that BMP4 and FGF8 antagonistically initiate odontogenesis, but whether this tenet is conserved across amniotes is largely unexplored. Moreover, changes in BMP4-signaling have previously been implicated in evolutionary tooth loss in Aves. Here we demonstrate that Bmp4, Msx1, and Msx2 expression is limited proximally in the red-eared slider turtle (Trachemys scripta) mandible at stages equivalent to those at which odontogenesis is initiated in mice, a similar finding to previously reported results in chicks. To address whether the limited domains in the turtle and the chicken indicate an evolutionary molecular parallelism, or whether the domains simply constitute an ancestral phenotype, we assessed gene expression in a toothed reptile (the American alligator, Alligator mississippiensis) and a toothed non-placental mammal (the gray short-tailed opossum, Monodelphis domestica). We demonstrate that the Bmp4 domain is limited proximally in M. domestica and that the Fgf8 domain is limited distally in A. mississippiensis just preceding odontogenesis. Additionally, we show that Msx1 and Msx2 expression patterns in these species differ from those found in mice. Our data suggest that a limited Bmp4 domain does not necessarily correlate with edentulism, and reveal that the initiation of odontogenesis in non-murine amniotes is more complex than previously imagined. Our data also suggest a partially conserved odontogenic program in T. scripta, as indicated by conserved Pitx2, Pax9, and Barx1 expression patterns and by the presence of a Shh-expressing palatal epithelium, which we hypothesize may represent potential dental rudiments based on the Testudinata fossil record. © 2015 Wiley Periodicals, Inc.

  9. Use of bioluminescent Escherichia coli to determine retention during the life cycle of the housefly, Musca domestica (Diptera: Muscidae, L). (United States)

    Schuster, Greta L; Donaldson, Janet R; Buntyn, Joe O; Duoss, Heather A; Callaway, Todd R; Carroll, Jeff A; Falkenberg, Shollie M; Schmidt, Ty B


    Researchers have documented that the housefly (Musca domestica) can serve as a vector for the spread of foodborne pathogens to livestock, food, and humans. Most studies have investigated Musca domestica as a vector only after the fly comes into contact or consumes the pathogen as an adult. The objective of this study was to determine whether the larvae of Musca domestica could ingest Escherichia coli from bovine manure and whether the E. coli could survive the metamorphosis process and be transmitted. Larvae (n=960) were incubated in sterilized bovine manure inoculated with 0, 3, 5, and 8 log10 colony-forming units (CFU)/mL of bioluminescent E. coli for 24 (larvae stage), 48 (larvae stage), 120 (pupae stage), and 192 h (adult stage). Larvae incubated for 24 h in bovine manure possessed 0.0, 2.7, 2.9, and 3.5 log(10) CFU/mL of E. coli, from inoculated with 0, 3, 5, and 8 log(10) CFU/mL of E. coli, respectively. Concentrations of E. coli within the pupae were 0.0, 1.7, 1.9, and 2.2 log(10) CFU/mL for each inoculation concentration, respectively. Flies that emerged from the pupae stage contained 0.0, 1.3, 2.2, and 1.7 log(10) CFU/mL of E. coli from larvae incubated in manure inoculated with concentrations of E. coli, respectively. These results suggest the housefly can emerge with quantities of E. coli. While this was an enteropathogenic E. coli (EPEC), these data may suggest that if the fly is capable of retaining similar concentrations of an enterohemorrhagic E. coli (EHEC), these concentrations may be capable of initiating illness in humans. Furthermore, the E. coli concentration within and on adult flies is related to environmental exposure. It must be noted that larvae were incubated in sterilized bovine manure, and there was no other bacterial competition for the E. coli. Thus, the rate of positive flies and concentrations present when flies emerged may vary under more realistic conditions.

  10. Macrochelid Mite, Macrocheles muscaedomesticae (Acarina: Macrochelidae as a Biological Control Agent Against House Fly, Musca domestica (Diptera: Muscidae in Egypt

    Directory of Open Access Journals (Sweden)



    Full Text Available Numerous species of macrochelids (Acarina: Mesostigmata have shown capability to attack housefly larvae and eggs but it is presumed that only a few of them play a significant role in the control of flies in nature. Macrocheles muscaedomesticae (Scopoli is one of several mites that feeds on eggs, newly hatched and small larvae of house fly Musca domestica L. This study provide avidence that macrochelid mite is attacking not only housefly larvae and eggs but also on housefly adults. Macrocheles muscaedomesticae mite was reared in the laboratory on house fly frozen eggs and first instar of larvae at constant conditions of 28°C±1 and 90% relative humidity using sterilized artificial diet. The mean incubation period of eggs, total immatures, female longevity were 0.7, 4.0 and 25.2 days, respectively when fed on frozen eggs meanwhile means were 0.8, 7.0 and 22.6 days when fed on first instar larvae of M. domestica. The total consumption of female was 131.1 eggs/female or 82.7 larvae. Results of the present study showed that the mean mortality percentages of eggs due to predation of three levels of predator 2, 5 and 10 individuals were 57.2, 74.9 and 96.5 after 5, 4, 2 days, respectively. Also, the larval stage of M. domestica was introduced with three levels of 10, 20 and 25 individuals for each level of predatory mite 2, 5 and 10 adults, respectively. Results revealed that the best results were recorded at the level of 5 mites, where the mean mortality percentage of larvae was 100% after one day when introduced with 10 housefly’s larvae but it was 96% after two days when introduced with 20 housefly’s larvae and 76.2% after three days when introduced with 25 houseflies larvae at level of 5. In addition, the present study provide evidence that mites can consume the housefly adult stage. Our findings indicated that the best results were recorded at the level of 10 mites where the mean mortality percentages of adults were 83.55%, the fly died after

  11. Do climatic and physical factors affect populations of the blow fly Chrysomya megacephala and house fly Musca domestica? (United States)

    Ngoen-klan, Ratchadawan; Moophayak, Kittikhun; Klong-klaew, Tunwadee; Irvine, Kim N; Sukontason, Kabkaew L; Prangkio, Chira; Somboon, Pradya; Sukontason, Kom


    The blow fly, Chrysomya megacephala (Fabricius), and house fly, Musca domestica L., are medically and forensically important flies. The population dynamic of these flies is essential for both control and forensical aspects. The aim of this study was to investigate the climatic and physical factors affecting the population trend of both species in Chiang Mai province, northern Thailand, using the Geographic Information System (GIS). Based on systematic random sampling, 18 study sites were selected in three districts (Mueang Chiang Mai, Mae Rim, and Hang Dong). Six land use types were involved in the study sites, i.e., disturbed mixed deciduous, mixed deciduous forest, mixed orchard, lowland village, city, and paddy field. Adult flies were sampled every 2 weeks using an in-house prototype reconstructable funnel trap. Two types of bait were used--one with fresh beef viscera for luring M. domestica and the other with 1-day tainted beef viscera for luring C. megacephala. Collections were conducted from May 2009 to May 2010, and analysis of climatic factors (temperature, relative humidity, and light intensity) was carried out. Correlation bivariate analysis was performed initially to determine the relationship between climatic factors and the number of flies. Consequently, an ordinary co-kriging approach, in ArcGIS 9.2, was performed to predict the spatial distribution of flies with land use and climatic factors as co-variables. A total of 63,158 flies were captured, with C. megacephala being the most common species collected (68.37%), while only 1.3% were M. domestica, thus proving that C. megacephala was the most abundant species in several land use types. A significantly higher number of females than males was found in both species. Fly populations can be collected throughout most of the year with a peak in late summer, which shows a positive relation to temperature but negative correlation with relative humidity. C. megacephala was predicted to be abundant in every

  12. Karyotype characterization and nucleolar organizer regions of marsupial species (Didelphidae from areas of Cerrado and Atlantic Forest in Brazil

    Directory of Open Access Journals (Sweden)

    Núbia P. Pereira


    Full Text Available The karyotypes of 23 specimens belonging to 16 species from nine genera of Brazilian marsupials (family Didelphidae were studied. The animals were collected in eight localities of Cerrado or Atlantic Forest biomes in the states of Goiás, Tocantins and São Paulo. The karyotypes were analyzed after conventional Giemsa staining and silver staining of the nucleolus organizer regions (Ag-NORs. New karyotypic data were obtained for Gracilinanus microtarsus (2n = 14, FN = 24, Marmosops paulensis (2n = 14, FN = 24 , Micoreus paraguayanus (2n = 14, FN = 20 and Monodelphis rubida (2n = 18, FN = 32 and are discussed in detail. The karyotypes of G. microtarsus , M. paulensis and M. paraguayanus include three large pairs of submetacentrics (pairs 1, 2 and 3 and a medium-sized metacentric or submetacentric pair 4. Pairs 5 and 6 are small submetacentrics in G. microtarsus and M. paulensis and acrocentrics in M. paraguayanus . M. paulensis presented a single Ag-NOR in pair 6 (6p6p, while M. paraguayanus exhibited multiple Ag-NORs in pairs 5 and 6 (5pq5pq6p6p. There was variation in size and morphology of the sex chromosomes among these species. Monodelphis rubida presented a karyotype with 2n = 18 and FN = 32 composed of a large submetacentric pair 1, a medium-sized metacentric pair 2 and six pairs of submetacentrics (pairs 3 through 8. The X was a small acrocentric and the Y was dot-like. A single Ag-NOR bearing pair (5p5p characterized M. rubida. Relevant karyotypic information was obtained for 19 specimens belonging to 12 species collected in areas sampled for the first time [ Caluromys lanatus and C. philander (2n = 14, FN = 20, Gracilinanus emiliae (2n = 14, FN = 24, Marmosa murina , Metachirus nudicaudatus and Micoureus demerarae (2n = 14, FN = 20, Monodelphis americana (2n = 18, FN = 32 and M. domestica (2n = 18, FN = 20, and Didelphis marsupialis, Philander frenata, P. opossum and P. sp (2n = 22, FN = 20]. Although the karyotypes were relatively

  13. Using multilevel systematic sampling to study apple fruit (Malus domestica Borkh.) quality and its variability at the orchard scale

    DEFF Research Database (Denmark)

    Martínez Vega, Mabel V.; Wulfsohn, Dvoralai; Clemmensen, Line Katrine Harder


    We report on the performance of a novel sampling method for determining fruit quality variability and yield from an orchard, which focus on its applicability for the fruit industry. We used the ‘fractionator’ tree sampling method to investigate the quality variability of a small, representative...... sample of ‘Granny Smith’ (Malus x domestica cv. ‘Granny Smith’) apples obtained from a 17 ha orchard based on a final sample of 74 fruit. Estimates of fruit marketable yield and fruit size distribution agreed well with packing house records. The estimated marketable yield was 356.6 ± 89.2 t compared.......29 and CVtF = 0.09). From the quality characteristics studied only fruit mass could be significantly related to position of the fruit in the canopy, represented by height of the fruit above ground, the fruit position along the branch and position relative to the tree row orientation in the orchard...


    Directory of Open Access Journals (Sweden)



    Full Text Available The aim of this study was to determine the antioxidant activity as well as total phenol (TPC and total flavonoid content (TFC in two fruits, apple (Malus domestica and green beans (Phaseolus vulgaris. The antioxidant activities were examined by two different methods namely DPPH free radical scavenging activity and reducing power scavenging activity. The results showed that considerable amount of TPC and TFC was present in these fruit extracts as well as these vegetables contain a vast array of different phytochemicals in their dry form. Apple showed higher antioxidant activity than green beans. Phytochemical screening revealed the presence of saponins, steroids, flavonoids and carbohydrates & glycosides in all the extracts. Overall, the present results provided basic data for choosing these fruits with high antioxidant capacity for consumption or for the development of antioxidant based medicines as value-added products.

  15. Temporal changes in the abundance of Musca domestica Linn (Diptera: Muscidae) in poultry farms in Penang, Malaysia. (United States)

    Jin, Bong Lee; Jaal, Zairi


    Changes in the abundance of the house fly, Musca domestica, was studied for a period of one year in two poultry farms in Penang, Malaysia: one in Balik Pulau, located in Penang island, and the other in Juru, located on mainland Penang. The sampling of house flies were carried out from March 2007 to April 2008 using the Scudder grill, and the correlation with meteorological conditions particularly rainfall, relative humidity and temperature were observed. In Balik Pulau, the fly abundance showed an inverse relationship to relative humidity and total rainfall. However, no significant correlations were found between the abundance of flies and the above mentioned climatic factors. In contrast, the occurrence of flies in Juru showed strong correlation indices with relative humidity (r=0.803, p<0.05) and total rainfall (r=0.731, p<0.05). Temperature had no significant effect on the abundance of flies in both poultry farms due to imperceptible changes in monthly temperature.

  16. Old Apple (Malus domestica L. Borkh) Varieties with Hypoallergenic Properties: An Integrated Approach for Studying Apple Allergenicity. (United States)

    Vegro, Mara; Eccher, Giulia; Populin, Francesca; Sorgato, Chiara; Savazzini, Federica; Pagliarani, Giulia; Tartarini, Stefano; Pasini, Gabriella; Curioni, Andrea; Antico, Andrea; Botton, Alessandro


    Freshly consumed apples (Malus domestica L. Borkh) can cause allergic reactions because of the presence of four classes of allergens. Knowledge of the genetic factors affecting the allergenic potential of apples would provide important information for the selection of hypoallergenic genotypes, which can be combined with the adoption of new agronomical practices to produce fruits with a reduced amount of allergens. In the present research, a multiple analytical approach was adopted to characterize the allergenic potential of 24 apple varieties released at different ages (pre- and post-green revolution). A specific workflow was set up including protein quantification by means of polyclonal antibodies, immunological analyses with sera of allergic subjects, enzymatic assays, clinical assessments on allergic patients, and gene expression assays on fruit samples. Taken as a whole, the results indicate that most of the less allergenic genotypes were found among those deriving from selection processes carried out prior to the so-called "green revolution".

  17. Isolation and identification of house fly,Musca domestica L., repellents from pepper tree,Schinus molle L. (United States)

    Wimalaratne, P D; Slessor, K N; Borden, J H; Chong, L J; Abate, T


    Foliage from the pepper tree,Schinus molle L., is traditionally used in Ethiopia to "repel" house flies,Musca domestica L. The volatile extracts of pepper tree leaves were shown to have repellent and feeding-deterrent activity against house flies in a two-choice laboratory bioassay. High-performance liquid chromatographic fractionation of steam-distilled volatiles from leaves, monitored by laboratory bioassays, demonstrated that bioactivity is associated with two compounds,cis-menth-2-en-1-ol andtrans-piperitol. The absolute configuration of the latter was established as (1S,6S)-piperitol by comparison of acetyl lactate derivatives. Racemic compounds were synthesized from piperitone, and bioassays with house flies indicatedtrans-piperitol to be the most active house fly repellent.

  18. Ana insect model for assessing arsenic toxicity: Arsenic elevated glutathione content in the musca domestica and trichoplusia ni

    Energy Technology Data Exchange (ETDEWEB)

    Zaman, K.; Pardini, R.S. [Univ. of Nevada, Reno, NV (United States)


    Throughout history, arsenic has acquired an unparalled reputation as a poison. Arsenic was used as a poison as early as 2000 B.C. The toxicity of arsenic (As) extends to mammals, fish, insects, plants and fungi. According to epidemiological evidence, inorganic arsenic compounds have been strongly suggested as human carcinogens. Human exposure to arsenic through various means is correlated with an increased incidence of skin, lung, and possibly liver cancers. Inorganic trivalent arsenic is systematically more poisonous than the pentavalent form and it is possible that pentavalent arsenic is reduced to the trivalent form before exerting any toxic effects. This study focuses on the potential to use two insect species, the housefly, Musca domestica and the cabbage looper moth, Trichoplusia ni, and a model for the study of arsenic toxicity. After 48 hours of exposure to Arsenic, a significant induction of Glutathione level and subsequent decrease in the level of GSSG in both species were observed. 21 refs., 2 figs., 1 tab.

  19. Housefly (Musca domestica as Carrier of Enterotoxigenic Staphylococcus aureus in Broiler Farms in Iran: Is it Important for Public Health?

    Directory of Open Access Journals (Sweden)

    Rashki Ghalehnoo


    Full Text Available Background During the last decade, the prevalence of insect borne diseases due to contaminated food as well as the outbreaks of diseases due to enterotoxin-producing Staphylococcus aureus (ETSA strains has increased. Objectives This study was conducted to determine the prevalence rate, enterotoxigenecity, and antimicrobial resistance of S. aureus isolated from M. domestica collected from the residential areas of nine districts broiler farms in Zabol, Iran. Materials and Methods The flies were captured with a sterile nylon net and washed twice with distilled water. The contents were streaked onto selective media and S. aureus was identified using the conventional biochemical tests. Antimicrobial susceptibility testing was performed using CLSI guideline. Staphylococcal enterotoxins (SEs, SEA, SEB, SEC and SED, was detected by the reverse passive latex agglutination (PRLA method. Coagulase typing was performed with coagulase typing kit. Results A total of 87 (17% S. aureus was isolated from 450 samples. The ability to synthesize staphylococcal enterotoxins (SEs was determined in 62 of 87 (71% isolates. SE type B was the most common enterotoxin found in the isolated S. aureus (45%, followed by SE type A (26%, SE type C (5%, SE type D (8%, SEA + SEC (7% and SEA + SEB (7%. Among the antibiotic tested, Penicillin was the most resistant antibiotic tested. Sixty seven percent of isolates belonged to coagulase type III, VI, VII, VIII, IV, and V. Conclusions Our results suggest that S. aureus, including ETSA, is being carried by house flies such as M. domestica and may contribute to the spread of pathogenic isolates, with an impact on public health.

  20. Unusual pseudomyiasis with Musca domestica (housefly) larvae in a tracheostomy wound: a case report and literature review. (United States)

    Shakeel, Mohammad; Khan, Iram; Ahmad, Imteyaz; Iqbal, Zafar; Hasan, Syed Abrar


    We report a case of pseudomyiasis (accidental myiasis) in a 52-year-old man who had previously undergone surgery and placement of a tracheostomy tube for laryngeal cancer. The patient presented to our outpatient department with a foul-smelling, blood-stained discharge and frequent and severe episodic pain at the site of the tracheostomy. He also reported the discharge of many whitish larvae from the site. On clinical examination, 3 of these larvae were removed from the tracheostomy wound and later identified as Musca domestica (housefly) larvae. The patient underwent further mechanical removal twice daily for 3 days, during which time 23 more larvae, or maggots, were removed. His condition improved, and he returned for regular follow-up with no recurrence or complications. Myiasis is an infestation of humans and vertebrate animals by insect larvae that feed on both dead and living tissue. Myiasis is most common in hot and humid climates in tropical and subtropical regions, such as the underdeveloped areas of India, Africa, and Southeast Asia, which provide favorable breeding grounds for flies. Myiasis is classified as specific, semispecific, or accidental, depending on whether the fly larvae require a host in order to develop. We review the literature on myiasis and its entomologic aspects in general. We also discuss the need for the proper care of tracheostomy wound myiasis because the site of such an infestation is close to vital organs in the neck. To the best of our knowledge, only 3 cases of tracheostomy wound myiasis have been previously reported in the English-language literature; 2 of them involved infestation with Chrysomyia bezziana larvae and 1 with Lucilia caesar larvae. We believe our case is the first case of tracheostomy wound pseudomyiasis attributable to M domestica larvae.

  1. Effects of different animal manures on attraction and reproductive behaviors of common house fly, Musca domestica L. (United States)

    Shah, Rizwan Mustafa; Azhar, Faheem; Shad, Sarfraz Ali; Walker, William B; Azeem, Muhammad; Binyameen, Muhammad


    Insects rely mainly on their well-developed and highly sophisticated olfactory system to discriminate volatile cues released from host and nonhost substances, mates, oviposition substrates, and food sources. Onset of first mating, mating duration, and onset of first oviposition, oviposition period, fecundity (number of eggs laid by a female), and longevity of freshly emerged Musca domestica L. (Diptera: Muscidae) adults were observed in the presence of different animal manures: cow, horse, donkey, poultry, and an artificial diet. The M. domestica adults exposed to horse manure showed a delay in onset of first mating and first oviposition, prolonged mating duration, and reduced fecundity compared to the artificial diet (control). Likewise, the fecundity was reduced in the presence of donkey manure as compared to artificial diet. The onset of first mating was delayed and duration of first mating was shortened in the presence of cow manure as compared to artificial diet and no oviposition was observed throughout the duration of the experiment. However, the reproductive behaviors and all fitness measures in adults exposed to poultry manure were similar or even better, compared to the artificial diet. Surprisingly, in a free-choice attraction assay, the highest numbers of adult flies were attracted toward the cow manure as compared to all other manures as well as the artificial diet. However, the numbers of flies captured in all other types of manures were not different than the artificial diet (control). Furthermore, chemical analysis of headspace samples of manures revealed qualitative differences in odor (volatile) profiles of all manures and artificial diet, indicating that behavioral differences could be due to the differences in the volatile chemistry of the adult ovipositional substrates and larval growth mediums. This study may contribute toward both understanding the linkage between ecological adaptations and host selection mechanisms and the development of

  2. Use of Neem (Azadirachta indica A. Juss Oil in The Control of Musca domestica L.(Diptera:Muscidae in Poultry Breeding Farms.

    Directory of Open Access Journals (Sweden)

    Amanda Flávia S Rovida


    Full Text Available Pest infestation, in general such as flies, is a problem faced by poultry workers in poultry breeding farms. Control of these populations is desirable, due to the damage they cause and, most times, it is done through chemical management, with insecticide application. Musca domestica is one of the species with the greatest ability to develop resistance to insecticides, and the digestive system, especially the midgut, is one of the most vulnerable organs to structural alteration, because in it there is production of digestive enzymes and absorption of nutrients. Damage caused by use of synthetic insecticides reactivated studies with bioinsecticides for being one of the most selective options in pest control. Furthermore, they do not cause environmental alterations such as food, soil, water poisoning and they are practically nontoxic to mammals. Among vegetable species with insecticidal activities that have been used a lot, we have neem, subtropical plant that shows low residual power and lower risk of intoxication for mammals and poultry. Thus the objectives that guided this work, was the observation of morphological alteration in M. domestica larvae and malformation of pupae after the use of neem, powder and emulsifiable oil at different concentrations (0,5%, 1%, 1,5% were tested. Following, after the applications, the midgut of flies in larval stage was isolated, processed and analyzed under light microscopy, scanning and transmission electron microscopy. As in most dipterous, the cell types found were columnar cells and regenerative cells, which showed alterations such as: coalescing vacuoles, intercellular spaces, formation of cytoplasmic protrusions, broken microvilli, rough endoplasmic reticulum and dilated mitochondria. The statistical analysis registered for pupa malformation showed significant results in comparison to control, but there was no difference among treatments. The different concentrations of neem oil contributed in altering

  3. The Malus domestica sugar transporter gene family: identifications based on genome and expression profiling related to the accumulation of fruit sugars



    In plants, sugar transporters are involved not only in long-distance transport, but also in sugar accumulations in sink cells. To identify members of sugar transporter gene families and to analyze their function in fruit sugar accumulation, we conducted a phylogenetic analysis of the Malus domestica genome. Expression profiling was performed with shoot tips, mature leaves, and developed fruit of ‘Gala’ apple. Genes for sugar alcohol (including 17 sorbitol transporters), sucrose, and monosacch...

  4. 鄂尔多斯市家蝇抗药性调查分析%Insecticide resistance in Musca domestica in Ordos

    Institute of Scientific and Technical Information of China (English)

    王玲芳; 海玉和; 白长义; 高慧; 蔺权德


    Objective To determine current resistance to commonly used insecticides in the natural population of Musca domestica in Ordos city, in order to evidence for proper application of insecticides for fly control. Methods Topical application method was used in the study. Results The natural populations of M. Domestica in Ordos city had developed various degrees of resistances to dichlorovos, deltamethrin and beta-cypermethrin, with resistance ratios of 19.39, 48.05, and 407.69, respectively. Propoxur resulted in low fatality in M. Domestica. Conclusion The natural populations of M. Domestica in Ordos city had low resistance to dichlorovos and high resistance to deltamethrin and beta-cypermethrin. Propoxur had a low lethality rate in the flies.%目的 了解鄂尔多斯市近年来家蝇自然种群对常用卫生杀虫剂的抗药性现状,为合理使用杀虫剂和指导灭蝇工作提供依据.方法 采用微量点滴法.结果 鄂尔多斯市家蝇自然种群对敌敌畏、溴氰菊酯、高效氯氰菊酯已呈现出不同程度的抗药性,抗性倍数依次为19.39、48.05和407.69倍,残杀威对家蝇的致死率较低.结论 鄂尔多斯市家蝇自然种群对敌敌畏的抗药性较低,对溴氰菊酯和高效氯氰菊酯呈现高抗水平,对残杀威致死率较低.

  5. Cross-resistance, genetics, and realized heritability of resistance to fipronil in the house fly, Musca domestica (Diptera: Muscidae): a potential vector for disease transmission. (United States)

    Abbas, Naeem; Khan, Hafiz Azhar Ali; Shad, Sarfraz Ali


    Houseflies, Musca domestica (L.), are ubiquitous pests that have the potential to spread a variety of pathogens to humans, poultries, and dairies. Pesticides are commonly used for the management of this pest. Fipronil is a GABA-gated chloride channel-inhibiting insecticide that has been commonly used for the management of different pests including M. domestica throughout the world. Many pests have developed resistance to this insecticide. A field-collected strain of M. domestica was selected with fipronil for continuous 11 generations to assess the cross-resistance, genetics, and realized heritability for designing a resistance management strategy. Laboratory bioassays were performed using the feeding method of mixing insecticide concentrations with 20% sugar solutions and cotton soaks dipped in insecticide solutions were provided to tested adult flies. Bioassay results at G12 showed that the fipronil-selected strain developed a resistance ratio of 140-fold compared to the susceptible strain. Synergism bioassay with piperonyl butoxide (PBO) and S,S,S,-tributyl phosphorotrithioate (DEF) indicated that fipronil resistance was associated with microsomal oxidase and also esterase. Reciprocal crosses between resistant and susceptible strains showed an autosomal and incompletely dominant resistance to fipronil. The LC50 values of F1 and F'1 strains were not significantly different and dominance values were 0.74 and 0.64, respectively. The resistance to fipronil was completely recessive (D(ML) = 0.00) at the highest dose and incompletely dominant at the lowest dose (D(ML) = 0.87). The monogenic resistance based on chi-square goodness of fit test and calculation of the minimum number of segregating genes showed that resistance to fipronil is controlled by multiple genes. The fipronil resistance strain confirmed very low cross-resistance to emamectin benzoate and spinosad while no cross-resistance to chlorpyrifos and acetamiprid when compared to that of the field population

  6. 天津市北辰家蝇抗药性调查%Investigation on resistance to drugs of musca domestica in Beichen District of Tianjin

    Institute of Scientific and Technical Information of China (English)

    王淑惠; 张静; 孟庆贺


    Objective To understand the resistance to drugs of musca domestica in Beichen District of Tianjin, and instruct people to use insecticides properly. Method Determine the median lethal dose (LD50) of musca domestica by dropping method. Results The LD50 values of musca domestica against 5 common insecticides of DDVP, beta - cypermethrin, deltamethrin, propoxur and permethrin were 0. 0 530, 0. 0 310, 0.0 217, 0. 1 902 and 0. 0 262 μg per musca domestica, respectively. Compared with sensitive insects, the R/S values of DDVP was 10. 0 times, beta - cypermethrin was 50. 82 times, deltamethrin was 22. 85 times, propoxur was 3. 30 times and permethrin was 2. 34 times. Conclusions The musca domestica in Beichen District had different resistances against the 5 common insecticides, of which, beta - cypermethrin and deltamethrin had the most significant effect We suggested to strengthen the monitoring of resistance to drugs, use insecticides properly, and adopt comprehensive control strategies so as to reduce the development of resistance to drugs.%目的 了解天津北辰区家蝇抗药性情况,指导合理使用杀虫剂.方法 用点滴法测定家蝇半数致死量(LD50).结果 北辰区家蝇对5种常用杀虫剂的LD50依次为敌敌畏0.0 530μg/只、高效氯氰菊酯0.0 310μg/只、溴氰菊酯0.0217μg/只、残杀威0.1902μg/只、氯菊酯0.0 262μg/只.与敏感试虫相比,R/S值敌敌畏为10.0倍、高效氯氰菊酯为50.82倍、溴氰菊酯为22.85倍、残杀威为3.30倍、氯菊酯为2.34倍.结论 北辰区野外家蝇对5种常见杀虫剂均产生不同程度的抗药性,以高效氯氰菊酯和溴氰菊酯最为著.建议加强抗药性监测,科学合理用药,采取综合防治措施,减缓抗药性的发展.

  7. House Fly (Musca domestica L. (Diptera Muscidae Development in Different Types of Manure Desarrollo de la Mosca Doméstica (Musca domestica L. (Díptera Muscidae en Distintos Tipos de Estiércol

    Directory of Open Access Journals (Sweden)

    Patricia Larraín S


    Full Text Available Animal production units with different management systems can be found along the Huasco Valley, Region of Atacama, Chile. These constitute sources of house flies (Musca domestica L. and other vector fly species that cause damage to animals and nuisance problems in urban areas. In order to asses the importance of fly breeding sources, an experiment was carried out under laboratory conditions to evaluate different types of animal manure and composted swine manure. Time of larval development, larva mortality, pupa size, and weight and time of development to the adult stage were assessed. Results show that swine, poultry and calf manure produced a significantly higher number of adult flies, shorter life cycles and larger and heavier pupae. Cow, dog, goat and horse manure follow in effectiviveness for fly production. Composted swine manure was totally ineffective for domestic fly development.En algunas comunas del Valle del Huasco, Región de Atacama, Chile, se encuentran diversas explotaciones pecuarias con diferentes sistemas de manejo, las cuales constituyen focos generadores de mosca doméstica, Musca domestica L., y otras especies de moscas con importancia sanitaria y médica. Estos insectos provocan pérdidas económicas en dichos planteles afectando además el bienestar de poblaciones urbanas cercanas. Con el objetivo de cuantificar la importancia de dichos focos en la generación de mosca doméstica, se realizó un ensayo de laboratorio donde se evaluó como sustrato de desarrollo del insecto estiércol de diferentes especies animales y estiércol de cerdo compostado. La calidad de estos sustratos en la producción del insecto se evaluó a través de los siguientes parámetros biológicos: tiempo de desarrollo de larvas, mortalidad de larvas, tamaño y peso de pupas, y tiempo hasta la emergencia de moscas adultas. Los resultados indicaron que el estiércol de cerdo, gallina y ternero produce significativamente más moscas adultas, con un

  8. Estrogenic Effect of 70% Ethanol Turmeric (Curcuma domestica Val. Extract on Ovariectomized Female Mice (Mus musculus L.

    Directory of Open Access Journals (Sweden)

    A.N. Dewi


    Full Text Available The influence of extract turmeric (Curcuma domestica Val. on endometrium thickness, vaginal epithelium, mammary gland, and protein of estrogen receptor of ovariectomized mice was examined. Twenty five ovariectomized mice which were divided into five groups, were treated by ethynilestradiol (8,4 x 10-3 g, aquades (10 ml, and turmeric extract at doses 230 mg/kg b.w.; 310 mg/kg b.w.; and 390 mg/kg b.w. for eight days. At the end of experiments the mice were killed, then the uterus, vagina, and mammae were removed and the wet weight of uterus was recorded. Uterus, vagina, and mammae were examined histologically. Estrogen receptor protein from uterus were analized by using SDS-PAGE. One way anava test showed that turmeric extract at doses 310 mg/kg b.w. and 390 mg/kg b.w give estrogenic effect on vaginal ephitelium, endometrium thickness, and diametre of mammary glands. SDS-PAGE analysis showed there were differences in protein concentration between control and treatment groups which were seen in the thickness of the bands. Estrogen receptor band could be detected in sampel of treatment groups at molecular weight 45 kDa.

  9. No contact transmission of avian bornavirus in experimentally infected cockatiels (Nymphicus hollandicus) and domestic canaries (Serinus canaria forma domestica). (United States)

    Rubbenstroth, Dennis; Brosinski, Katrin; Rinder, Monika; Olbert, Marita; Kaspers, Bernd; Korbel, Rüdiger; Staeheli, Peter


    Avian bornaviruses (ABV) are the causative agents of proventricular dilatation disease (PDD), a widely distributed disease of parrots. Distinct ABV lineages were also found in various non-psittacine avian species, such as canaries, but the pathogenic role of ABV in these species is less clear. Despite the wide distribution of ABV in captive parrots and canaries, its mode of transmission is poorly understood: both horizontal transmission via the urofaecal-oral route and vertical transmission are discussed to play a role. In this study we investigated pathology and horizontal transmission of ABV in domestic canaries (Serinus canaria forma domestica) and cockatiels (Nymphicus hollandicus), two natural host species commonly used for experimental ABV infections. ABV inoculation resulted in persistent infection of all inoculated animals from both species. ABV-infected cockatiels exhibited PDD-like symptoms, such as neurologic signs or shedding of undigested seeds. In contrast, infected domestic canaries did not develop clinical disease. Interestingly, we did not detect viral RNA in cloacal swabs and organ samples or ABV-specific antibodies in serum samples of contact-exposed sentinel birds from either species at any time during a four months observation period. Our results strongly indicate that horizontal transmission of ABV by direct contact is inefficient in immunocompetent fully fledged domestic canaries and cockatiels. Copyright © 2014 Elsevier B.V. All rights reserved.

  10. Insecticide Mixtures Could Enhance the Toxicity of Insecticides in a Resistant Dairy Population of Musca domestica L (United States)

    Khan, Hafiz Azhar Ali; Akram, Waseem; Shad, Sarfraz Ali; Lee, Jong-Jin


    House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-“A” and LC50: LC50-“B”) significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies. PMID:23613758

  11. Suppressing Sorbitol Synthesis Substantially Alters the Global Expression Profile of Stress Response Genes in Apple (Malus domestica) Leaves. (United States)

    Wu, Ting; Wang, Yi; Zheng, Yi; Fei, Zhangjun; Dandekar, Abhaya M; Xu, Kenong; Han, Zhenhai; Cheng, Lailiang


    Sorbitol is a major product of photosynthesis in apple (Malus domestica) that is involved in carbohydrate metabolism and stress tolerance. However, little is known about how the global transcript levels in apple leaves respond to decreased sorbitol synthesis. In this study we used RNA sequencing (RNA-seq) profiling to characterize the transcriptome of leaves from transgenic lines of the apple cultivar 'Greensleeves' exhibiting suppressed expression of aldose-6-phosphate reductase (A6PR) to gain insights into sorbitol function and the consequences of decreased sorbitol synthesis on gene expression. We observed that, although the leaves of the low sorbitol transgenic lines accumulate higher levels of various primary metabolites, only very limited changes were found in the levels of transcripts associated with primary metabolism. We suggest that this is indicative of post-transcriptional and/or post-translational regulation of primary metabolite accumulation and central carbon metabolism. However, we identified significantly enriched gene ontology terms belonging to the 'stress related process' category in the antisense lines (P-value sorbitol plays a role in the responses of apple trees to abiotic and biotic stresses.

  12. Attenuation of veterinary antibiotics in full-scale vermicomposting of swine manure via the housefly larvae (Musca domestica) (United States)

    Zhang, Zhijian; Shen, Jianguo; Wang, Hang; Liu, Meng; Wu, Longhua; Ping, Fan; He, Qiang; Li, Hongyi; Zheng, Changfeng; Xu, Xinhua


    Animal waste from concentrated swine farms is widely considered to be a source of environmental pollution, and the introduction of veterinary antibiotics in animal manure to ecosystems is rapidly becoming a major public health concern. A housefly larvae (Musca domestica) vermireactor has been increasingly adopted for swine manure value-added bioconversion and pollution control, but few studies have investigated its efficiency on antibiotic attenuation during manure vermicomposting. In this study we explored the capacity and related attenuation mechanisms of antibiotic degradation and its linkage with waste reduction by field sampling during a typical cycle (6 days) of full-scale larvae manure vermicomposting. Nine antibiotics were dramatically removed during the 6-day vermicomposting process, including tetracyclines, sulfonamides, and fluoroquinolones. Of these, oxytetracycline and ciprofloxacin exhibited the greater reduction rate of 23.8 and 32.9 mg m-2, respectively. Environmental temperature, pH, and total phosphorus were negatively linked to the level of residual antibiotics, while organic matter, total Kjeldahl nitrogen, microbial respiration intensity, and moisture exhibited a positive effect. Pyrosequencing data revealed that the dominant phyla related to Firmicutes, Bacteroidetes, and Proteobacteria accelerated manure biodegradation likely through enzyme catalytic reactions, which may enhance antibiotic attenuation during vermicomposting.

  13. Does freezing and dynamic flexing of frozen branches impact the cavitation resistance of Malus domestica and the Populus clone Walker? (United States)

    Christensen-Dalsgaard, Karen K; Tyree, Melvin T


    Frost damage to the xylem conduits of trees is a phenomenon of eco-physiological importance. It is often documented in terms of the percentage loss of conductivity (PLC), an indicator of air filling of the conduits. However, trees that refill their conduits in spring could be impacted more by damage to the conduits that reduce cavitation resistance, making them more susceptible to future drought events. We investigated whether ice formation, dynamic flexing of frozen branches or freeze-thaw events could reduce the cavitation resistance (cause "frost fatigue") in first-year shoots of apple (Malus domestica) and clonal hybrid cottonwood (Walker). Frost fatigue was measured in terms of P50 (the negative xylem pressure required to cause a 50 % loss of conductivity). All treatment groups showed significant frost fatigue, with the exception of the pre-flushed, constantly frozen poplar branches. The P50 following freeze treatments was approximately 50 % of the pre-freeze values. The effect tended to be greater in freeze-thawed branches. Dynamic bending of the branches had no effect on either PLC or P50. In three out of four cases, there was a significant correlation between P50 and PLC. Frost fatigue occurred in both apple and poplar, two unrelated species with different drought and frost tolerances, suggesting that it may be a widespread phenomenon that could impact the ecophysiology of temperate forests.

  14. Quantitative and qualitative changes of the carboxylesterase associated with beta-cypermethrin resistance in the housefly, Musca domestica (Diptera: Muscidae). (United States)

    Zhang, Lan; Shi, Jing; Shi, Xueyan; Liang, Pei; Gao, Junping; Gao, Xiwu


    Mechanisms of esterase-mediated pyrethroid resistance were analyzed based on our previous works in a strain of the housefly, Musca domestica. The carboxylesterase gene, MdalphaE7, was cloned and sequenced from susceptible (CSS) and resistant (CRR) strains, and a total of nine amino acid substitutions were found. The mutation, Trp(251)-Ser appeared to play a role in beta-cypermethrin resistance and cross-resistance between organophosphates (OPs) and pyrethroids in the CRR strain. Quantitative real-time PCR showed that MdalphaE7 was over-expressed in the CRR strain, the reciprocal cross progeny F(1) and back-cross progeny BC(2) compared with the CSS strain, respectively. Two alpha-cynaoester substrates as surrogates for beta-cypermethrin and deltamethrin, were synthesized to determine the pyrethroid hydrolase activity. Results showed that carboxylesterases from the CRR strain hydrolyzed cypermethrin/deltamethrin-like substrate 9.05- and 13.53-fold more efficiently than those from the CSS strain, respectively. Our studies suggested that quantitative and qualitative changes in the carboxylesterase might contribute together to pyrethroid resistance in the CRR strain.

  15. The house fly (Musca domestica) as a potential vector of metazoan parasites caught in a pig-pen in Germany. (United States)

    Förster, Maike; Klimpel, Sven; Sievert, Kai


    In the present study a total of 224 specimens of the synanthropic house fly (Musca domestica) were caught in a pig-pen of an organic farmer in Dormagen (Germany). The flies were examined for their potential as a carrier of metazoan parasites. On the exoskeletons and in the intestines of the flies the eggs and/or larvae of four endoparasite nematode species of domestic pigs (Ascaris suum, Strongyloides ransomi, Metastrongylus sp., undetermined Strongylida) were isolated. Also one ectoparasite species, the hog louse (Haematopinus suis), was detected on the exoskeleton of one fly. The analysis of the pig faeces as potential source revealed many eggs and larvae of nematodes. A high number of A. suum eggs (62.0% of all found nematode eggs), many eggs of strongylid nematodes (21.0%), some eggs of S. ransomi and few eggs of Trichuris suis were detected. However Metastrongylus sp. could not be identified in the faeces. Further laboratory experiments verified the potential of the house fly as a transmitter of the pig parasites A. suum and T. suis. In the intestines of 59 flies (49.2%) from 120 experimentally used house flies, nematode eggs of both nematode species were detected. The present study clearly demonstrates the potential of the house fly as a vector of metazoan pig parasites.

  16. Mutation by DNA shuffling of 5-enolpyruvylshikimate-3-phosphate synthase from Malus domestica for improved glyphosate resistance. (United States)

    Tian, Yong-Sheng; Xu, Jing; Peng, Ri-He; Xiong, Ai-Sheng; Xu, Hu; Zhao, Wei; Fu, Xiao-Yan; Han, Hong-Juan; Yao, Quan-Hong


    A new 5-enolpyruvylshikimate-3-phosphate synthase (EPSPS) gene from Malus domestica (MdEPSPS) was cloned and characterized by rapid amplification of cDNA ends to identify an EPSPS gene appropriate for the development of transgenic glyphosate-tolerant plants. However, wild-type MdEPSPS is not suitable for the development of transgenic glyphosate-tolerant plants because of its poor glyphosate resistance. Thus, we performed DNA shuffling on MdEPSPS, and one highly glyphosate-resistant mutant with mutations in eight amino acids (N63D, N86S, T101A, A187T, D230G, H317R, Y399R and C413A.) was identified after five rounds of DNA shuffling and screening. Among the eight amino acid substitutions on this mutant, only two residue changes (T101A and A187T) were identified by site-directed mutagenesis as essential and additive in altering glyphosate resistance, which was further confirmed by kinetic analyses. The single-site A187T mutation has also never been previously reported as an important residue for glyphosate resistance. Furthermore, transgenic rice was used to confirm the potential of MdEPSPS mutant in developing glyphosate-resistant crops.

  17. Development and validation of high-performance thin layer chromatographic method for ursolic acid in Malus domestica peel

    Directory of Open Access Journals (Sweden)

    P H Nikam


    Full Text Available Ursolic acid, a pentacyclic triterpenoid possess a wide range of pharmacological activities. It shows hypoglycemic, antiandrogenic, antibacterial, antiinflammatory, antioxidant, diuretic and cynogenic activity. It is commonly present in plants especially coating of leaves and fruits, such as apple fruit, vinca leaves, rosemary leaves, and eucalyptus leaves. A simple high-performance thin layer chromatographic method has been developed for the quantification of ursolic acid from apple peel (Malus domestica. The samples dissolved in methanol and linear ascending development was carried out in twin trough glass chamber. The mobile phase was selected as toluene:ethyl acetate:glacial acetic acid (70:30:2. The linear regression analysis data for the calibration plots showed good linear relationship with r 2 =0.9982 in the concentration range 0.2-7 ΅g/spot with respect to peak area. According to the ICH guidelines the method was validated for linearity, accuracy, precision, and robustness. Statistical analysis of the data showed that the method is reproducible and selective for the estimation of ursolic acid.

  18. Development and Validation of High-performance Thin Layer Chromatographic Method for Ursolic Acid in Malus domestica Peel. (United States)

    Nikam, P H; Kareparamban, J A; Jadhav, A P; Kadam, V J


    Ursolic acid, a pentacyclic triterpenoid possess a wide range of pharmacological activities. It shows hypoglycemic, antiandrogenic, antibacterial, antiinflammatory, antioxidant, diuretic and cynogenic activity. It is commonly present in plants especially coating of leaves and fruits, such as apple fruit, vinca leaves, rosemary leaves, and eucalyptus leaves. A simple high-performance thin layer chromatographic method has been developed for the quantification of ursolic acid from apple peel (Malus domestica). The samples dissolved in methanol and linear ascending development was carried out in twin trough glass chamber. The mobile phase was selected as toluene:ethyl acetate:glacial acetic acid (70:30:2). The linear regression analysis data for the calibration plots showed good linear relationship with r(2)=0.9982 in the concentration range 0.2-7 μg/spot with respect to peak area. According to the ICH guidelines the method was validated for linearity, accuracy, precision, and robustness. Statistical analysis of the data showed that the method is reproducible and selective for the estimation of ursolic acid.

  19. Assessment of resistance risk to fipronil and cross resistance to other insecticides in the Musca domestica L. (Diptera: Muscidae). (United States)

    Abbas, Naeem; Ijaz, Mamuna; Shad, Sarfraz Ali; Binyameen, Muhammad


    Fipronil, a phenyl-pyrazole insecticide has been used frequently for the control of disease vector house flies, Musca domestica L., (Diptera: Muscidae) worldwide including Pakistan. This experiment was performed to determine the selection and assessment of fipronil resistance evolution along with cross resistance to other three insecticides. After 26 generations of selection, the house fly strain developed 430-fold resistance to fipronil compared to a susceptible strain. Realized heritability (h(2)) of resistance to fipronil was 0.05. The projected rate of resistance development revealed that if 30-90% house flies were selected then a tenfold increase in lethal concentration 50 happened after 95.51-26.59 generations for fipronil (h(2)=0.05, Slope=2.34). At similar slope, if h(2)=0.15, then 31.84-8.86 generations are required for tenfold increase in LC50 at 30-90% selection intensity, respectively. Likewise, if h(2)=0.25, then similar would occur in 19.10-5.32 generations. Differences in any of the variable would affect the rate of resistance development. Selection with fipronil did not increase the level of resistance to lambda-cyhalothrin, profenofos and indoxacarb, suggesting no cross resistance to these insecticides. The results of our study concluded that house flies have the potential to develop resistances following continued selection pressure with fipronil.

  20. Involvement of plasma membrane peroxidases and oxylipin pathway in the recovery from phytoplasma disease in apple (Malus domestica). (United States)

    Patui, Sonia; Bertolini, Alberto; Clincon, Luisa; Ermacora, Paolo; Braidot, Enrico; Vianello, Angelo; Zancani, Marco


    Apple trees (Malus domestica Borkh.) may be affected by apple proliferation (AP), caused by 'Candidatus Phytoplasma mali'. Some plants can spontaneously recover from the disease, which implies the disappearance of symptoms through a phenomenon known as recovery. In this article it is shown that NAD(P)H peroxidases of leaf plasma membrane-enriched fractions exhibited a higher activity in samples from both AP-diseased and recovered plants. In addition, an increase in endogenous SA was characteristic of the symptomatic plants, since its content increased in samples obtained from diseased apple trees. In agreement, phenylalanine ammonia lyase (PAL) activity, a key enzyme of the phenylpropanoid pathway, was increased too. Jasmonic acid (JA) increased only during recovery, in a phase subsequent to the pathological state, and in concomitance to a decline of salicylic acid (SA). Oxylipin pathway, responsible for JA synthesis, was not induced during the development of AP-disease, but it appeared to be stimulated when the recovery occurred. Accordingly, lipoxygenase (LOX) activity, detected in plasma membrane-enriched fractions, showed an increase in apple leaves obtained from recovered plants. This enhancement was paralleled by an increase of hydroperoxide lyase (HPL) activity, detected in leaf microsomes, albeit the latter enzyme was activated in either the disease or recovery conditions. Hence, a reciprocal antagonism between SA- and JA-pathways could be suggested as an effective mechanism by which apple plants react to phytoplasma invasions, thereby providing a suitable defense response leading to the establishment of the recovery phenomenon. Copyright © Physiologia Plantarum 2012.

  1. Plum (Prunus domestica) trees transformed with poplar FT1 result in altered architecture, dormancy requirement, and continuous flowering. (United States)

    Srinivasan, Chinnathambi; Dardick, Chris; Callahan, Ann; Scorza, Ralph


    The Flowering Locus T1 (FT1) gene from Populus trichocarpa under the control of the 35S promoter was transformed into European plum (Prunus domestica L). Transgenic plants expressing higher levels of FT flowered and produced fruits in the greenhouse within 1 to 10 months. FT plums did not enter dormancy after cold or short day treatments yet field planted FT plums remained winter hardy down to at least -10°C. The plants also displayed pleiotropic phenotypes atypical for plum including shrub-type growth habit and panicle flower architecture. The flowering and fruiting phenotype was found to be continuous in the greenhouse but limited to spring and fall in the field. The pattern of flowering in the field correlated with lower daily temperatures. This apparent temperature effect was subsequently confirmed in growth chamber studies. The pleitropic phenotypes associated with FT1 expression in plum suggests a fundamental role of this gene in plant growth and development. This study demonstrates the potential for a single transgene event to markedly affect the vegetative and reproductive growth and development of an economically important temperate woody perennial crop. We suggest that FT1 may be a useful tool to modify temperate plants to changing climates and/or to adapt these crops to new growing areas.

  2. Chemometric evaluation of trace metals in Prunus persica L. Batech and Malus domestica from Minićevo (Serbia). (United States)

    Alagić, Slađana Č; Tošić, Snežana B; Dimitrijević, Mile D; Petrović, Jelena V; Medić, Dragana V


    The samples of spatial soils and different organs of Prunus persica L. Batech and Malus domestica were analyzed by methods such as inductively coupled plasma optical emission spectroscopy (ICP-OES), Hierarchical Cluster Analysis (HCA), One-way ANOVA, and calculation of biological accumulation factors (BAFs) with the aim of investigating whether these methods may help in the evaluation of trace metals in plants, as well as in the estimation of plant bioaccumulation potentials. ICP-OES provided accurate data on present concentrations of Cu, Zn, Pb, As, Cd, and Ni which showed that most concentrations were in normal ranges, except in some cases for Cu, Zn, and As. HCA illustrated nicely various specifics in the distribution of metals in both investigated systems plant-soil. One-way ANOVA pointed successfully on the existing statistical differences between metal concentrations. Calculated BAFs showed that both plants had very low accumulation rates for all elements; they acted as metal excluders. Copyright © 2016 Elsevier Ltd. All rights reserved.

  3. Preliminary studies on the reaction of growing geese (Anser anser f. domestica) to the proximity of wind turbines. (United States)

    Mikolajczak, J; Borowski, S; Marć-Pieńkowska, J; Odrowaz-Sypniewska, G; Bernacki, Z; Siódmiak, J; Szterk, P


    Wind farms produce electricity without causing air pollution and environmental degradation. Unfortunately, wind turbines are a source of infrasound, which may cause a number of physiological effects, such as an increase in cortisol and catecholamine secretion. The impact of infrasound noise, emitted by wind turbines, on the health of geese and other farm animals has not previously been evaluated. Therefore, the aim of this study was to determine the effect of noise, generated by wind turbines, on the stress parameters (cortisol) and the weight gain of geese kept in surrounding areas. The study consisted of 40 individuals of 5-week-old domestic geese Anser anser f domestica, divided into 2 equal groups. The first experimental gaggle (I) remained within 50 m from turbine and the second one (II) within 500 m. During the 12 weeks of the study, noise measurements were also taken. Weight gain and the concentration of cortisol in blood were assessed and significant differences in both cases were found. Geese from gaggle I gained less weight and had a higher concentration of cortisol in blood, compared to individuals from gaggle II. Lower activity and some disturbing changes in behavior of animals from group I were noted. Results of the study suggest a negative effect of the immediate vicinity of a wind turbine on the stress parameters of geese and their productivity.

  4. Comparison of genetic diversity structure analyses of SSR molecular marker data within apple (Malus×domestica) genetic resources. (United States)

    Patzak, Josef; Paprštein, František; Henychová, Alena; Sedlák, Jiří


    The aim of this study was to compare traditional hierarchical clustering techniques and principal coordinate analysis (PCoA) with the model-based Bayesian cluster analyses in relation to subpopulation differentiation based on breeding history and geographical origin of apple (Malus×domestica Borkh.) cultivars and landraces. We presented the use of a set of 10 microsatellite (SSR) loci for genetic diversity structure analyses of 273 apple accessions from national genetic resources. These SSR loci yielded a total of 113 polymorphic SSR alleles, with 5-18 alleles per locus. SSR molecular data were successfully used in binary and allelic input format for all genetic diversity analyses, but allelic molecular data did not reveal reliable results with the NTSYS-pc and BAPS softwares. A traditional cluster analysis still provided an easy and effective way for determining genetic diversity structure in the apple germplasm collection. A model-based Bayesian analysis also provided the clustering results in accordance to traditional cluster analysis, but the analyses were distorted by the presence of a dominant group of apple genetic resources owing to the narrow origin of the apple genome. PCoA confirmed that there were no noticeable differences in genetic diversity structure of apple genetic resources during the breeding history. The results of our analyses are useful in the context of enhancing apple collection management, sampling of core collections, and improving breeding processes.

  5. Nutrients and antioxidant molecules in yellow plums (Prunus domestica L.) from conventional and organic productions: a comparative study. (United States)

    Lombardi-Boccia, Ginevra; Lucarini, Massimo; Lanzi, Sabina; Aguzzi, Altero; Cappelloni, Marsilio


    Yellow plums (Prunus domestica L) conventionally and organically grown in the same farm were selected to study the influence of different agronomic practices on antioxidant vitamins (ascorbic acid, vitamin E, beta-carotene) and phenolics (total polyphenols, phenolic acids, flavonols) concentration. Conventional plums were grown on tilled soil. Three organic cultivations were performed: tilled soil, soil covered with trifolium, and soil covered with natural meadow. Differences in macronutrients were marginal, whereas antioxidant vitamins and phenolic compounds concentration markedly differed among cultivations. Ascorbic acid, alpha-, gamma-tocopherols, and beta-carotene were higher in organic plums grown on soil covered with natural meadow. The highest phenolic acids content was detected in plums grown on soil covered with trifolium. Total polyphenols content was higher in conventional plums. Quercetin was higher in conventional plums, but myrecitin and kaempferol were higher in organic plums. Under the same cultivar and climate conditions, the type of soil management turned out of primary importance in influencing the concentration of health-promoting compounds.

  6. Investigations of aroma volatile biosynthesis under anoxic conditions and in different tissues of "Redchief Delicious" apple fruit (Malus domestica Borkh.). (United States)

    Rudell, D R; Mattinson, D S; Mattheis, J P; Wyllie, S G; Fellman, J K


    Disks from different tissues were obtained from "Redchief Delicious" apple fruit (Malus domestica Borkh.) and analyzed for the ability to metabolize 1-pentanol as well as synthesize constitutive esters and alcohols under anoxic and aerobic conditions. The skin tissue displayed a greater capacity to synthesize pentanal, pentyl acetate, pentyl propionate, pentyl butyrate, and pentyl hexanoate than the hypanthial and carpellary tissues during incubation with 1-pentanol. With the exception of pentyl acetate and pentyl propionate biosynthesis, the hypanthial tissue synthesized these compounds at a higher rate than the carpellary tissue. Anoxia inhibited both constituent and 1-pentanol-derived ester biosynthesis. While anoxia inhibited ester biosynthesis, ethanol biosynthesis increased at a greater rate in tissue disks held under these conditions. Biosynthesis of 1-butanol, 2-methyl-1-butanol, and 1-hexanol was greater in tissue disks held in air during the first part of the measurement period and dropped off more rapidly than those transpiring in tissue disks held under anoxic conditions. The biosynthetic rates of all esters, both constituent and 1-pentanol-derived, increased as a result of air exposure. While hypoxic or anoxic conditions may promote ethanol synthesis, these conditions also appear to inhibit the formation of the ethanol-derived esters partially responsible for the off-flavor in apples attributed to ultralow O(2) controlled atmosphere storage.

  7. Comparative evaluation of five Beauveria isolates for housefly (Musca domestica L.) control and growth optimization of selected strain. (United States)

    Mishra, Sapna; Malik, Anushree


    Pathogenic potential of five native Beauveria isolates was assessed against housefly adult and larvae in laboratory bioassays. Beauveria isolate Beauveria bassiana HQ917687 showed highest virulence with 72.3 and 100 % mortality of larvae and adults of Musca domestica, respectively. Other Beauveria isolates caused 36-52 % housefly larval mortality while the adult mortalities varied between 72 and 82 %. B. bassiana HQ917687 also showed the fastest killing activity with LT(50) of 4 days (for larvae) and 3 days (for adults). This isolate showing highest virulence was selected for its growth optimization in terms of biomass and spore production using response surface methodology. The optimum value of temperature, yeast extract, and pH for maximum biomass and spore production was predicted as 27 °C, 5.00 g/l, and 6.75, respectively. Temperature was found to be the most critical factor influencing biomass and spore yield of the fungus and even nullified the effects of other factors at sufficiently higher value. The results obtained in this study depict the significance of appropriate strain selection and process parameter optimization in order to facilitate mass production of biocontrol agents.

  8. Expression pattern and function of alternative splice variants of glutamate-gated chloride channel in the housefly Musca domestica. (United States)

    Kita, Tomo; Ozoe, Fumiyo; Ozoe, Yoshihisa


    Glutamate-gated chloride channels (GluCls) mediate fast inhibitory neurotransmission in invertebrate nervous systems. cDNAs encoding two alternative splice variants (MdGluClB and C) of the GluCl subunit were cloned from the housefly Musca domestica. The expression patterns of three variants, including the previously reported MdGluClA, differed among the body parts (head, thorax, abdomen, and leg) of the adult housefly and among developmental stages (embryo, larva, pupa, and adult). The MdGluClA and B transcripts were abundant in the central nervous system of the adult, whereas the MdGluClC transcript was expressed in the central nervous system and as the predominant variant in the peripheral tissues. The sensitivities to the agonist glutamate and the allosteric activator ivermectin B1a did not differ between channels containing MdGluCl variants when they were singly or co-expressed in Xenopus oocytes. By contrast, MdGluClA and B channels were more sensitive to the channel blockers fipronil and picrotoxinin than was MdGluClC channels. Heteromeric channels containing different subunit variants were more sensitive to picrotoxinin than were homomeric channels. Heteromeric channels were more sensitive to fipronil than were homomeric MdGluClC channels but not than homomeric MdGluClA and B channels. These results suggest that functionally indistinguishable but pharmacologically distinct GluCls are expressed in a spatially and temporally distinct manner in the housefly.

  9. Comparative analysis of bacterial community and antibiotic-resistant strains in different developmental stages of the housefly (Musca domestica). (United States)

    Wei, Ting; Hu, Jun; Miyanaga, Kazuhiko; Tanji, Yasunori


    The housefly (Musca domestica) is an important host for a variety of bacteria, including some pathogenic and antibiotic-resistant strains. To further investigate the relationship between the housefly and the bacteria it harbors, it is necessary to understand the fate of microorganisms during the larval metamorphosis. The major bacterial communities in three developmental stages of the housefly (maggot, pupa, and adult fly) were investigated by a culture-independent method, polymerase chain reaction-denaturing gradient gel electrophoresis (PCR-DGGE) analysis of 16S rRNA genes. The bacteria that were identified using DGGE analysis spanned phyla Proteobacteria, Firmicutes, and Bacteroidetes. Changes in the predominant genera were observed during the housefly development. Bacteroides, Koukoulia, and Schineria were detected in maggots, Neisseria in pupae, and Macrococcus, Lactococcus, and Kurthia in adult flies. Antibiotic-resistant bacteria were screened using a selective medium and tested for antibiotic susceptibility. Most resistant isolates from maggots and pupae were classified as Proteus spp., while those from adult flies were much more diverse and spanned 12 genera. Among 20 tested strains across the three stages, 18 were resistant to at least two antibiotics. Overall, we demonstrated that there are changes in the major bacterial communities and antibiotic-resistant strains as the housefly develops.

  10. Size relationships of different body parts in the three dipteran species Drosophila melanogaster, Ceratitis capitata and Musca domestica. (United States)

    Siomava, Natalia; Wimmer, Ernst A; Posnien, Nico


    Body size is an integral feature of an organism that influences many aspects of life such as fecundity, life span and mating success. Size of individual organs and the entire body size represent quantitative traits with a large reaction norm, which are influenced by various environmental factors. In the model system Drosophila melanogaster, pupal size and adult traits, such as tibia and thorax length or wing size, accurately estimate the overall body size. However, it is unclear whether these traits can be used in other flies. Therefore, we studied changes in size of pupae and adult organs in response to different rearing temperatures and densities for D. melanogaster, Ceratitis capitata and Musca domestica. We confirm a clear sexual size dimorphism (SSD) for Drosophila and show that the SSD is less uniform in the other species. Moreover, the size response to changing growth conditions is sex dependent. Comparison of static and evolutionary allometries of the studied traits revealed that response to the same environmental variable is genotype specific but has similarities between species of the same order. We conclude that the value of adult traits as estimators of the absolute body size may differ among species and the use of a single trait may result in wrong assumptions. Therefore, we suggest using a body size coefficient computed from several individual measurements. Our data is of special importance for monitoring activities of natural populations of the three dipteran flies, since they are harmful species causing economical damage (Drosophila, Ceratitis) or transferring diseases (Musca).

  11. Bacteria on housefly eggs, Musca domestica, suppress fungal growth in chicken manure through nutrient depletion or antifungal metabolites (United States)

    Lam, Kevin; Thu, Kelsie; Tsang, Michelle; Moore, Margo; Gries, Gerhard


    Female houseflies, Musca domestica (Diptera: Muscidae), lay their eggs in ephemeral resources such as animal manure. Hatching larvae compete for essential nutrients with fungi that also colonize such resources. Both the well-known antagonistic relationship between bacteria and fungi and the consistent presence of the bacterium Klebsiella oxytoca on housefly eggs led us to hypothesize (1) that K. oxytoca, and possibly other bacteria on housefly eggs, help curtail the growth of fungal resource competitors and (2) that such fungi indeed adversely affect the development of housefly larvae. Bacteria washed from housefly eggs significantly reduced the growth of fungi in chicken manure. Nineteen bacterial strains and ten fungal strains were isolated from housefly eggs or chicken manure, respectively. Co-culturing each of all the possible bacterium-fungus pairs revealed that the bacteria as a group, but no single bacterium, significantly suppressed the growth of all fungal strains tested. The bacteria's adverse effect on fungi is due to resource nutrient depletion and/or the release of antifungal chemicals. Well-established fungi in resources significantly reduced the number of larval offspring that completed development to adult flies.

  12. A WD40-repeat gene from Malus x domestica is a functional homologue of Arabidopsis thaliana TRANSPARENT TESTA GLABRA1. (United States)

    Brueggemann, Julian; Weisshaar, Bernd; Sagasser, Martin


    The WD40 repeat protein TRANSPARENT TESTA GLABRA1 (TTG1) is involved in a multitude of developmental and biochemical reactions in Arabidopsis thaliana such as the production of seed coat colour and mucilage, pigmentation by anthocyanins as well as the formation of trichomes and root hairs. In this study, a putative TTG1 homologue was isolated from apple (Malus x domestica Borkh.) showing 80.2% identity to A. thaliana TTG1 on nucleotide and 90.7% similarity on amino acid level. The MdTTG1 candidate was able to activate the AtBAN promoter in cooperation with the A. thaliana transcription factors TT2 and TT8 in A. thaliana protoplasts. This indicates that the encoded protein can be integrated into the complex that activates BAN in A. thaliana, and that a similar complex might also be present in apple. When transformed into ttg1 mutants of A. thaliana, the apple sequence was able to restore trichome growth, anthocyanin production in young seedlings as well as proanthocyanidin production in seeds. Additionally, roots of complemented mutant plants showed root hair formation resembling wild type. These results show that the studied apple WD40 gene is a functional homologue of AtTTG1 and we refer to this gene as MdTTG1.

  13. The effect of Beauveria bassiana infection on cell mediated and humoral immune response in house fly, Musca domestica L. (United States)

    Mishra, Sapna; Kumar, Peeyush; Malik, Anushree


    Entomopathogenic fungi that manifest infections by overcoming insect's immune response could be a successful control agent for the house fly, Musca domestica L. which is a major domestic, medical, and veterinary pest. In this study, the immune response of house fly to Beauveria bassiana infection was investigated to reveal fundamental aspects of house fly hemocyte biology, such as hemocyte numbers and size, which is poorly understood. The total hemocyte counts (THCs) in B. bassiana-infected house fly showed an initial increase (from 6 to 9 h), followed by subsequent decrease (9 to 12 h) with increase in time of infection. The THCs was slightly greater in infected flies than the non-infected ones. Insight into relative hemocyte counts depicted a significant increase in prohemocyte (PR) and decrease in granulocyte (GR) in infected house flies compared to non-infected ones. The relative cell area of hemocyte cells showed a noticeable increase in PR and intermediate cells (ICs), while a considerable reduction was observed for plasmatocyte (PL) and GR. The considerable variation in relative cell number and cell area in the B. bassiana-infected house flies indicated stress development during infection. The present study highlights changes occurring during B. bassiana invasion to house fly leading to establishment of infection along with facilitation in understanding of basic hemocyte biology. The results of the study is expected to help in better understanding of house fly immune response during fungal infection, so as to assist production of more efficient mycoinsecticides for house fly control using B. bassiana.

  14. 宝鸡市家蝇对常用杀虫剂抗性状况及防治对策%Resistance of Musca domestica to insecticides and countermeasure for its control in Baoji city

    Institute of Scientific and Technical Information of China (English)

    张铮; 吕文; 李旭龙; 张宝芳; 王军浩


    Objective To find out the situation of Musca domestica' s resistance to insecticides in Baoji city, and provide scientific use of insecticides in Baoji. Methods Dropping method was adopted to determine median lethal dose of Musca domestica. Results LD50 of the eight insecticides of Musca domestica in Baoji city was 0.016 - 22.092 μg per piece. The resistance ratios of Musca domestica to DDVP, deltamethrin, propoxur, cypermethrin were 38. 21,36. 51,103. 41 and 7. 82 respectively. Conclusion In Baoji city,Musca domestica have had resistance to DDVP,deltamethrin, propoxur, cypermethrin in different degrees, so it is necessary to reinforce scientific and effective drug regimen to prevent and delay the rising of Musca domestica's resistance to insecticides.%目的 了解宝鸡市家蝇抗药性情况,以便科学合理地使用杀虫剂.方法 采用点滴法,测定家蝇半数致死量.结果 宝鸡市家蝇对8种杀虫剂的LD50为0.016 ~ 22.092μg/只.敌敌畏、溴氰菊酯、残杀威、高效氯氰菊酯的抗药倍数分别为38.21、36.51、103.41、7.82.结论 宝鸡市家蝇对敌敌畏、溴氰菊酯、残杀威、高效氯氰菊酯均已产生了不同程度的抗药性,今后应加强科学合理用药,预防和延缓家蝇抗药性的增长.

  15. Enterobactérias associadas a adultos de Musca domestica (Linnaeus, 1758 (Diptera: Muscidae e Chrysomya megacephala (Fabricius, 1754 (Diptera: Calliphoridae no Jardim Zoológico, Rio de Janeiro Enterobacteria associated to adults of Musca domestica (Linnaeus, 1758 (Diptera: Muscidae and Chrysomya megacephala (Fabricius, 1754 (Diptera: Calliphoridae at the Zoo of Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    V.C. Oliveira


    Full Text Available Enterobactérias foram identificadas em adultos de Musca domestica (Linnaeus, 1758 (Diptera: Muscidae e Chrysomya megacephala (Fabricius, 1754 (Diptera: Calliphoridae. Ambas as espécies foram capturadas no Jardim Zoológico da cidade do Rio de Janeiro e tiveram a superfície externa do corpo lavada e o sistema digestivo dissecado, para análise bacteriológica. Identificaram-se Escherichia coli, Citrobacter sp., Proteus mirabilis, Morganella sp., Klebsiella sp., Pseudomonas sp., Enterobacter sp. e Salmonella Agona. P. mirabilis foi o isolado bacteriano mais freqüente. Em duas amostragens (8% de C. megacephala, isolou-se Salmonella Agona. As amostras de E. coli não foram enteropatogênicas. M. domestica e C. megacephala são potenciais veiculadoras de bactérias causadoras de enterites em humanos e animais.Enterobacteria were identified in adults of Musca domestica (Linnaeus, 1758 (Diptera: Muscidae and Chrysomya megacephala (Fabricius, 1754 (Diptera: Calliphoridae. Both species were captured in the Zoo of Rio de Janeiro. They had their external body surface washed and their digestive system dissected for bacteriological analysis. Escherichia coli, Citrobacter sp., Proteus mirabilis, Morganella sp., Klebsiella sp., Pseudomonas sp., Enterobacter sp. and Salmonella serovar Agona were isolated in the samples. P. mirabilis was the species most frequent isolated. Strains of Salmonella Agona were isolated from two samples (8% of C. megacephala. Enteropathogenic E. coli was not isolated. M. domestica and C. megacephala showed themselves as potential vectors of agents related to enteric diseases in humans and other animals.

  16. Desenvolvimento de Supputius cincticeps (Heteroptera, Pentatomidae alimentado com larvas de Zophobas confusa, Tenebrio molitor (Coleoptera, Tenebrionidae e Musca domestica (Diptera, Muscidae Development of Supputius cincticeps (Heteroptera, Pentatomidae fed with Zophobas confusa, Tenebrio molitor (Coleoptera, Tenebrionidae and Musca domestica (Diptera, Muscidae larvae

    Directory of Open Access Journals (Sweden)

    Eduardo B. Beserra


    Full Text Available Egg viability and nymphal development of the predatory bug Supputius cincticeps (Stål, 1860 were evaluated during two generations in the Biological Control Laboratory of the Núcleo de Biotecnologia Aplicada à Agropecuária (Bioagro/UFV in Viçosa (Minas Gerais, Brazil at 24.72±1.10ºC and photophase of 12 hours. Three treatments were represented by S. cincticeps fed with Zophobas confusa Gebien, 1906, Tenebrio molitor Linnaeus, 1758 and Musca domestica Linnaeus, 1758 larvae. Higher egg viability of this predator was found when the preys were Z. confusa and T. molitor, 74.46% and 80.91 %, than in M. domestica, 57.02%, but incubation period showed no differences between preys. Shorter nymphal development and higher nymphal viability were found with Z. confusa and T. molitor than with M. domestica. Higher weight increase was found for nymphs which originated males and females in the second generation specialy with the first two preys.

  17. 南阳市家蝇抗性现状及防治措施%Present resistance situation of Musca domestica and its controlling strategies in Nanyang city

    Institute of Scientific and Technical Information of China (English)

    李峰; 崔士磊; 王庭柱; 丁新阳


    Objective To investigate the present resistance situation of Musca domestica to four kinds of insecticides in Nanyang and provide scientific evidence for its development. Methods Topical method was used . Results In Nanyang city,LD50 of DDVP, deltamethrin , beta - cypermethrin ,propoxur were 0. 567 0,0. 105 2,0. 288 0, > 132.44 jig per fly. Conclusion Musca domestica has high resistance to the four kinds of insecticides, but the resistance to DDVP has increased rather slowly. It is indicated that the integrated management and rational employment of insecticides can restrain and delay the resisitance development of Musca domestica.%目的 掌握南阳市家蝇抗性现状,为抗性的发生发展提供科学依据.方法 采用微量点滴法.结果 家蝇对敌敌畏、溴氰菊酯、高效氯氰菊酯、残杀威的LD50依次为0.567 0、0.105 2、0.288 0,>132.44μg/蝇.结论 南阳市家蝇对4种杀虫剂产生了较高的抗性,对敌敌畏的抗性发展相对缓慢,应实施综合治理、合理用药,抑制和延缓抗药性的发展.

  18. Isolation of fungi in Musca domestica Linnaeus, 1758 (Diptera: Muscidae captured at two natural breeding grounds in the municipality of Seropédica, Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Sales Márcia de Senna Nunes


    Full Text Available The objective of this study was to isolate and identify fungal species found in natural association with adults of Musca domestica. The adult insects were collected from two natural breeding grounds: hog pens and an urban sanitary landfill. The isolated fungi were identified as: Aspergillus flavus (23.8%, A. niger var. niger (14.4%, Penicillium corylophilum (21.4%, P. fellutanum (11.9%, Cladosporium cladosporoides (4.7%, Fusarium sp. (4.7%, Alternaria alternata (11.9%, Curvularia brachyspora (2.4%, Mycelia sterilia (2.4% and the Mucorales order (2.4%.

  19. Transcriptome analysis of an apple (Malus × domestica) yellow fruit somatic mutation identifies a gene network module highly associated with anthocyanin and epigenetic regulation


    El-sharkawy, Islam; Liang, Dong; Xu, Kenong


    Using RNA-seq, this study analysed an apple (Malus×domestica) anthocyanin-deficient yellow-skin somatic mutant ‘Blondee’ (BLO) and its red-skin parent ‘Kidd’s D-8’ (KID), the original name of ‘Gala’, to understand the molecular mechanisms underlying the mutation. A total of 3299 differentially expressed genes (DEGs) were identified between BLO and KID at four developmental stages and/or between two adjacent stages within BLO and/or KID. A weighted gene co-expression network analysis (WGCNA) o...

  20. Insecticidal resistance of Musca domestica in urban areas of Liaoning%辽宁省4市城区家蝇抗药性调查

    Institute of Scientific and Technical Information of China (English)

    李志; 白玉银; 李鑫; 邢丽; 贾吉中; 王陆玲; 刘晓鹏; 王忠利


    目的 了解辽宁省不同市区家蝇抗药性状况,为科学地使用杀虫剂提供依据.方法 采用点滴法.用微量点滴器,将丙酮配制的试验药剂,点滴于家蝇中胸背板进行测试.结果 辽宁省抚顺、本溪、辽阳、鞍山市的家蝇对4种常用杀虫剂均产生了不同程度的抗药性,以溴氰菊酯的抗性最为突出,4市家蝇对该杀虫剂的平均抗性系数为61.60倍,对残杀威的抗药性次之,平均抗性系数为22.65倍,对高效氯氰菊酯和敌敌畏的平均抗性系数分别为8.71和4.72倍.结论 应采取科学的方法使用杀虫剂,有效控制家蝇的抗药性增长.%Objective To determine the insecticidal resistance of Musca domestica in urban areas of Liaoning in order to provide the basis for scientific administration of insecticides in fly control.Methods Topical application of insecticides solved in acetone was made to the mesonotum of M.domestica.Results Different degrees of resistance of M.domestica to four commonly used insecticides were observed in Fushun, Benxi, Liaoyang, Anshan city of Liaoning.The resistance to deltamethrin was the highest, with the average resistance coefficient of 61.60, followed by the resistance to propoxur with an average resistance coefficient of 22.65.The average resistance coefficients to alpha-cypermethrin and dichlorvos were 8.71 and 4.72, respectively.Conclusion Insecticides should be applied scientifically to effectively curb the increase in insecticidal resistance ofM.domestica.

  1. Prevalence of parasites and associated risk factors in domestic pigeons (Columba livia domestica) and free-range backyard chickens of Sistan region, east of Iran


    RADFAR, Mohammad Hossein; Javad KHEDRI; Adinehbeigi, Keivan; NABAVI, Reza; Rahmani, Khatereh


    This study was carried out on free-range backyard chickens and domestic pigeons (Columba livia domestica) from December 2010 to November 2011 to determine the prevalence, intensity and species of internal and external parasites in Sistan region, east of Iran. Of the total of 59 (27 males and 32 females) free-range backyard chickens and 46 (26 males and 20 females) domestic pigeons inspected, 55 (93.22 %) and 39 (84.78 %) were infected respectively. Ten species of free-range backyard chickens ...

  2. Produção de patulina em maçã (Malus domestica Borkhausen, cultivares Gala e Fuji inoculadas com Penicillium spp. Production of patulin in apples (Malus domestica Borkhausen Gala and Fuji cultivars inoculated with Penicillium spp.

    Directory of Open Access Journals (Sweden)

    G.U. ROSS


    Full Text Available A maçã (Malus domestica Borkhausen é uma excelente fonte nutricional e de interesse econômico, sendo que a Região Sul do Brasil contribue com 90% da produção Nacional deste fruto com destaque aos cultivares Gala e Fuji. O objetivo deste estudo foi avaliar a produção de patulina nestes cultivares inoculados com Penicillium expansum NRRL 1172 e Penicillium variabile toxigênico, isolado de maçãs regionais. As frutas contaminadas foram mantidas em condições de tempo de armazenamento e temperatura que variaram respectivamente de 15 a 90 dias e de 0 a 25°C. A produção de patulina ocorreu em todas as combinações de armazenagem e temperaturas empregadas para o ensaio, independentemente dos cultivares. A produção de patulina foi negativa no 30º dia nas maçãs estocadas a 0°C inoculadas com P.expansum, mas o aumento de temperatura para 4°C restringiu a margem de segurança, causando positividade na produção da toxina para ambos os cultivares inoculados com as duas linhagens fúngicas, no mesmo período. Nas maçãs inoculadas com P. variabile ocorreu maior concentração de patulina (F=68,05 do que as contaminadas com P. expansum NRRL 1172 (F=26,0. O risco freqüente de produção de patulina nas temperaturas de refrigeração, indicaram a necessidade de melhor controle nos estágios de colheita e armazenagem de maçãs, a fim de evitar constante ingestão de toxina.The apple (Malus domestica Borkhausen is an excellent nutritional source of economical interest, with emphasis to the Brazilian Southern Region which comprises 90% of national apple production, mainly Gala and Fuji cultivars.The aim of this research was to evaluate patulin production in both cultivars, inoculated with Penicillium expansum NRRL 1172 and a toxigenic P. variabile strain isolated from commercialized apples. Samples for analysis were taken from apples stored under combined conditions of time and temperature, which ranged from 15 to 90 days period and 0 to

  3. Extract from Nandina domestica inhibits lipopolysaccharide-induced cyclooxygenase-2 expression in human pulmonary epithelial A549 cells. (United States)

    Ueki, Takuro; Akaishi, Tatsuhiro; Okumura, Hidenobu; Abe, Kazuho


    Extract from fruits of Nandina domestica THUNBERG (NDE) has been used to improve cough and breathing difficulty in Japan for many years. To explore whether NDE may alleviate respiratory inflammation, we investigated its effect on expression of cyclooxygenase-2 (COX-2) and production of prostaglandin E₂ (PGE₂) in human pulmonary epithelial A549 cells in culture. Treatment with lipopolysaccharide (LPS; 6 µg/mL) resulted in an increase of COX-2 expression and PGE₂ production in A549 cells. Both the LPS-induced COX-2 expression and PGE₂ production were significantly inhibited by NDE (1-10 µg/mL) in a concentration-dependent manner. NDE did not affect COX-1 expression nor COX activity. These results suggest that NDE downregulates LPS-induced COX-2 expression and inhibits PGE₂ production in pulmonary epithelial cells. Furthermore, higenamine and nantenine, two major constituents responsible for tracheal relaxing effect of NDE, did not mimic the inhibitory effect of NDE on LPS-induced COX-2 expression in A549 cells. To identify active constituent(s) of NDE responsible for the anti-inflammatory effect, NDE was introduced in a polyaromatic absorbent resin column and stepwise eluted to yield water fraction, 20% methanol fraction, 40% methanol fraction, 99.8% methanol fraction, and 99.5% acetone fraction. However, none of these five fractions alone inhibited LPS-induced COX-2 expression. On the other hand, exclusion of water fraction from NDE abolished the inhibitory effect of NDE on LPS-induced COX-2 expression. These results suggest that constituent(s) present in water fraction is required but not sufficient for the anti-inflammatory activity of NDE, which may result from interactions among multiple constituents.

  4. Oviposition deterrent and ovicidal activities of seven herbal essential oils against female adults of housefly, Musca domestica L. (United States)

    Sinthusiri, Jirisuda; Soonwera, Mayura


    The oviposition deterrent and ovicidal of seven herbal essential oils derived from Citrus sinensis, Cymbopogon citratus, Eucalyptus glubulus, Illicium verum, Lavandula angustifolia, Mentha piperita, and Zingiber cussumunar were assessed against the gravid female of housefly, Musca domestica L., under laboratory conditions and compared with commercial insecticide (10% w/v cypermethrin). They were assayed at three concentrations (1.0, 5.0, and 10.0%) where plastic cups containing 1 ml of desired oil concentration and cotton pad soaked with 10 ml of milk solution (10% w/v) were used as oviposition substrate. The 0.1 ml of deferent concentrations was dropped on ten housefly eggs, which were used for ovicidal activity. The number of eggs laid and the hatched larvae in each cup was recorded to evaluate the oviposition deterrent and ovicidal activities of the herbal essential oils. High concentration (10%) of herbal essential oils showed high percent effective repellency (ER). The 10% I. verum oil caused complete oviposition deterrence (100% ER, oviposition activity index (OAI) = -1.0), followed by Z. cussumunar, M. piperita, L. angustifolia, C. citratus, C. sinensis, and E. glubulus oils with 97.20, 88.55, 88.14, 87.93, 76.68, and 57.00% ER, respectively. As the concentration of herbal essential oils increased from 1.0, 5.0, and up to 10.0% concentration, the hatching rate decreased. Ten percent I. verum oil gave the maximum inhibiting rate at 97.3% (LC50 value of 6.85%); in addition, the other herbal essential oils showed the minimum inhibiting rate of 3.3-22.7%. On the other hand, cypermethrin 10% w/v showed complete oviposition deterrence (100% ER, OAI = -1.0) and ovicidal activity (100% inhibiting rate). Our data showed that I. verum oil have high potential of oviposition deterrence and ovicide housefly control.

  5. The mitochondrial genome of Malus domestica and the import-driven hypothesis of mitochondrial genome expansion in seed plants. (United States)

    Goremykin, Vadim V; Lockhart, Peter J; Viola, Roberto; Velasco, Riccardo


    Mitochondrial genomes of spermatophytes are the largest of all organellar genomes. Their large size has been attributed to various factors; however, the relative contribution of these factors to mitochondrial DNA (mtDNA) expansion remains undetermined. We estimated their relative contribution in Malus domestica (apple). The mitochondrial genome of apple has a size of 396 947 bp and a one to nine ratio of coding to non-coding DNA, close to the corresponding average values for angiosperms. We determined that 71.5% of the apple mtDNA sequence was highly similar to sequences of its nuclear DNA. Using nuclear gene exons, nuclear transposable elements and chloroplast DNA as markers of promiscuous DNA content in mtDNA, we estimated that approximately 20% of the apple mtDNA consisted of DNA sequences imported from other cell compartments, mostly from the nucleus. Similar marker-based estimates of promiscuous DNA content in the mitochondrial genomes of other species ranged between 21.2 and 25.3% of the total mtDNA length for grape, between 23.1 and 38.6% for rice, and between 47.1 and 78.4% for maize. All these estimates are conservative, because they underestimate the import of non-functional DNA. We propose that the import of promiscuous DNA is a core mechanism for mtDNA size expansion in seed plants. In apple, maize and grape this mechanism contributed far more to genome expansion than did homologous recombination. In rice the estimated contribution of both mechanisms was found to be similar.

  6. The effect of temperature on the toxicity of insecticides against Musca domestica L.: implications for the effective management of diarrhea. (United States)

    Khan, Hafiz Azhar Ali; Akram, Waseem


    Diarrhea is an important cause of childhood mortality in developing countries like Pakistan because of unhygienic conditions, lack of awareness, and unwise use of preventive measures. Mechanical transmission of diarrheal pathogens by house flies, Musca domestica, is believed as the most effective route of diarrhea transmission. Although the use of insecticides as a preventive measure is common worldwide for the management of house flies, success of the measure could be compromised by the prevailing environmental temperature since it significantly affects toxicity of insecticides and thus their efficacy. Peaks of the house fly density and diarrheal cases are usually coincided and season specific, yet little is known about the season specific use of insecticides. To determine the temperature-toxicity relationship in house flies, the effect of post-bioassays temperature (range, 20-34°C) on the toxicity of seven insecticides from organophosphate (chlorpyrifos, profenofos), pyrethroid (cypermethrin, deltamethrin) and new chemical (emamectin benzoate, fipronil, spinosad) classes was evaluated by using a feeding bioassay method. From 20-34°C, the toxicities of chlorpyrifos, profenofos, emamectin and fipronil increased 2.10, 2.93, 2.40 and 3.82 fold (i.e. positive temperature coefficient), respectively. Whereas, the toxicities of cypermethrin, deltamethrin and spinosad decreased 2.21, 2.42 and 3.16 fold (i.e. negative temperature coefficient), respectively. These findings suggest that for the reduction in diarrheal cases, house flies should be controlled with insecticides according to the prevailing environmental temperature. Insecticides with a positive temperature coefficient may serve as potential candidates in controlling house flies and diarrhea epidemics in hot season and vice versa.

  7. Interactions between Entomopathogenic Fungus, Metarhizium Anisopliae and Sublethal Doses of Spinosad for Control of House Fly, Musca Domestica

    Directory of Open Access Journals (Sweden)

    M Sharififard


    Full Text Available Background: Metarhizium anisopliae strain IRAN 437C is one of the most virulent fungal isolates against house fly, Musca domestica. The objective of this study was to determine the interaction of this isolate with sublethal doses of spino­sad against housefly.Methods: In adult bioassay, conidia of entomopathogenic fungus were applied as inoculated bait at 105 and 107 spore per gram and spinosad at 0.5, 1 and 1.5 µg (A.I. per gram bait. In larval bioassay, conidia were applied as combina­tion of spore with larval bedding at 106 and 108 spore per gram and spinosad at sublethals of 0.002, 0.004 and 0.006 µg (AI per gram medium. Results: Adult mortality was 48% and 72% for fungus alone but ranged from 66–87% and 89–95% in combination treat­ments of 105 and 107 spore/g with sublethal doses of spinosad respectively. The interaction between 105 spore/g with sublethals exhibited synergistic effect, but in combination of 107 spore in spite of higher mortality, the interac­tion was additive. There was significant difference in LT50 among various treatments. LT50 values in all combination treat­ments were smaller than LT50 values in alone ones. Larval mortality was 36% and 69% for fungus alone but ranged from 58%–78% and 81%–100% in combination treatments of 106 and 108 spore/g medium with sublethals of spino­sad respectively. The interaction was synergistic in all combination treatments of larvae.Conclusion: The interaction between M. anispliae and spinosad indicated a synergetic effect that increased the house fly mortality as well as reduced the lethal time.

  8. Spatial and temporal assessment of pollen- and seed-mediated gene flow from genetically engineered plum Prunus domestica. (United States)

    Scorza, Ralph; Kriss, Alissa B; Callahan, Ann M; Webb, Kevin; Demuth, Mark; Gottwald, Tim


    Pollen flow from a 0.46 ha plot of genetically engineered (GE) Prunus domestica located in West Virginia, USA was evaluated from 2000-2010. Sentinel plum trees were planted at distances ranging from 132 to 854 m from the center of the GE orchard. Plots of mixed plum varieties and seedlings were located at 384, 484 and 998 m from the GE plot. Bee hives (Apis mellifera) were dispersed between the GE plum plot and the pollen flow monitoring sites. Pollen-mediated gene flow from out of the GE plum plot to non-GE plums under the study conditions was low, only occurring at all in 4 of 11 years and then in only 0.31% of the 12,116 seeds analyzed. When it occurred, gene flow, calculated as the number of GUS positive embryos/total embryos sampled, ranged from 0.215% at 132 m from the center of the GE plum plot (28 m from the nearest GE plum tree) to 0.033-0.017% at longer distances (384-998 m). Based on the percentage of GUS positive seeds per individual sampled tree the range was 0.4% to 12%. Within the GE field plot, gene flow ranged from 4.9 to 39%. Gene flow was related to distance and environmental conditions. A single year sample from a sentinel plot 132 m from the center of the GE plot accounted for 65% of the total 11-year gene flow. Spatial modeling indicated that gene flow dramatically decreased at distances over 400 m from the GE plot. Air temperature and rainfall were, respectively, positively and negatively correlated with gene flow, reflecting the effects of weather conditions on insect pollinator activity. Seed-mediated gene flow was not detected. These results support the feasibility of coexistence of GE and non-GE plum orchards.

  9. Effectiveness of Naturally Occurring Substances Added to Duck Litter in Reducing Emergence and Landing of Adult Musca domestica (Diptera: Muscidae). (United States)

    Lachance, Simon; Shiell, Justine; Guerin, Michele T; Scott-Dupree, Cynthia


    Poultry barns provide an ideal breeding environment for Musca domestica L. (Diptera: Muscidae) owing to the controlled temperatures and litter (manure plus bedding material) accumulation. Management techniques that render the litter less suitable for immature stage development, such as the addition of naturally occurring insecticidal substances, could reduce fly infestations. The effectiveness of acetic, boric, and citric acids; diatomaceous earth; and hydrated lime at restricting female landing and growth of house flies in duck litter was evaluated. Litter treated with 1.9% and 4.7% by weight of acetic or boric acid had significantly lower adult emergence rates compared with the same concentrations of citric acid, diatomaceous earth, hydrated lime, or the untreated control litter. The pH of duck litter treated with acetic or citric acid was significantly reduced and remained significantly lower than the control litter (pH 8.7) for 10 d. Significantly more house flies landed on a house fly-rearing substrate (wheat bran, powdered milk, bloodmeal, water, and yeast) than litter treated with any of the other test substances or the control. The LC50 for boric acid was estimated to be 0.01% by weight, which was lower than that of acetic acid (1.42%). Similarly, the LC90 of boric acid was estimated to be 0.12%, which was lower than that of acetic acid (10.03%). Acetic acid and boric acid have the potential to be incorporated into litter as a pest management tactic to reduce house fly populations in duck production facilities.

  10. Heat-shock-mediated elimination of the nptII marker gene in transgenic apple (Malus×domestica Borkh.). (United States)

    Herzog, Katja; Flachowsky, Henryk; Deising, Holger B; Hanke, Magda-Viola


    Production of marker-free genetically modified (GM) plants is one of the major challenges of molecular fruit breeding. Employing clean vector technologies, allowing the removal of undesired DNA sequences from GM plants, this goal can be achieved. The present study describes the establishment of a clean vector system in apple Malus×domestica Borkh., which is based on the use of the neomycin phosphotransferase II gene (nptII) as selectable marker gene and kanamycin/paramomycin as selective agent. The nptII gene can be removed after selection of GM shoots via site-specific excision mediated by heat-shock-inducible expression of the budding yeast FLP recombinase driven by the soybean Gmhsp17.5-E promoter. We created a monitoring vector containing the nptII and the flp gene as a box flanked by two direct repeats of the flp recognition target (FRT) sites. The FRT-flanked box separates the gusA reporter gene from the Cauliflower Mosaic Virus 35S (CaMV 35S) promoter. Consequently, GUS expression does only occur after elimination of the FRT-flanked box. Transformation experiments using the monitoring vector resulted in a total of nine transgenic lines. These lines were investigated for transgenicity by PCR, RT-PCR and Southern hybridization. Among different temperature regimes tested, exposure to 42 °C for 3.5 to 4h led to efficient induction of FLP-mediated recombination and removal of the nptII marker gene. A second round of shoot regeneration from leaf explants led to GM apple plants completely free of the nptII gene.

  11. Fungal dissemination by housefly (Musca domestica L.) and contamination of food commodities in rural areas of South Africa. (United States)

    Phoku, J Z; Barnard, T G; Potgieter, N; Dutton, M F


    Several insects that act as vectors, including houseflies (Musca domestica L.), are often considered to be an important source of fungal contamination in human foods. Houseflies are also involved in the transmission of bacterial pathogens that may pose a serious hazard to human health. Thus, the rural population of South Africa, as typified by that in the Gauteng Province investigated in this study, is at high risk from fungal exposure disseminated by houseflies and it is therefore important to assess the role of flies in contaminating various food commodities. Eighty four samples of houseflies (captured from households and pit toilets) were studied for their potential to carry fungal spores into food commodities. The fungi occurring in samples of raw maize (15) and porridge (19) were also assessed. Fungal isolates were identified based on morphological characteristics by conventional identification methods. Fifteen genera of fungi were isolated and identified, of which Aspergillus, Fusarium, Penicillium, Cladosporium, Moniliella and Mucor were the most prevalent in all three sample types analysed. The incidence rates of fungal contamination per total fungal count isolated in houseflies, maize and porridge were recorded with mean fungal load of 2×10(8) CFU/ml, 1×10(7)CFU/g and 2×10(7)CFU/g respectively. Additionally, A. flavus, A. parasiticus, F. verticillioides, F. proliferatum, P. verrucosum, P. aurantiogriseum and M. suaveolens were the most frequent fungal isolates in houseflies with incidence rate of 34%, 11%, 27%, 21%, 22%, 17% and 32% respectively. F. verticillioides, A. flavus, A. niger and P. oslonii were the most prevalent species contaminating porridge and maize with incidence rate of 23%, 32%, 16% and 28% in maize samples, while incidence rates of 59%, 15% and 29% were recorded in porridge samples with the exception of F. verticillioides. The prevalence of these genera of fungi may pose serious health risks.

  12. Pollen tube access to the ovule is mediated by glycoprotein secretion on the obturator of apple (Malus × domestica, Borkh). (United States)

    Losada, Juan M; Herrero, Maria


    Within the ovary, the obturator bridges the pathway of the pollen tube from the style to the ovule. Despite its widespread presence among flowering plants, its function has only been studied in a handful of species, and the molecules involved in pollen tube-obturator cross-talk have not been explored hitherto. This work evaluates the involvement of glucans and glycoproteins on pollen tube growth in the obturator of apple flowers ( Malus × domestica) . Pollen tube kinetics were sequentially examined in the pistil and related to changes occurring on the obturator using histochemistry and inmunocytochemistry. To discriminate between changes in the obturator induced by pollen tubes from those developmentally regulated, both pollinated and unpollinated pistils were examined. Pollen tube growth rates were slow in the stigma, faster in the style and slow again in the ovary. The arrival of pollen tubes at the obturator was concomitant with the secretion of proteins, saccharides and glycoprotein epitopes belonging to extensins and arabinogalactan proteins (AGPs). While some of these secretions - extensins and AGPs labelled by JIM13 - were developmentally regulated, others - AGPs labelled by JIM8 - were elicited by the presence of pollen tubes. Following pollen tube passage, all these glycoproteins were depleted. The results show a timely secretion of glycoproteins on the obturator surface concomitant with pollen tube arrival at this structure. The fact that their secretion is depleted following pollen tube passage strongly suggests their role in regulating pollen tube access to the ovule. Remarkably, both the regulation of the secretion of the different glycoproteins, as well as their association with the performance of pollen tubes exhibit similarities with those observed in the stigma, in line with their common developmental origin.

  13. Molecular cloning and functional analysis of a blue light receptor gene MdCRY2 from apple (Malus domestica). (United States)

    Li, Yuan-Yuan; Mao, Ke; Zhao, Cheng; Zhao, Xian-Yan; Zhang, Rui-Fen; Zhang, Hua-Lei; Shu, Huai-Rui; Hao, Yu-Jin


    MdCRY2 was isolated from apple fruit skin, and its function was analyzed in MdCRY2 transgenic Arabidopsis. The interaction between MdCRY2 and AtCOP1 was found by yeast two-hybrid and BiFC assays. Cryptochromes are blue/ultraviolet-A (UV-A) light receptors involved in regulating various aspects of plant growth and development. Investigations of the structure and functions of cryptochromes in plants have largely focused on Arabidopsis (Arabidopsis thaliana), tomato (Solanum lycopersicum), pea (Pisum sativum), and rice (Oryza sativa). However, no data on the function of CRY2 are available in woody plants. In this study, we isolated a cryptochrome gene, MdCRY2, from apple (Malus domestica). The deduced amino acid sequences of MdCRY2 contain the conserved N-terminal photolyase-related domain and the flavin adenine dinucleotide (FAD) binding domain, as well as the C-terminal DQXVP-acidic-STAES (DAS) domain. Relationship analysis indicates that MdCRY2 shows the highest similarity to the strawberry FvCRY protein. The expression of MdCRY2 is induced by blue/UV-A light, which represents a 48-h circadian rhythm. To investigate the function of MdCRY2, we overexpressed the MdCRY2 gene in a cry2 mutant and wild type (WT) Arabidopsis, assessed the phenotypes of the resulting transgenic plants, and found that MdCRY2 functions to regulate hypocotyl elongation, root growth, flower initiation, and anthocyanin accumulation. Furthermore, we examined the interaction between MdCRY2 and AtCOP1 using a yeast two-hybrid assay and a bimolecular fluorescence complementation assay. These data provide functional evidence for a role of blue/UV-A light-induced MdCRY2 in controlling photomorphogenesis in apple.

  14. Chilling-related cell damage of apple (Malus × domestica Borkh.) fruit cortical tissue impacts antioxidant, lipid and phenolic metabolism. (United States)

    Leisso, Rachel S; Buchanan, David A; Lee, Jinwook; Mattheis, James P; Sater, Chris; Hanrahan, Ines; Watkins, Christopher B; Gapper, Nigel; Johnston, Jason W; Schaffer, Robert J; Hertog, Maarten L A T M; Nicolaï, Bart M; Rudell, David R


    'Soggy breakdown' (SB) is an internal flesh disorder of 'Honeycrisp' apple (Malus × domestica Borkh.) fruit that occurs during low temperature storage. The disorder is a chilling injury (CI) in which visible symptoms typically appear after several weeks of storage, but information about the underlying metabolism associated with its induction and development is lacking. The metabolic profile of flesh tissue from wholly healthy fruit and brown and healthy tissues from fruit with SB was characterized using gas chromatography-mass spectrometry (GC-MS) and liquid chromatograph-mass spectrometry (LC-MS). Partial least squares discriminant analysis (PLS-DA) and correlation networks revealed correlation among ester volatile compounds by composition and differences in phytosterol, phenolic and putative triacylglycerides (TAGs) metabolism among the tissues. anova-simultaneous component analysis (ASCA) was used to test the significance of metabolic changes linked with tissue health status. ASCA-significant components included antioxidant compounds, TAGs, and phytosterol conjugates. Relative to entirely healthy tissues, elevated metabolite levels in symptomatic tissue included γ-amino butyric acid, glycerol, sitosteryl (6'-O-palmitoyl) β-d-glucoside and sitosteryl (6'-O-stearate) β-d-glucoside, and TAGs containing combinations of 16:0, 18:3, 18:2 and 18:1 fatty acids. Reduced metabolite levels in SB tissue included 5-caffeoyl quinate, β-carotene, catechin, epicatechin, α-tocopherol, violaxanthin and sitosteryl β-d glucoside. Pathway analysis indicated aspects of primary metabolism differed according to tissue condition, although differences in metabolites involved were more subtle than those of some secondary metabolites. The results implicate oxidative stress and membrane disruption processes in SB development and constitute a diagnostic metabolic profile for the disorder. © 2014 Scandinavian Plant Physiology Society.

  15. Down-regulation of POLYGALACTURONASE1 alters firmness, tensile strength and water loss in apple (Malus x domestica fruit

    Directory of Open Access Journals (Sweden)

    Atkinson Ross G


    Full Text Available Abstract Background While there is now a significant body of research correlating apple (Malus x domestica fruit softening with the cell wall hydrolase ENDO-POLYGALACTURONASE1 (PG1, there is currently little knowledge of its physiological effects in planta. This study examined the effect of down regulation of PG1 expression in ‘Royal Gala’ apples, a cultivar that typically has high levels of PG1, and softens during fruit ripening. Results PG1-suppressed ‘Royal Gala’ apples harvested from multiple seasons were firmer than controls after ripening, and intercellular adhesion was higher. Cell wall analyses indicated changes in yield and composition of pectin, and a higher molecular weight distribution of CDTA-soluble pectin. Structural analyses revealed more ruptured cells and free juice in pulled apart sections, suggesting improved integrity of intercellular connections and consequent cell rupture due to failure of the primary cell walls under stress. PG1-suppressed lines also had reduced expansion of cells in the hypodermis of ripe apples, resulting in more densely packed cells in this layer. This change in morphology appears to be linked with reduced transpirational water loss in the fruit. Conclusions These findings confirm PG1’s role in apple fruit softening and suggests that this is achieved in part by reducing cellular adhesion. This is consistent with previous studies carried out in strawberry but not with those performed in tomato. In apple PG1 also appears to influence other fruit texture characters such as juiciness and water loss.

  16. Genome-wide identification and analysis of the SBP-box family genes in apple (Malus × domestica Borkh.). (United States)

    Li, Jun; Hou, Hongmin; Li, Xiaoqin; Xiang, Jiang; Yin, Xiangjing; Gao, Hua; Zheng, Yi; Bassett, Carole L; Wang, Xiping


    SQUAMOSA promoter binding protein (SBP)-box genes encode a family of plant-specific transcription factors and play many crucial roles in plant development. In this study, 27 SBP-box gene family members were identified in the apple (Malus × domestica Borkh.) genome, 15 of which were suggested to be putative targets of MdmiR156. Plant SBPs were classified into eight groups according to the phylogenetic analysis of SBP-domain proteins. Gene structure, gene chromosomal location and synteny analyses of MdSBP genes within the apple genome demonstrated that tandem and segmental duplications, as well as whole genome duplications, have likely contributed to the expansion and evolution of the SBP-box gene family in apple. Additionally, synteny analysis between apple and Arabidopsis indicated that several paired homologs of MdSBP and AtSPL genes were located in syntenic genomic regions. Tissue-specific expression analysis of MdSBP genes in apple demonstrated their diversified spatiotemporal expression patterns. Most MdmiR156-targeted MdSBP genes, which had relatively high transcript levels in stems, leaves, apical buds and some floral organs, exhibited a more differential expression pattern than most MdmiR156-nontargeted MdSBP genes. Finally, expression analysis of MdSBP genes in leaves upon various plant hormone treatments showed that many MdSBP genes were responsive to different plant hormones, indicating that MdSBP genes may be involved in responses to hormone signaling during stress or in apple development.

  17. Variations of Antioxidant Characteristics and Mineral Contents in Pulp and Peel of Different Apple (Malus domestica Borkh. Cultivars from Pakistan

    Directory of Open Access Journals (Sweden)

    Maleeha Manzoor


    Full Text Available Variations of phenolics, antioxidant activity, and mineral contents in peel and pulp of five apple (Malus domestica Borkh. cultivars from Pakistan, namely Red Delicious, Golden Delicious, Kashmiri Amri, Kala Kulu and Sky Spur were appraised. The mean extract yield of antioxidant components obtained with 80:20 methanol-water (v/v, was found to be 22.1 g/100 g for peel and 14.2 g/100 g for pulp on a dry weight basis. The amounts of total phenolics and total flavonoids in peel and pulp of different cultivars of apple ranged from 1,907.5–2,587.9 mg gallic acid equivalent/100 g DW and 1,214.3–1,816.4 mg catechin equivalent/100 g DW and 1,185.2–1,475.5 mg GAE/100 g DW and 711.8–999.3 mg CE/100 g DW, respectively. The inhibition of linoleic acid peroxidation and DPPH scavenging activity of the extracts varied from 71.7–84.9 and 66.6–80.8% in peel, and 43.9–52.8 and 42.9–51.1% in pulp, respectively. Reducing power of the tested fruit part extracts at concentration 12.5 mg/mL ranged from 2.54–2.89 and 1.37–1.73, respectively. With regard to minerals analysis, both fruit parts showed the amount of K to be the highest, followed by Mg, Ca, Fe, Na and Zn. The results revealed that peel of the tested apple cultivars in this study had superior antioxidant capacity and mineral concentration than the pulp, indicating significant variations between the parts tested. Thus, consumption of apple fruits along with peel might be recommended to gaining better nutritive benefits.

  18. Insecticidal evaluation of essential oils of Citrus sinensis L. (Myrtales: Myrtaceae) against housefly, Musca domestica L. (Diptera: Muscidae). (United States)

    Kumar, Peeyush; Mishra, Sapna; Malik, Anushree; Satya, Santosh


    The housefly, Musca domestica L., is one of the most common insects, associated with vectoring of various etiological agents. In order to search for effective control agent, the essential oil of sweet orange [Citrus sinensis (L.) Osbeck] was evaluated for its insecticidal activity against the larvae and pupae of housefly using contact toxicity and fumigation bioassays. In the contact toxicity assay, lethal concentration, LC(50) of C. sinensis essential oil against housefly larvae, varied between 3.93 and 0.71 μl/cm(2) for different observation days, while lethal time, LT(50), varied between 5.8 to 2.3 days. Mortality of larvae were significant with different concentrations (F = 2.79, df = 4, P housefly larvae, LC(50) of 71.2 and 52.6 μl/l was obtained in 24 and 48 h, respectively. Scanning electron microscopy of oil treated larvae revealed extreme dehydration and surface distortion while control larvae were free from any of the above symptoms and presented smooth surface, conforming effect of essential oil on housefly larvae. Percentage inhibition rate of oil against housefly pupae was 27.3-72.7% for contact toxicity and 46.4-100% for fumigation assay. Compositional analysis of C. sinensis essential oil using gas chromatography/mass spectrometry (GC-MS) revealed D: -limonene (73.24%), α-pinene (5.86%) and myrcene (4.45%) as major components whereas its vapour profile (solid-phase micro extraction-GC/MS) was dominated by D: -limonene at 92.57%. Significant activity of C. sinensis essential oil against larvae and pupae of housefly, pave the way for its use as eco-friendly housefly control measure.

  19. Response of pigmented porcine skin (Sus scrofa domestica) to single 3.8-micron laser radiation pulses (United States)

    Bostick, Anthony C.; Johnson, Thomas E.; Randolph, Donald Q.; Winston, Golda C. H.


    Background and purpose: The purpose of this study is to determine the impact of melanin on skin response to single 3.8 micron, eight microsecond laser pulses and the difference in lesion formation thresholds for input into laser safety standards. Williams et al., performed a study examining laser tissue interaction from 3.8-micron lasers in lightly pigmented Yorkshire pigs (Sus scrofa domestica). However, studies performed by Eggleston et al comparing pigmented and lightly pigmented skin with human skin found that the Yucatan mini-pig is a superior model for laser skin exposures. Methods: Five Yucatan mini-pigs under general anesthesia were exposed to 3.8 micron laser pulses ranging from 0.8 J/cm2 to 93 J/cm2. Gross examinations were done acutely and 24 hours after laser exposure. Skin biopsies were then collected at various times post exposure, and histologic examinations were conducted. Results: The 24 hour ED50 was determined to be 4.5 J/cm2 with fiducial limits of 6.2 and 2.2 J/cm2. As deposited energy was increased, the lesion presentation ranged from whitening of the epidermis (4 J/cm2) to whitening with inflammatory centers (14 J/cm2), and at the highest energy levels inflammatory areas were replaced with an epidermal ulcerated central area (>21 J/cm2). Conclusion: Preliminary findings suggest pigmentation or melanin may play a minor role in the mechanism of laser-tissue damage. The ED50 of Yorkshire pigs was 2.6 J/cm2. The ED50 of the Yucatan mini-pig was found to be 3.6 J/cm2, and although it was higher, it is still within the 95% fiducial limits.

  20. Parasite distribution and early-stage encephalitis in Sarcocystis calchasi infections in domestic pigeons (Columba livia f. domestica). (United States)

    Maier, Kristina; Olias, Philipp; Enderlein, Dirk; Klopfleisch, Robert; Mayr, Sylvia L; Gruber, Achim D; Lierz, Michael


    Pigeon protozoal encephalitis is a biphasic, neurologic disease of domestic pigeons (Columba livia f. domestica) caused by the apicomplexan parasite Sarcocystis calchasi. Despite severe inflammatory lesions of the brain, associated parasitic stages have only rarely been identified and the cause of the lesions is still unclear. The aim of this study was therefore to characterize the tissue distribution of S. calchasi within pigeons between the two clinical phases and during the occurrence of neurological signs. For this purpose, a semi-quantitative real-time polymerase chain reaction (PCR) was developed. Forty-five domestic pigeons were infected orally (via a cannula into the crop) with 200 S. calchasi sporocysts and euthanized in groups of three pigeons at intervals of 2 to 10 days over a period of 61 days. Tissue samples including brain and skeletal muscle were examined by histology, immunohistochemistry, and PCR. Schizonts were detected in the liver of one pigeon at day 10 post infection. A mild encephalitis was detected at day 20 post infection, around 4 weeks before the onset of neurological signs. At the same time, immature sarcocysts were present in the skeletal muscle. In seven pigeons a few sarcocysts were identified in the brain, but not associated with any lesion. These results suggest that the encephalitis is induced at a very early stage of the S. calchasi lifecycle rather than in the chronic phase of pigeon protozoal encephalitis. Despite the increasing severity of lesions in the central nervous system, the amount of sarcocysts did not increase. This supports the hypothesis of a delayed-type hypersensitivity response as the cause of the encephalitis. The study also demonstrated that S. calchasi DNA is detectable in tissues negative by histological methods, indicating a higher sensitivity of the real-time PCR.

  1. Spatial and temporal assessment of pollen- and seed-mediated gene flow from genetically engineered plum Prunus domestica.

    Directory of Open Access Journals (Sweden)

    Ralph Scorza

    Full Text Available Pollen flow from a 0.46 ha plot of genetically engineered (GE Prunus domestica located in West Virginia, USA was evaluated from 2000-2010. Sentinel plum trees were planted at distances ranging from 132 to 854 m from the center of the GE orchard. Plots of mixed plum varieties and seedlings were located at 384, 484 and 998 m from the GE plot. Bee hives (Apis mellifera were dispersed between the GE plum plot and the pollen flow monitoring sites. Pollen-mediated gene flow from out of the GE plum plot to non-GE plums under the study conditions was low, only occurring at all in 4 of 11 years and then in only 0.31% of the 12,116 seeds analyzed. When it occurred, gene flow, calculated as the number of GUS positive embryos/total embryos sampled, ranged from 0.215% at 132 m from the center of the GE plum plot (28 m from the nearest GE plum tree to 0.033-0.017% at longer distances (384-998 m. Based on the percentage of GUS positive seeds per individual sampled tree the range was 0.4% to 12%. Within the GE field plot, gene flow ranged from 4.9 to 39%. Gene flow was related to distance and environmental conditions. A single year sample from a sentinel plot 132 m from the center of the GE plot accounted for 65% of the total 11-year gene flow. Spatial modeling indicated that gene flow dramatically decreased at distances over 400 m from the GE plot. Air temperature and rainfall were, respectively, positively and negatively correlated with gene flow, reflecting the effects of weather conditions on insect pollinator activity. Seed-mediated gene flow was not detected. These results support the feasibility of coexistence of GE and non-GE plum orchards.

  2. The volatile profiles of a rare apple (Malus domestica Borkh.) honey: shikimic acid-pathway derivatives, terpenes, and others. (United States)

    Kuś, Piotr Marek; Jerković, Igor; Tuberoso, Carlo Ignazio Giovanni; Šarolić, Mladenka


    The volatile profiles of rare Malus domestica Borkh. honey were investigated for the first time. Two representative samples from Poland (sample I) and Spain (sample II) were selected by pollen analysis (44-45% of Malus spp. pollen) and investigated by GC/FID/MS after headspace solid-phase microextraction (HS-SPME) and ultrasonic solvent extraction (USE). The apple honey is characterized by high percentage of shikimic acid-pathway derivatives, as well as terpenes, norisoprenoids, and some other compounds such as coumaran and methyl 1H-indole-3-acetate. The main compounds of the honey headspace were (sample I; sample II): benzaldehyde (9.4%; 32.1%), benzyl alcohol (0.3%; 14.4%), hotrienol (26.0%, 6.2%), and lilac aldehyde isomers (26.3%; 1.7%), but only Spanish sample contained car-2-en-4-one (10.2%). CH2 Cl2 and pentane/Et2 O 1 : 2 (v/v) were used for USE. The most relevant compounds identified in the extracts were: benzaldehyde (0.9-3.9%), benzoic acid (2.0-11.2%), terpendiol I (0.3-7.4%), coumaran (0.0-2.8%), 2-phenylacetic acid (2.0-26.4%), methyl syringate (3.9-13.1%), vomifoliol (5.0-31.8%), and methyl 1H-indole-3-acetate (1.9-10.2%). Apple honey contained also benzyl alcohol, 2-phenylethanol, (E)-cinnamaldehyde, (E)-cinnamyl alcohol, eugenol, vanillin, and linalool that have been found previously in apple flowers, thus disclosing similarity of both volatile profiles.

  3. Gene : CBRC-PMAR-01-0515 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0515 Novel UN A Odorant/olfactory and gustatory receptors O52P1_HUMAN ...2e-34 32% ref|XP_001371055.1| PREDICTED: hypothetical protein [Monodelphis domestica] 6e-35 31% gnl|UG|Pma#S35161357 PM...337313 /gi=116023302 /ug=Pma.113 /len=642 7e-40 46% MLATFEAPYSVQLCAFGLFLPLFVVTIVANVAVLATVAARVDLHKPMYMFLCSLVV

  4. Gene : CBRC-MDOM-01-0392 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available etical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_...IFFTSSFICFASSFISFASFSSWLVLAFKTPFSCFSSSASVYKCLILVFKFFSQFYSASLNCVLNCILSSSKDCIQFAGISDFSFADPSPSVSFALCSLPVQKLSIVISFFFFCCLLKFTPSLLPIFVCALTPLIFFLFWGCQSPLLELCQISWYSL ... ...04581 [Lodderomyces elongisporus NRRL YB-4239] 2e-08 33% gnl|UG|Mdm#S40592008 Monodelphis domestica vomerona

  5. Gene : CBRC-MDOM-03-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available etical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_...ISLASFSNWLILTFKTLVSVSRLLILVFKFFSQLYSASLNFVLNCILSSSKACIHFSGISDLLFADPSPSVPFALCLLPVQKLSIVISFLLFCHLLIFTPSLLPIFVCALAPLTFLVLGFYVSLPSWSFDRKSLPTLWCWSLSFPVLWRLLIGLN ... ...04581 [Lodderomyces elongisporus NRRL YB-4239] 0.002 30% gnl|UG|Mdm#S40592008 Monodelphis domestica vomerona

  6. Gene : CBRC-MDOM-09-0044 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available etical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_...FFASSFSFFASSFISFASFSSWLILAFKTLFSVSRGLILVFKFLSQLSSASLSCVLNCILSSSKACVQFAGISILLLAYSCELFVLGLLPVQKLSIVISFFFFCCLFTFTPSLLFCCVCALAPLIFLVLRL ... ...04581 [Lodderomyces elongisporus NRRL YB-4239] 3e-06 37% gnl|UG|Mdm#S40592008 Monodelphis domestica vomerona

  7. Gene : CBRC-MDOM-02-0315 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available etical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_...FASSFISFASFSSWLILAFKTVFSVSRLLILVFKFLSQLSSASLSCVLNCILSSSKACVQFAGISVLLLISSSVLLVLGSLPVQKLSIVISFFFFCCLLIFTSSLLPVFVCALAPLIFFWFWGFLSVSPLGALSELSVQSLGEECWLPCPLEAFDQIMLNWVGLYVL ... ...04581 [Lodderomyces elongisporus NRRL YB-4239] 2e-05 35% gnl|UG|Mdm#S40592008 Monodelphis domestica vomerona

  8. AcEST: DK962216 [AcEST

    Lifescience Database Archive (English)

    Full Text Available NDO Somatotropin OS=Monodelphis domestica GN=GH... 32 2.8 sp|Q11ED3|ANMK_MESSB Anhydro-N-acetylmuramic acid ...bjct: 19 GPQRAAAFPAMPLSSLFANAVLRAQHLHQLVADTYKEFERTYIP 62 >sp|Q11ED3|ANMK_MESSB An

  9. AcEST: DK956268 [AcEST

    Lifescience Database Archive (English)

    Full Text Available S=Monodelphis domestica GN=GH... 32 2.6 sp|Q11ED3|ANMK_MESSB Anhydro-N-acetylmuramic acid kinase OS=Meso... ...LFANAVLRAQHLHQLVADTYKEFERTYIP 62 >sp|Q11ED3|ANMK_MESSB Anhydro-N-acetylmuramic acid kinase OS=Mesorhizobium

  10. AcEST: DK955372 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ecula GN=GH... 33 1.3 sp|Q9GL60|SOMA_MONDO Somatotropin OS=Monodelphis domestica GN=GH... 32 2.2 sp|Q11ED3|ANMK_MESSB...Sbjct: 19 GPQRAAAFPAMPLSSLFANAVLRAQHLHQLVADTYKEFERTYIP 62 >sp|Q11ED3|ANMK_MESSB Anhydro-N-acetylmuramic acid

  11. Gene : CBRC-MDOM-01-0411 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available etical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_...LAFWSSFSFWSDFLWRSSFILFTSSFISFFLIFHLLHLIFYLLCLIFHLLCLISSWLILTFKTLFSCFSSSASVSRSLILVFKFFSQLSSASLNCILNCILSSSKACFQFAGIS...04581 [Lodderomyces elongisporus NRRL YB-4239] 1e-06 32% gnl|UG|Mdm#S40592008 Monodelphis domestica vomerona

  12. Gene : CBRC-MEUG-01-1357 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1357 Novel UN B UNKNOWN CMYA5_HUMAN 0.0 33% ref|XP_001381564.1| PREDICTED: similar to cardiomyo...pathy associated 5 [Monodelphis domestica] 0.0 47% MVTVQREDSGITWETSSSRSSTPWASDSGLTS

  13. Unigene BLAST: CBRC-MDOM-02-0154 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 0.87 39% ... ...CBRC-MDOM-02-0154 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  14. Unigene BLAST: CBRC-MDOM-07-0029 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 0.46 34% ... ...CBRC-MDOM-07-0029 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  15. Unigene BLAST: CBRC-MDOM-08-0177 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 5.5 36% ... ...CBRC-MDOM-08-0177 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  16. Unigene BLAST: CBRC-MDOM-08-0086 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 4.6 36% ... ...CBRC-MDOM-08-0086 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  17. Unigene BLAST: CBRC-MDOM-01-0486 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 9.4 66% ... ...CBRC-MDOM-01-0486 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  18. Unigene BLAST: CBRC-MDOM-05-0241 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 7.2 43% ... ...CBRC-MDOM-05-0241 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  19. Unigene BLAST: CBRC-MDOM-06-0078 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 7.3 33% ... ...CBRC-MDOM-06-0078 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  20. Unigene BLAST: CBRC-MDOM-05-0453 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 9.7 33% ... ...CBRC-MDOM-05-0453 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  1. Unigene BLAST: CBRC-MDOM-01-0249 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 0.84 39% ... ...CBRC-MDOM-01-0249 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  2. Unigene BLAST: CBRC-MDOM-06-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 0.94 40% ... ...CBRC-MDOM-06-0028 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  3. Unigene BLAST: CBRC-MDOM-05-0223 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 4.2 46% ... ...CBRC-MDOM-05-0223 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  4. Unigene BLAST: CBRC-MDOM-04-0641 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 1.8 50% ... ...CBRC-MDOM-04-0641 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  5. Unigene BLAST: CBRC-MDOM-04-0570 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 2.9 61% ... ...CBRC-MDOM-04-0570 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  6. Unigene BLAST: CBRC-MDOM-07-0090 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 1.7 37% ... ...CBRC-MDOM-07-0090 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  7. Unigene BLAST: CBRC-MDOM-01-0445 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 1.8 55% ... ...CBRC-MDOM-01-0445 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  8. Unigene BLAST: CBRC-MDOM-05-0497 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 3.3 53% ... ...CBRC-MDOM-05-0497 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  9. Unigene BLAST: CBRC-MDOM-02-0207 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 1.1 34% ... ...CBRC-MDOM-02-0207 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  10. Unigene BLAST: CBRC-MDOM-01-0472 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 9.5 36% ... ...CBRC-MDOM-01-0472 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  11. Unigene BLAST: CBRC-MDOM-02-0312 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 5.8 41% ... ...CBRC-MDOM-02-0312 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  12. Unigene BLAST: CBRC-MDOM-04-0115 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 5.6 39% ... ...CBRC-MDOM-04-0115 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  13. Unigene BLAST: CBRC-MDOM-02-0317 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 5.9 36% ... ...CBRC-MDOM-02-0317 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  14. Unigene BLAST: CBRC-MDOM-04-0310 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 9.7 40% ... ...CBRC-MDOM-04-0310 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  15. Unigene BLAST: CBRC-MDOM-04-0441 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 1.7 28% ... ...CBRC-MDOM-04-0441 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  16. Unigene BLAST: CBRC-MDOM-04-0150 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 4.2 37% ... ...CBRC-MDOM-04-0150 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  17. Unigene BLAST: CBRC-MDOM-02-0054 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 3.4 53% ... ...CBRC-MDOM-02-0054 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  18. Unigene BLAST: CBRC-MDOM-04-0638 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 4.7 28% ... ...CBRC-MDOM-04-0638 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  19. Unigene BLAST: CBRC-MDOM-04-0143 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 3.9 35% ... ...CBRC-MDOM-04-0143 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr

  20. Unigene BLAST: CBRC-MDOM-06-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available angement mRNA sequence /gb=DQ979399 /gi=118638583 /ug=Mdm.4713 /len=1577 7.3 33% ... ...CBRC-MDOM-06-0072 gnl|UG|Mdm#S38675334 Monodelphis domestica clone T9.2 non-productive T-cell receptor rearr