Molecular pathways underlying inhibitory effect of antimicrobial peptide Nal-P-113 on bacteria biofilms formation of Porphyromonas gingivalis W83 by DNA microarray.

Science.gov (United States)

Wang, Hong-Yan; Lin, Li; Tan, Li-Si; Yu, Hui-Yuan; Cheng, Jya-Wei; Pan, Ya-Ping

2017-02-17

Wound-related infection remains a major challenge for health professionals. One disadvantage in conventional antibiotics is their inability to penetrate biofilms, the main protective strategy for bacteria to evade irradiation. Previously, we have shown that synthetic antimicrobial peptides could inhibit bacterial biofilms formation. In this study, we first delineated how Nal-P-113, a novel antimicrobial peptide, exerted its inhibitory effects on Porphyromonas gingivalis W83 biofilms formation at a low concentration. Secondly, we performed gene expression profiling and validated that Nal-P-113 at a low dose significantly down-regulated genes related to mobile and extrachromosomal element functions, transport and binding proteins in Porphyromonas gingivalis W83. These findings suggest that Nal-P-113 at low dose is sufficient to inhibit the formation of biofilms although Porphyromonas gingivalis W83 may maintain its survival in the oral cavity. The newly discovered molecular pathways may add the knowledge of developing a new strategy to target bacterial infections in combination with current first-line treatment in periodontitis.

46 CFR 113.35-13 - Mechanical engine order telegraph systems; operation.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Mechanical engine order telegraph systems; operation...) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT Engine Order Telegraph Systems § 113.35-13 Mechanical engine order telegraph systems; operation. If more than one transmitter operates a...

Single-Qubit Operation Sharing with Bell and W Product States

International Nuclear Information System (INIS)

Ji Qi-Bin; Liu Xian-Song; Yin Xiao-Feng; Zhang Zhan-Jun; Liu Yi-Min

2013-01-01

Two tripartite schemes are put forward with shared entanglements and Local Operation and Classical Communication (LOCC) for sharing an operation on a remote target sate. The first scheme uses a Bell and a symmetric W states as quantum channels, while the second replaces the symmetric W state by an asymmetric one. Both schemes are treated and compared from the aspects of quantum resource consumption, operation complexity, classical resource consumption, success probability and efficiency. It is found that the latter scheme is better than the former one. Particularly, the sharing can be achieved only probabilistically with the first scheme deterministically with the second one. (general)

Apparent partition coefficient in octanol-water and binding percentage to BSA of 153Sm(113,117Snm) complexes

International Nuclear Information System (INIS)

Yang Yuqing; Luo Shunzhong; Wang Guanquan; He Jiaheng; Bing Wenzeng; Pu Manfei; Wei Hongyuan; Wang Wenjin

2004-01-01

Apparent partition coefficient in octanol-water and binding percentage to BSA of 153 Sm-NTMP, 153 Sm-HEDTMP, 153 Sm-DCTMP, 153 Sm-EDTMP, 153 Sm-DTPMP, 113,117 Sn m -EDTMP, 113,117 Sn m -HEDTMP, 113,117 Sn m -DTPMP are measured. The results show that there is a linear relationship between the relative magnitude of the apparent partition coefficient in octanol-water and the relative magnitude of the binding percentage to BSA of these 153 Sm( 113,117 Sn m ) complexes. This linear relationship provides a new method for determination of the apparent partition coefficient in octanol-water of 153 Sm( 113,117 Sn m ) complexes of this kind. This linear relationship also implicates that hydrophobic force plays an important role in the binding of 153 Sm( 113,117 Sn m ) complexes to BSA

New special operators in W-gravity theories

International Nuclear Information System (INIS)

Rama, S.K.

1991-01-01

This paper reports on special physical operators of W 3 -gravity having non-trivial ghost sectors. Some of these operators may be viewed as the Liouville dressings of the energy operator of the Ising model coupled to two-dimensional (2D) gravity and this fills in the gap in the connection between pure W 3 -gravity and Ising model coupled to 2D gravity found in the authors' previous work. The authors formulate a selection rule required for the calculation of correlators in W-gravity theories. Using this rule, the authors construct the non-ghost part of the new operators of W N -gravity and find that they represent the (N,N + 1) minimal model operators from both inside and outside the minimal table. Along the way the authors obtain the canonical spectrum of W N -gravity for all N

Study of new 113mIn-BAT complexes for myocardial imaging agents

International Nuclear Information System (INIS)

Zhu Lin; Liu Boli; Kojima, M.

1991-01-01

Some new BAT derivatives are designed and synthesized in order to find some ideal myocardial imaging agents. These ligands form pentacoordinated complexes with indium cation. The structures of ligand BAT-TE and complexes In-BAT-TE and In-BAT-ETE are determined by X-ray crystallography at first. Biodistribution shows that the higher lipophilicity of complex induces apparently higher myocardial accumulation. Up to date, complex B is the best 113m In-labeled myocardial imaging agent. It is also suited to 111 In

STAR FORMATION ACROSS THE W3 COMPLEX

Energy Technology Data Exchange (ETDEWEB)

Román-Zúñiga, Carlos G.; Ybarra, Jason E.; Tapia, Mauricio [Instituto de Astronomía, Universidad Nacional Autónoma de México, Unidad Académica en Ensenada, Km 103 Carr. Tijuana–Ensenada, Ensenada 22860 (Mexico); Megías, Guillermo D. [Facultad de Física. Universidad de Sevilla. Dpto. Física Atómica, Molecular y Nuclear, Sevilla, E-41080 (Spain); Lada, Elizabeth A. [Astronomy Department, University of Florida, 211 Bryant Space Sciences Center, FL 32611 (United States); Alves, Joáo F. [Institute of Astronomy, University of Vienna, Türkenschanzstr. 17, A-1180 Vienna (Austria)

2015-09-15

We present a multi-wavelength analysis of the history of star formation in the W3 complex. Using deep, near-infrared ground-based images combined with images obtained with Spitzer and Chandra observatories, we identified and classified young embedded sources. We identified the principal clusters in the complex and determined their structure and extension. We constructed extinction-limited samples for five principal clusters and constructed K-band luminosity functions that we compare with those of artificial clusters with varying ages. This analysis provided mean ages and possible age spreads for the clusters. We found that IC 1795, the centermost cluster of the complex, still hosts a large fraction of young sources with circumstellar disks. This indicates that star formation was active in IC 1795 as recently as 2 Myr ago, simultaneous to the star-forming activity in the flanking embedded clusters, W3-Main and W3(OH). A comparison with carbon monoxide emission maps indicates strong velocity gradients in the gas clumps hosting W3-Main and W3(OH) and shows small receding clumps of gas at IC 1795, suggestive of rapid gas removal (faster than the T Tauri timescale) in the cluster-forming regions. We discuss one possible scenario for the progression of cluster formation in the W3 complex. We propose that early processes of gas collapse in the main structure of the complex could have defined the progression of cluster formation across the complex with relatively small age differences from one group to another. However, triggering effects could act as catalysts for enhanced efficiency of formation at a local level, in agreement with previous studies.

Differential operators and W-algebra

International Nuclear Information System (INIS)

Vaysburd, I.; Radul, A.

1992-01-01

The connection between W-algebras and the algebra of differential operators is conjectured. The bosonized representation of the differential operator algebra with c=-2n and all the subalgebras are examined. The degenerate representations and null-state classifications for c=-2 are presented. (orig.)

Test Results of a 200 W Class Hall Thruster

Science.gov (United States)

Jacobson, David; Jankovsky, Robert S.

1999-01-01

The performance of a 200 W class Hall thruster was evaluated. Performance measurements were taken at power levels between 90 W and 250 W. At the nominal 200 W design point, the measured thrust was 11.3 mN. and the specific impulse was 1170 s excluding cathode flow in the calculation. A laboratory model 3 mm diameter hollow cathode was used for all testing. The engine was operated on laboratory power supplies in addition to a breadboard power processing unit fabricated from commercially available DC to DC converters.

13 CFR 113.450 - Athletics.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Athletics. 113.450 Section 113.450 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE... female teams if a recipient operates or sponsors separate teams will not constitute noncompliance with...

21 CFR 111.113 - What quality control operations are required for a material review and disposition decision?

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false What quality control operations are required for a... Production and Process Control System: Requirements for Quality Control § 111.113 What quality control operations are required for a material review and disposition decision? (a) Quality control personnel must...

42 CFR 433.113 - Reduction of FFP for failure to operate a system and obtain initial approval.

Science.gov (United States)

2010-10-01

... 42 Public Health 4 2010-10-01 2010-10-01 false Reduction of FFP for failure to operate a system... ADMINISTRATION Mechanized Claims Processing and Information Retrieval Systems § 433.113 Reduction of FFP for failure to operate a system and obtain initial approval. (a) Except as waived under § 433.130 or 433.131...

SMA OBSERVATIONS OF THE W3(OH) COMPLEX: PHYSICAL AND CHEMICAL DIFFERENTIATION BETWEEN W3(H{sub 2}O) AND W3(OH)

Energy Technology Data Exchange (ETDEWEB)

Qin, Sheng-Li [Department of Astronomy, Yunnan University, and Key Laboratory of Astroparticle Physics of Yunnan Province, Kunming, 650091 (China); Schilke, Peter; Sánchez-Monge, Álvaro [Physikalisches Institut, Universität zu Köln, Zülpicher Str. 77, D-50937 Köln (Germany); Wu, Jingwen [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Wu, Yuefang [Department of Astronomy, Peking University, Beijing, 100871 (China); Liu, Tie [Korea Astronomy and Space Science Institute 776, Daedeokdaero, Yuseong-gu, Daejeon, Korea 305-348 (Korea, Republic of); Liu, Ying, E-mail: slqin@bao.ac.cn [Department of Physics and Hebei Advanced Thin Film Laboratory, Hebei Normal University, Shijiazhuang 050024 (China)

2015-04-10

We report on the Submillimeter Array (SMA) observations of molecular lines at 270 GHz toward the W3(OH) and W3(H{sub 2}O) complex. Although previous observations already resolved the W3(H{sub 2}O) into two or three sub-components, the physical and chemical properties of the two sources are not well constrained. Our SMA observations clearly resolved the W3(OH) and W3(H{sub 2}O) continuum cores. Taking advantage of the line fitting tool XCLASS, we identified and modeled a rich molecular spectrum in this complex, including multiple CH{sub 3}CN and CH{sub 3}OH transitions in both cores. HDO, C{sub 2}H{sub 5}CN, O{sup 13}CS, and vibrationally excited lines of HCN, CH{sub 3}CN, and CH{sub 3}OCHO were only detected in W3(H{sub 2}O). We calculate gas temperatures and column densities for both cores. The results show that W3(H{sub 2}O) has higher gas temperatures and larger column densities than W3(OH) as previously observed, suggesting physical and chemical differences between the two cores. We compare the molecular abundances in W3(H{sub 2}O) to those in the Sgr B2(N) hot core, the Orion KL hot core, and the Orion Compact Ridge, and discuss the chemical origin of specific species. An east–west velocity gradient is seen in W3(H{sub 2}O), and the extension is consistent with the bipolar outflow orientation traced by water masers and radio jets. A north–south velocity gradient across W3(OH) is also observed. However, with current observations we cannot be assured whether the velocity gradients are caused by rotation, outflow, or radial velocity differences of the sub-components of W3(OH)

Physical States and BRST Operators for Higher-spin $W$ Strings

OpenAIRE

Liu, Yu-Xiao; Wei, Shao-Wen; Zhang, Li-Jie; Ren, Ji-Rong

2008-01-01

In this paper, we mainly investigate the $W_{2,s}^{M}\\otimes W_{2,s}^{L}$ system, in which the matter and the Liouville subsystems generate $W_{2,s}^{M}$ and $W_{2,s}^L$ algebras respectively. We first give a brief discussion of the physical states for corresponding $W$ stings. The lower states are given by freezing the spin-2 and spin-$s$ currents. Then, introducing two pairs of ghost-like fields, we give the realizations of $W_{1,2,s}$ algebras. Based on these linear realizations, BRST oper...

Electron Temperatures in W51 Complex from High Resolution, Low ...

Indian Academy of Sciences (India)

2016-01-27

Jan 27, 2016 ... We have made continuum radio observations of these HII regions of the W51 complex at 240, 610, 1060 and 1400 MHz using GMRT with lower resolution (20'' × 15'') at the lowest frequency. The observed spectra of the prominent thermal subcomponents of W51 have been fitted to a free-free emission ...

On the origin of W-algebras

International Nuclear Information System (INIS)

Bilal, A.; Kogan, I.I.

1991-01-01

We show that the complex and projective structures on 2D Riemann surfaces are determined by the solutions to the linear differential equations obtained by the hamiltonian reduction of Sl(2,C) connections by the gauge parabolic subgroup. The compatibility of complex (μ) and projective (T) structures appears as the associated zero-curvature condition on the reduced symplectic manifold and is nothing but the conformal Ward identity. Generalizing this construction to the reduction of Sl(n,C) connections by the maximal parabolic gauge subgroup, we obtain generalized complex (μ,ρ,...) and projective (T,W,...) structures. From their compatibility conditions we explicitly obtain the Ward identities of W n -gravity and the operator product expansions of the W n -algebras. The associated linear differential equations (one of which involves the basic differential operator of the nth reduction of the KP hierarchy) allow for a geometric interpretation of the W-symmetries in terms of deformations of flag configurations in the jet bundle Γ (n-1) . We also show how to derive the W n -Ward identities from the quantization of the (2+1)-dimensional Chern-Simons theory. (orig.)

Necrotising fasciitis as atypical presentation of infection with emerging Neisseria meningitidis serogroup W (MenW) clonal complex 11, the Netherlands, March 2017

NARCIS (Netherlands)

Russcher, Anne; Fanoy, Ewout; van Olden, Ger D. J.; Graafland, Antonie D.; van der Ende, Arie; Knol, Mirjam J.

2017-01-01

In March 2017, a patient with necrotising fasciitis caused by Neisseria meningitidis serogroup W (MenW) clonal complex 11 was diagnosed in the Netherlands. Unusual and severe presentations of MenW infections are common in the current European epidemic. In the Netherlands, the incidence of MenW

Metathesis Polymerization Reactions Induced by the Bimetallic Complex (Ph4P2[W2(μ-Br3Br6

Directory of Open Access Journals (Sweden)

Despoina Chriti

2015-12-01

Full Text Available The reactivity of the bimetallic complex (Ph4P2[W2(μ-Br3Br6] ({W 2.5 W}7+, a′2e3 towards ring opening metathesis polymerization (ROMP of norbornene (NBE and some of its derivatives, as well as the mechanistically related metathesis polymerization of phenylacetylene (PA, is presented. Our results show that addition of a silver salt (AgBF4 is necessary for the activation of the ditungsten complex. Polymerization of PA proceeds smoothly in tetrahydrofuran (THF producing polyphenylacetylene (PPA in high yields. On the other hand, the ROMP of NBE and its derivatives is more efficient in CH2Cl2, providing high yields of polymers. 13C Cross Polarization Magic Angle Spinning (CPMAS spectra of insoluble polynorbornadiene (PNBD and polydicyclopentadiene (PDCPD revealed the operation of two mechanisms (metathetic and radical for cross-linking, with the metathesis pathway prevailing.

Physical states and BRST operators for higher-spin W strings

International Nuclear Information System (INIS)

Liu, Yu-Xiao; Wei, Shao-Wen; Ren, Ji-Rong; Zhang, Li-Jie

2009-01-01

In this paper, we mainly investigate the W 2,s M x W 2,s L system, in which the matter and the Liouville subsystems generate the W 2,s M and W 2,s L algebras, respectively. We first give a brief discussion of the physical states for the corresponding W strings. The lower states are given by freezing the spin-2 and spin-s currents. Then, introducing two pairs of ghost-like fields, we give the realizations of the W 1,2,s algebras. Based on these linear realizations, the BRST operators for the W 2,s algebras are obtained. Finally, we construct new BRST charges of the Liouville system for the W 2,s L strings at the specific values of the central charges c: c=-(22)/(5) for the W 2,3 L algebra, c=-24 for the W 2,4 L algebra and c=-2,-(286)/(3) for the W 2,6 L algebra, at which the corresponding W 2,s L algebras are singular. (orig.)

14 CFR 135.113 - Passenger occupancy of pilot seat.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Passenger occupancy of pilot seat. 135.113... Operations § 135.113 Passenger occupancy of pilot seat. No certificate holder may operate an aircraft type certificated after October 15, 1971, that has a passenger seating configuration, excluding any pilot seat, of...

49 CFR 199.113 - Employee assistance program.

Science.gov (United States)

2010-10-01

... TESTING Drug Testing § 199.113 Employee assistance program. (a) Each operator shall provide an employee assistance program (EAP) for its employees and supervisory personnel who will determine whether an employee... 49 Transportation 3 2010-10-01 2010-10-01 false Employee assistance program. 199.113 Section 199...

Operational stability of a compact 600-W KrF laser

International Nuclear Information System (INIS)

Borisov, V M; Vinokhodov, A Yu; Vodchits, V A; El'tsov, A V; Basting, D; Stamm, U; Voss, F

1998-01-01

The problem of the operational stability of a KrF laser with an average output power of at least 600 W was investigated. An experimental study was made of the dependences of the rms deviation σ of the output energy on the charging voltage, on the pulse repetition rate, and on the operating time. The value of σ varied from 1.2% to 6.0%, depending on the experimental conditions. For an average power of ∼ 600 W, the deviation σ did not exceed 3.2%. (lasers and amplifiers)

Summary of W7-AS results after 14 years of operation

International Nuclear Information System (INIS)

Jaenicke, R.

2003-01-01

The experiments on the Stellarator W7-AS ceased on July 31, 2002 according to schedule. W7-AS itself resulted out of replacing the torus vessel with helical windings of the classical stellarator W7-A by modular field coils and a new torus vessel. On W7-A ohmic heating was the only available heating method at the start of the experiments. The partial optimized stellarator W7-AS was designed for net current free operation and consequently equipped - from the very beginning - with powerful ECRH. The NBI heating system was upgraded several times, and heating by ICRH in 3D magnetic field configurations was demonstrated successfully. The paper summarises essential results obtained during 14 years of operation. Since W7-AS was a first step in the development of optimized stellarators, its main task was to verify the predictions of the optimization procedure applied to the design of the fully optimized W7-X by means of experiments as far as possible. And thus, W7-AS has clearly proven that it is possible - to produce magnetic flux surfaces of high quality with modular field coils - to reduce the Pfirsch-Schlueter currents - to predict neoclassical transport in 3D magnetic field configurations by the DKES code - to calculate the bootstrap current on the basis of neoclassical theory - to obtain high β-values without evident limitation by instabilities and - to use the island divertor as an effective divertor concept in 3D magnetic field configurations. Other highlights found more by chance during the operation of W7-AS are e.g. the discovery of high confinement regimes such as the first H-mode discharges in stellarators as well as discharges with transport barriers (ion and electron root) wherein maximum energy confinement times (more than 60 ms) and maximum ion (up to 1.7 keV) and electron temperatures (up to 6.8 keV) were obtained. For sufficiently low impurity levels, very high densities (up to 4.10 20 m -3 ) were accessible and limited by radiative collapse only. A

40 CFR 63.113 - Process vent provisions-reference control technology.

Science.gov (United States)

2010-07-01

... § 63.113 Process vent provisions—reference control technology. (a) The owner or operator of a Group 1... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Process vent provisions-reference control technology. 63.113 Section 63.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...

A 66pW Discontinuous Switch-Capacitor Energy Harvester for Self-Sustaining Sensor Applications.

Science.gov (United States)

Wu, Xiao; Shi, Yao; Jeloka, Supreet; Yang, Kaiyuan; Lee, Inhee; Sylvester, Dennis; Blaauw, David

2016-06-01

We present a discontinuous harvesting approach for switch capacitor DC-DC converters that enables ultra-low power energy harvesting. By slowly accumulating charge on an input capacitor and then transferring it to a battery in burst-mode, switching and leakage losses in the DC-DC converter can be optimally traded-off with the loss due to non-ideal MPPT operation. The harvester uses a 15pW mode controller, an automatic conversion ratio modulator, and a moving sum charge pump for low startup energy upon a mode switch. In 180nm CMOS, the harvester achieves >40% end-to-end efficiency from 113pW to 1.5μW with 66pW minimum input power, marking a >10× improvement over prior ultra-low power harvesters.

Project W-320, operational test procedure OTP-320-003 test report

International Nuclear Information System (INIS)

Bevins, R.R.

1998-01-01

This report documents and summarizes the results of OTP-320-003 Project W-320 Operational Testing of the WRSS Supernate Transfer System. Project W-320 Operational Test OTP-320-003 was performed to verify components of the Waste Retrieval Sluicing System (WRSS) supernate transfer system functioned as designed following construction completion and turnover to operations. All equipment operation was performed by Tank Farms Operations personnel following the operational test procedure and referenced operating procedures. Supernate Transfer line Flushing System Testing was completed over the course of approximately 4 weeks as tank farm conditions and configuration, equipment availability, and operations resources allowed. All testing was performed with the 702-AZ ventilation system and the 296-P-16 ventilation systems in operation. Test procedure OTP-320-003 required two revisions during testing to incorporate Procedure Changes Authorizations (PCAs) necessary to facilitate testing. Various sections of testing are documented on each procedure revision. The completed test procedure is included as Attachment A. Exception Reports generated during the course of testing are included as Attachment B

The VirtualwindoW for nuclear applications

Energy Technology Data Exchange (ETDEWEB)

Anderson, M.O.; McKay, M.D.; Willis, W.D.

1997-08-01

Throughout the Department of Energy (DOE) complex there are numerous facilities which were constructed to research and develop nuclear materials during the cold war era. As a result, there are now many facilities such as reactors which require dismantlement and clean up. Technological advances over the past 10 years have significantly increased the state of computers, electronics and automated machinery. Because of this rapid growth, the technology of robotics has played a key role in clean up and remote operations. While robotic systems which perform hazardous tasks are being advanced, the human interface has not. Only within the past few years has the human/machine interface been addressed. A growing concern with the rapid advances in technology is that the robotic systems will become so complex that operators will be overwhelmed by the complexity and number of controls. Thus there is an on going effort within the remote and teleoperated robotic field to develop better man-machine interfaces. The Department of Energy`s Idaho National Engineering Laboratory (INEL) has been researching methods to simplify this interface including telepresence techniques which are applicable to nuclear environments. Initial telepresence research conducted at the INEL developed a concept called the VirtualwindoW. This system minimizes the complexity of remote stereo viewing controls and provides the operator the `feel` of viewing the environment in a natural setting. The VirtualwindoW has shown that the man-machine interface can be simplified while increasing operator performance. This paper deals with the continuing research and development of the VirtualwindoW system to provide a standard camera interface. An application of the VirtualwindoW in the dismantlement of the Chicago Pile-Five (CP-5) reactor at Argonne National Laboratory-East is discussed.

The Virtualwindo W for nuclear applications

International Nuclear Information System (INIS)

Anderson, M.O.; McKay, M.D.; Willis, W.D.

1997-01-01

Throughout the Department of Energy (DOE) complex there are numerous facilities which were constructed to research and develop nuclear materials during the cold war era. As a result, there are now many facilities such as reactors which require dismantlement and clean up. Technological advances over the past 10 years have significantly increased the state of computers, electronics and automated machinery. Because of this rapid growth, the technology of robotics has played a key role in clean up and remote operations. While robotic systems which perform hazardous tasks are being advanced, the human interface has not. Only within the past few years has the human/machine interface been addressed. A growing concern with the rapid advances in technology is that the robotic systems will become so complex that operators will be overwhelmed by the complexity and number of controls. Thus there is an on going effort within the remote and teleoperated robotic field to develop better man-machine interfaces. The Department of Energy's Idaho National Engineering Laboratory (INEL) has been researching methods to simplify this interface including telepresence techniques which are applicable to nuclear environments. Initial telepresence research conducted at the INEL developed a concept called the VirtualwindoW. This system minimizes the complexity of remote stereo viewing controls and provides the operator the 'feel' of viewing the environment in a natural setting. The VirtualwindoW has shown that the man-machine interface can be simplified while increasing operator performance. This paper deals with the continuing research and development of the VirtualwindoW system to provide a standard camera interface. An application of the VirtualwindoW in the dismantlement of the Chicago Pile-Five (CP-5) reactor at Argonne National Laboratory-East is discussed

A Simplified Method for Laboratory Preparation of Organ Specific Indium 113m Compounds

Energy Technology Data Exchange (ETDEWEB)

Adatepe, M H; Potchen, E James [Washington University School of Medicine, St. Louis (United States)

1969-03-15

Generator systems producing short lived nuclides from longer lived parents have distinct clinical advantages. They are more economical, result in a lower radiation dose, and can make short lived scanning readily available even in areas remote from rapid radiopharmaceutical delivery services. The {sup 113}Sn-{sup 113m}In generator has the additional advantage that, as a transition metal, Indium can be readily complexed into organ specific preparations. 113Sn, a reactor produced nuclide with a 118 day half life, is absorbed on a zirconium or silica gel column. the generator is eluded with 5 to 8 ml of 0.05 N HCL solution at pH 1.3-1.4. The daughter nuclide, {sup 113m}In, has a half life of 1.7 hours and emits a 393 Kev monoenergetic gamma ray. Previous methods for labeling organ specific complexes with {sup 113m}In required terminal autoclaving before injection. With the recent introduction of sterile, apyrogenic {sup 113}Sn-{sup 113m}In generators, we have developed a simplified technique for the laboratory preparation of Indium labeled compounds. This method eliminates autoclaving and titration enabling us to pre-prepare organ specific complexes for blood pool, liver, spleen, brain, kidney and lung scanning.

Operational test report - Project W-320 cathodic protection systems

International Nuclear Information System (INIS)

Bowman, T.J.

1998-01-01

Washington Administrative Code (WAC) 173-303-640 specifies that corrosion protection must be designed into tank systems that treat or store dangerous wastes. Project W-320, Waste Retrieval Sluicing System (WRSS), utilizes underground encased waste transfer piping between tanks 241-C-106 and 241-AY-102. Corrosion protection is afforded to the encasements of the WRSS waste transfer piping through the application of earthen ionic currents onto the surface of the piping encasements. Cathodic protection is used in conjunction with the protective coatings that are applied upon the WRSS encasement piping. WRSS installed two new two rectifier systems (46 and 47) and modified one rectifier system (31). WAC 173-303-640 specifies that the proper operation of cathodic protection systems must be confirmed within six months after initial installation. The WRSS cathodic protection systems were energized to begin continuous operation on 5/5/98. Sixteen days after the initial steady-state start-up of the WRSS rectifier systems, the operational testing was accomplished with procedure OTP-320-006 Rev/Mod A-0. This operational test report documents the OTP-320-006 results and documents the results of configuration testing of integrated piping and rectifier systems associated with the W-320 cathodic protection systems

Radiological and chemical source terms for Solid Waste Operations Complex

International Nuclear Information System (INIS)

Boothe, G.F.

1994-01-01

The purpose of this document is to describe the radiological and chemical source terms for the major projects of the Solid Waste Operations Complex (SWOC), including Project W-112, Project W-133 and Project W-100 (WRAP 2A). For purposes of this document, the term ''source term'' means the design basis inventory. All of the SWOC source terms involve the estimation of the radiological and chemical contents of various waste packages from different waste streams, and the inventories of these packages within facilities or within a scope of operations. The composition of some of the waste is not known precisely; consequently, conservative assumptions were made to ensure that the source term represents a bounding case (i.e., it is expected that the source term would not be exceeded). As better information is obtained on the radiological and chemical contents of waste packages and more accurate facility specific models are developed, this document should be revised as appropriate. Radiological source terms are needed to perform shielding and external dose calculations, to estimate routine airborne releases, to perform release calculations and dose estimates for safety documentation, to calculate the maximum possible fire loss and specific source terms for individual fire areas, etc. Chemical source terms (i.e., inventories of combustible, flammable, explosive or hazardous chemicals) are used to determine combustible loading, fire protection requirements, personnel exposures to hazardous chemicals from routine and accident conditions, and a wide variety of other safety and environmental requirements

System Safety Program Plan for Project W-314, tank farm restoration and safe operations

International Nuclear Information System (INIS)

Boos, K.A.

1996-01-01

This System Safety Program Plan (SSPP) outlines the safety analysis strategy for project W-314, ''Tank Farm Restoration and Safe Operations.'' Project W-314 will provide capital improvements to Hanford's existing Tank Farm facilities, with particular emphasis on infrastructure systems supporting safe operation of the double-shell activities related to the project's conceptual Design Phase, but is planned to be updated and maintained as a ''living document'' throughout the life of the project to reflect the current safety analysis planning for the Tank Farm Restoration and Safe Operations upgrades. This approved W-314 SSPP provides the basis for preparation/approval of all safety analysis documentation needed to support the project

Quality control of the 113Sn-113mIn generator

International Nuclear Information System (INIS)

Morin Zorilla, J.; Olive, E.; Isaac, M.; Cruz, J.

1989-01-01

Methods for quality control of 113 Sn- 113m In generators are compared and recommended the most convenient to applicate in hospitals and in more specialized quality control laboratories. The quality of 113 Sn- 113m In generator produced by POLATOM (Poland) is also evaluated. The product met the requirements of the International Pharmacopeia

Preventive effects of the novel antimicrobial peptide Nal-P-113 in a rat Periodontitis model by limiting the growth of Porphyromonas gingivalis and modulating IL-1β and TNF-α production.

Science.gov (United States)

Wang, Hong-Yan; Lin, Li; Fu, Wei; Yu, Hui-Yuan; Yu, Ning; Tan, Li-Si; Cheng, Jya-Wei; Pan, Ya-Ping

2017-08-29

P-113 (AKRHHGYKRKFH-NH2) is a 12-amino-acid histidine-rich peptide derived from histatin 5 that is highly degradable in high salt concentrations and biological fluids such as serum, plasma and saliva. Nal-P-113, a novel antimicrobial peptide whose histidine residues are replaced by the bulky amino acids β-naphthylalanine, causes the antimicrobial peptide to retain its bactericidal activity even in physiological environments. This study evaluated the effect of the novel antimicrobial peptide Nal-P-113 in a rat periodontitis model and the mechanisms of action of Nal-P-113 for suppressing periodontitis. Periodontitis was induced in mandibular first molars in rats receiving a ligature and infected with Porphyromonas gingivalis. Animals were randomly divided into six groups: a, P. gingivalis W83 alone; b, P. gingivalis W83 with 6.25 μg/mL of Nal-P-113; c, P. gingivalis W83 with 25 μg/mL of Nal-P-113; d, P. gingivalis W83 with 100 μg/mL of Nal-P-113; e, P. gingivalis W83 with 400 μg/mL of Nal-P-113; and f, control without P. gingivalis W83 or Nal-P-113. Morphometric analysis was used to evaluate alveolar bone loss. Microbiological assessment of the presence of Porphyromonas gingivalis and total bacteria was performed using absolute quantitative real-time PCR and scanning electron microscopy. Gingival tissue was collected for western blot and immunohistochemical assays of IL-1β and TNF-α levels. Alveolar bone loss was inhibited by 100 μg/mL or 400 μg/mL of Nal-P-113 compared to the control group (P periodontal tissue (P periodontitis in rats by limiting the amount of bacteria and modulating IL-1β and TNF-α production. The use of Nal-P-113 in vivo might serve as a beneficial preventive or therapeutic approach for periodontitis.

2607-W6 sanitary drainfield replacement

International Nuclear Information System (INIS)

Simmons, F.M.

1994-05-01

The septic 2607-W6 which supports the 222-S complex is operating at 200% capacity. The septic tank has been inspected and found to be sound. Test hole excavations of the existing drainfield indicate that it is disposing of the current waste water effluent load as opposed to treating it. The system is over 40 years old and has not been approved by the Washington State Department of Health. Under the existing operating conditions it is subject to imminent failure. No additional tie-ins or increases in personnel are allowed which will increase the flow to the 2607-W6 system

Theoretical studies on the electronic and optoelectronic properties of [A.2AP(w)/A*.2AP(WC)/C.2AP(w)/C*.2AP(WC)/C.A(w)/C*.A(WC)]-Au8 mismatch nucleobase complexes

Science.gov (United States)

Srivastava, Ruby

2018-01-01

The electronic and optoelectronic properties of [A.2AP(w)/A*.2AP(WC)/C.2AP(w)/C*.2AP(WC)/C.A(w)/ C*.A(WC)]-Au8 metal-mismatch nucleobase complexes are investigated by means of density functional theory and time-dependent methods. We selected these mispairs as 2-aminopurine (2AP) produces incorporation errors when binding with cytosine (C) into the wobble (w) C.2AP(w) mispair, and is tautomerised into Watson-Crick (WC)-like base mispair C*.2AP(WC) and less effectively produces A.2AP(w)/A*.2AP(WC) mispairs. The vertical ionisation potential, vertical electron affinity, hardness and electrophilicity index of these complexes have also been discussed. The modifications of energy levels and charge density distributions of the frontier orbitals are also analysed. The absorption spectra of these complexes lie in the visible region, which suggests their application in fluorescent-bio imaging. The mechanism of cooperativity effect is studied by molecular orbital potential (MEP), atoms-in-molecules (AIM) and natural bond orbital analyses. Most metalated pairs have smaller HOMO-LUMO band gaps than the isolated mismatch nucleobases which suggest interesting consequences for electron transfer through DNA duplexes.

Ten years of cryo-magnetic W7-X test facility construction and operation

International Nuclear Information System (INIS)

Renard, B.; Dispau, G.; Donati, A.; Genini, L.; Gournay, J.F.; Kuster, O.; Molinie, F.; Schild, T.; Touzery, R.; Vieillard, L.; Walter, C.

2011-01-01

The construction, commissioning, and operation phases of the W7-X cryo-magnetic test facility in CEA Saclay lasted ten years. The large diversity of equipments called, specialties involved and problems solved attest the expertise that was required to operate the test facility and test the coils. Nearly one hundred cryogenic tests were performed on the seventy W7-X coils, at a rate always increasing, using two cryostats each holding two coils. This paper presents the test facility and its operation first, the cryogenic difficulties that were confronted with their solutions, the electro-magnetic difficulties encountered along with corrective actions, and finally the instrumentation and data acquisition aspects. (authors)

Identification of protein W, the elusive sixth subunit of the Rhodopseudomonas palustris reaction center-light harvesting 1 core complex.

Science.gov (United States)

Jackson, Philip J; Hitchcock, Andrew; Swainsbury, David J K; Qian, Pu; Martin, Elizabeth C; Farmer, David A; Dickman, Mark J; Canniffe, Daniel P; Hunter, C Neil

2018-02-01

The X-ray crystal structure of the Rhodopseudomonas (Rps.) palustris reaction center-light harvesting 1 (RC-LH1) core complex revealed the presence of a sixth protein component, variably referred to in the literature as helix W, subunit W or protein W. The position of this protein prevents closure of the LH1 ring, possibly to allow diffusion of ubiquinone/ubiquinol between the RC and the cytochrome bc 1 complex in analogous fashion to the well-studied PufX protein from Rhodobacter sphaeroides. The identity and function of helix W have remained unknown for over 13years; here we use a combination of biochemistry, mass spectrometry, molecular genetics and electron microscopy to identify this protein as RPA4402 in Rps. palustris CGA009. Protein W shares key conserved sequence features with PufX homologs, and although a deletion mutant was able to grow under photosynthetic conditions with no discernible phenotype, we show that a tagged version of protein W pulls down the RC-LH1 complex. Protein W is not encoded in the photosynthesis gene cluster and our data indicate that only approximately 10% of wild-type Rps. palustris core complexes contain this non-essential subunit; functional and evolutionary consequences of this observation are discussed. The ability to purify uniform RC-LH1 and RC-LH1-protein W preparations will also be beneficial for future structural studies of these bacterial core complexes. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

Analysis of the Response of a 600 kW Stall Controlled Wind Turbine in Complex Terrain

Energy Technology Data Exchange (ETDEWEB)

Cuerva, A.; Bercebal, D.; De la Cruz, S.; Lopez-Diez, S.; Lopez-Roque, V.; Vazquez-Aguado, A.; Marti, I.; Marchante, M.; Navarro, J. [CIEMAT. Madrid (Spain)

1998-12-31

This work presents a detailed analysis of the operating characteristics of a 600 kW rated power wind turbine installed in complex terrain. The description of the experimental set up and analysis system is included. The relationships between parameters that describe the wind turbine response and the environmental conditions are established via high level statistical analysis, fatigue analysis and analysis is the frequency domain. Dimensionless factors are calculated to explain the intrinsic response of the structure before stochastic and deterministic wind conditions, independently from its size and wind intensity. Finally, conclusions are presented regarding the parameters that affect the loading state and power production of the machine. (Author) 12 refs.

Analysis of the Response of a 600 kW Stall Controlled Wind Turbine in Complex Terrain

International Nuclear Information System (INIS)

Cuerva, A.; Bercebal, D.; De La Cruz, M.; Lopez-Diez, S.; Lopez-Roque, V.; Vazquez-Aguado, A.; Marti, I.; Marchante, M.; Navarro, J.

1998-01-01

This work presents a detailed analysis of the operating characteristics of a 600 kW rated power wind turbine installed in complex terrain. The description of the experimental set up and analysis system is included. The relationships between parameters that describe the wind turbine response and the environmental conditions are established via high level statistical analysis, fatigue analysis and analysis in the frequency domain. Dimension less factors are calculated to explain the intrinsic response of the structure before stochastic and deterministic wind conditions, independently from its size and wind intensity. Finally, conclusions are presented regarding the parameters that affect the loading state and power production of the machine. (Author) 12 refs

7 CFR 1463.113 - Issuance of payments in event of death.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Issuance of payments in event of death. 1463.113 Section 1463.113 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS 2005-2014 TOBACCO TRANSITION PROGRAM Tobacco Transition Payment Program ...

Physical properties of W gravities and W strings

International Nuclear Information System (INIS)

Das, S.R.; Dhar, A.; Rama, S.K.

1991-01-01

This paper investigates some basic physical properties of W gravities and W strings, using a free field realization. The authors argue that the configuration space of W gravities have global characteristics in addition to the Euler characteristic. The authors identify one such global quantity to be a monopole charge and show how this charge appears in the exponents. The free energy would then involve a θ parameter. Using a BRST procedure the authors find all the physical states of W 3 and W 4 gravities, and show that physical operators are nonsingular composites of the screening charge operators. (The latter are not physical operators for N ≥ 3.) For W strings we show how the W constraints lead to the emergence of a single (and not many) extra dimension coming from the W-gravity sector. By analyzing the resulting dispersion relations the authors find that both the lower and upper critical dimensions are lowered compared to ordinary two-dimensional gravity. The pure W gravity spectrum reveals an intriguing numerological connection with unitary minimal models coupled to ordinary gravity

The w-effect in interferometric imaging: from a fast sparse measurement operator to superresolution

Science.gov (United States)

Dabbech, A.; Wolz, L.; Pratley, L.; McEwen, J. D.; Wiaux, Y.

2017-11-01

Modern radio telescopes, such as the Square Kilometre Array, will probe the radio sky over large fields of view, which results in large w-modulations of the sky image. This effect complicates the relationship between the measured visibilities and the image under scrutiny. In algorithmic terms, it gives rise to massive memory and computational time requirements. Yet, it can be a blessing in terms of reconstruction quality of the sky image. In recent years, several works have shown that large w-modulations promote the spread spectrum effect. Within the compressive sensing framework, this effect increases the incoherence between the sensing basis and the sparsity basis of the signal to be recovered, leading to better estimation of the sky image. In this article, we revisit the w-projection approach using convex optimization in realistic settings, where the measurement operator couples the w-terms in Fourier and the de-gridding kernels. We provide sparse, thus fast, models of the Fourier part of the measurement operator through adaptive sparsification procedures. Consequently, memory requirements and computational cost are significantly alleviated at the expense of introducing errors on the radio interferometric data model. We present a first investigation of the impact of the sparse variants of the measurement operator on the image reconstruction quality. We finally analyse the interesting superresolution potential associated with the spread spectrum effect of the w-modulation, and showcase it through simulations. Our c++ code is available online on GitHub.

On W1+∞ 3-algebra and integrable system

Directory of Open Access Journals (Sweden)

Min-Ru Chen

2015-02-01

Full Text Available We construct the W1+∞ 3-algebra and investigate its connection with the integrable systems. Since the W1+∞ 3-algebra with a fixed generator W00 in the operator Nambu 3-bracket recovers the W1+∞ algebra, it is intrinsically related to the KP hierarchy. For the general case of the W1+∞ 3-algebra, we directly derive the KP and KdV equations from the Nambu–Poisson evolution equation with the different Hamiltonian pairs of the KP hierarchy. Due to the Nambu–Poisson evolution equation involves two Hamiltonians, the deep relationship between the Hamiltonian pairs of KP hierarchy is revealed. Furthermore we give a realization of the W1+∞ 3-algebra in terms of a complex bosonic field. Based on the Nambu 3-brackets of the complex bosonic field, we derive the (generalized nonlinear Schrödinger equation and give an application in optical soliton.

Operating test report for project W-417, T-plant steam removal upgrade, waste transfer portion

International Nuclear Information System (INIS)

Myers, N.K.

1997-01-01

This Operating Test Report (OTR) documents the performance results of the Operating Test Procedure HNF-SD-W417-OTP-001 that provides steps to test the waste transfer system installed in the 221-T Canyon under project W-417. Recent modifications have been performed on the T Plant Rail Car Waste Transfer System. This Operating Test Procedure (OTP) will document the satisfactory operation of the 221-T Rail Car Waste Transfer System modified by project W-417. Project W-417 installed a pump in Tank 5-7 to replace the steam jets used for transferring liquid waste. This testing is required to verify that operational requirements of the modified transfer system have been met. Figure 2 and 3 shows the new and existing system to be tested. The scope of this testing includes the submersible air driven pump operation in Tank 5-7, liquid waste transfer operation from Tank 5-7 to rail car (HO-IOH-3663 or HO-IOH-3664), associated line flushing, and the operation of the flow meter. This testing is designed to demonstrate the satisfactory operation-of the transfer line at normal operating conditions and proper functioning of instruments. Favorable results will support continued use of this system for liquid waste transfer. The Functional Design Criteria for this system requires a transfer flow rate of 40 gallons per minute (GPM). To establish these conditions the pump will be supplied up to 90 psi air pressure from the existing air system routed in the canyon. An air regulator valve will regulate the air pressure. Tank capacity and operating ranges are the following: Tank No. Capacity (gal) Operating Range (gal) 5-7 10,046 0 8040 (80%) Rail car (HO-IOH-3663 HO-IOH-3664) 097219,157 Existing Tank level instrumentation, rail car level detection, and pressure indicators will be utilized for acceptance/rejection Criteria. The flow meter will be verified for accuracy against the Tank 5-7 level indicator. The level indicator is accurate to within 2.2 %. This will be for information only

Complexity rating of abnormal events and operator performance

International Nuclear Information System (INIS)

Oeivind Braarud, Per

1998-01-01

The complexity of the work situation during abnormal situations is a major topic in a discussion of safety aspects of Nuclear Power plants. An understanding of complexity and its impact on operator performance in abnormal situations is important. One way to enhance understanding is to look at the dimensions that constitute complexity for NPP operators, and how those dimensions can be measured. A further step is to study how dimensions of complexity of the event are related to performance of operators. One aspect of complexity is the operator 's subjective experience of given difficulties of the event. Another related aspect of complexity is subject matter experts ratings of the complexity of the event. A definition and a measure of this part of complexity are being investigated at the OECD Halden Reactor Project in Norway. This paper focus on the results from a study of simulated scenarios carried out in the Halden Man-Machine Laboratory, which is a full scope PWR simulator. Six crews of two licensed operators each performed in 16 scenarios (simulated events). Before the experiment subject matter experts rated the complexity of the scenarios, using a Complexity Profiling Questionnaire. The Complexity Profiling Questionnaire contains eight previously identified dimensions associated with complexity. After completing the scenarios the operators received a questionnaire containing 39 questions about perceived complexity. This questionnaire was used for development of a measure of subjective complexity. The results from the study indicated that Process experts' rating of scenario complexity, using the Complexity Profiling Questionnaire, were able to predict crew performance quite well. The results further indicated that a measure of subjective complexity could be developed that was related to crew performance. Subjective complexity was found to be related to subjective work load. (author)

ICD Complex Operations and Maintenance Plan

Energy Technology Data Exchange (ETDEWEB)

Gibson, P. L.

2007-06-25

This Operations and Maintenance (O&M) Plan describes how the Idaho National Laboratory (INL) conducts operations, winterization, and startup of the Idaho CERCLA Disposal Facility (ICDF) Complex. The ICDF Complex is the centralized INL facility responsible for the receipt, storage, treatment (as necessary), and disposal of INL Comprehensive Environmental Response, Compensation and Liability Act (CERCLA) remediation waste.

Design, Construction and Operation of a Molten Carbonate Fuel Cell (MCFC) in the 100-kW-Class

International Nuclear Information System (INIS)

Heiming, Andreas; Huppmann, Gerhard; Aasberg-Petersen, Kim

1999-01-01

In fuel cells, the electrochemical energy of the fuel is converted directly into electricity and heat. The electrochemical conversion is inherently related to high electrical efficiencies and very low pollutant emissions. Fuel cells with sufficiently high operating temperatures such as (1) the phosphoric acid fuel cell (PAFC), operating temperature: 200 o C, (2) the molten carbonate fuel cell (MCFC), operating temperature: 650 o C and (3) the solid oxide fuel cell (SOFC), operating temperature: around 900 o C are best suited for decentralised combined heat and power (CHP) applications. This is due to the fact, that the heat of the exothermic reaction taking place in the fuel cell can be used in the domestic, commercial and industrial sector for heating and hot water or steam production. At the present time, gas-engines or gas-turbines are the preferred CHP-technologies for these applications. Nowadays, the PAFC is commercially available. More than 160 plants, each with a power of 200 kW, have been installed world-wide. Ruhrgas has investigated the behaviour of a 200 kW PAFC at its research centre in Dorsten, Germany, and at the site of a local utility. High temperature fuel cells such as MCFC or SOFC promise electrical efficiencies above 50 % in simple cycle mode. Up to now, MCFC-test plants have been built and operated in the 100 kW to 1 MW power range. The largest MCFC ever operated consisted of 16 identical stacks of 125 kW each, resulting in a plant power of 2 MW. The initial experience with SOFC in this power-range is currently gained from the operation of a 100 kW plant. In this paper, the result of the construction and operation of a highly innovatively designed 280 kW MCFC will be presented. This plant has been designed, built and operated by a European consortium for the development and market introduction of the MCFC. Members of the consortium are MTU-Friedrichshafen GmbH, Haldor Topsoee NS, Elkraft A.m.b.H., RWE Energie AG and Ruhrgas AG. (author)

13 CFR 113.310 - Recruitment.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.310 Section 113... Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 113.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 113.300 through 113.310 apply shall not discriminate on the...

study on 113 Sn-113m In generator of the chromatographic column elution mode

International Nuclear Information System (INIS)

Abdel-Halim, A.A.

2002-01-01

this work has been carried out to study the optimum conditions required for local preparation of 113 Sn- 113m In radioisotope generator based on 12- molybdocerate- 113 Sn column matrix. this work was directed to: 1- investigate the optimum conditions of the tin target irradiation and dissolution processes. 2- study the different preparative conditions which affect the loading of 113 Sn radionuclide onto 12- molybdocerate (IV) columns and the elution of the generated 113m In radionuclide. 3- study the effect of generator life- time on the elution performance and quality control of the generated 113m In radionuclide over a period of 190 days

Effect of complexing agents and pH on microstructure and tribological properties of Co-W coatings produced by double pulse electrodeposition

International Nuclear Information System (INIS)

Su Fenghua; Liu Cansen; Huang Ping

2012-01-01

The Co-W coatings were produced by double pulse electrodeposition from aqueous bath with cobalt sulphate and sodium tungstate. Effect of complexing agent and pH value in the plating bath on the microstructure, morphology and hardness of the electrodeposited Co-W coatings were investigated using an X-ray diffraction (XRD), scanning electron microscope (SEM) and a Vickers hardness tester, respectively. The friction and wear properties of the Co-W coatings deposited from different baths were evaluated with a ball-on-disk UMT-3MT tribometer. The correlation among the electrodepositing condition that varied with the complexing agent or pH value, the microstructure and the tribological properties of the deposited Co-W coatings were discussed. The results show that the complexing agent and pH value significantly affect the microstructure and tribological properties of the electrodeposited Co-W coatings. The sodium citrate is the best complexing agent to improve the tribological properties of the electrodeposited Co-W coatings at pH 6.0, followed by the sodium gluconate. The Co-W coatings electrodeposited from the near neutral bath can obtain better tribological properties than those deposited from strong acid or strong alkaline bath. The differences of the tribological properties for Co-W coatings from different baths were attributed to their different hardness, crystal structure and morphological characterizations, which can be optimized by the electrodepositing condition, i.e., the complexing agent and pH value in bath.

Addressing chronic operational issues at the W. M. Keck Observatory

Science.gov (United States)

Nordin, Tom; Matsuda, Richard

2016-07-01

The W. M. Keck Observatory (WMKO) has a good track record at addressing large critical faults which impact observing. Our performance tracking and correcting chronic minor faults has been mixed, yet this class of problems has a significant negative impact on scientific productivity and staff effectiveness. We have taken steps to address this shortcoming. This paper outlines the creation of a program to identify, categorize and rank these chronic operational issues, track them over time, and develop management options for their resolution. The success of the program at identifying these chronic operational issues and the advantages of dedicating observatory resources to this endeavor are presented.

Intrinsic gas-phase reactivity toward methanol of trinuclear tungsten W(3)S(4) complexes bearing W-X (X = Br, OH) groups.

Science.gov (United States)

Vicent, Cristian; Feliz, Marta; Llusar, Rosa

2008-12-11

Electrospray ionization (ESI) tandem mass spectrometry is used to investigate the gas-phase dissociation of trinuclear sulfide W(3)S(4) complexes containing three diphosphane ligands and three terminal bromine atoms, namely, [W(3)S(4)(dmpe)(3)(Br)(3)](+) (1(+)) or hydroxo groups, [W(3)S(4)(dmpe)(3)(OH)(3)](+) (2(+)) (dmpe = 1,2-bis(dimethylphosphanyl)ethane). Sequential evaporation of two diphosphane ligands is the sole fragmentation channel for the 1(+) cation that yields product ions with one or two unsaturated W-Br functional groups, respectively. Conversely, evaporation of one diphosphane ligand followed by two water molecules is observed for cation 2(+). Complementary deuterium-labeling experiments in conjunction with computational studies provide deep insight into the thermodynamically favored product ion structures found along the fragmentation pathways. From these results, the formation of a series of cluster cations with WBr, WOH, and WO functional groups either on saturated or unsaturated metal sites is proposed. The effect of the properties of these cluster cations, among them chemical composition and coordinative saturation, on their reactivity toward methanol is discussed.

47 CFR 15.113 - Power line carrier systems.

Science.gov (United States)

2010-10-01

....113 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL RADIO FREQUENCY DEVICES Unintentional... shall submit the details of all existing systems plus any proposed new systems or changes to existing... operation on electric lines which connect the distribution substation to the customer or house wiring. Such...

Gas-phase chemistry of Mo, Ru, W, and Os metal carbonyl complexes

International Nuclear Information System (INIS)

Wang, Y.; Qin, Z.; Fan, F.L.

2014-01-01

Metal carbonyl complexes were used for studying the gas-phase chemical behavior of Mo, Ru, W and Os isotopes with an on-line low temperature isothermal gas chromatography apparatus. Short-lived Mo and Ru isotopes were produced by a 252 Cf spontaneous fission source. Short-lived nuclides of W and Os were produced using the heavy ion reactions 19 F + 159 Tb and 165 Ho, respectively. Short-lived products were thermalized in a recoil chamber filled with a gas mixture of helium and carbon monoxide. The carbonyls formed were then transported through capillaries to an isothermal chromatography column for study of the adsorption behavior as a function of temperature. On-line isothermal chromatography (IC) experiments on Teflon (PTFE) and quartz surfaces showed that short-lived isotopes of the listed elements can form carbonyl complexes which are very volatile and interact most likely in physical sorption processes. Deduced adsorption enthalpies of Mo and Ru carbonyls were -38 ± 2 kJ/mol and -36 ± 2 kJ/mol, respectively. These values are in good agreement with literature data, partly obtained with different chromatographic techniques. A validation of the applied Monte Carlo model to deduce adsorption enthalpies with Mo isotopes of different half-lives proved the validity of the underlying adsorption model. The investigations using a gas-jet system coupled to a heavy ion accelerator without any preseparator clearly showed the limitations of the approach. The He and CO gas mixture, which was directly added into the chamber, will result in decomposition of CO gas and produce some aerosol particles. After the experiment of 173 W and 179 Os in the heavy ion experiments, the Teflon column was covered by a yellowish deposit; the adsorption enthalpy of W and Os carbonyls could therefore not be properly deduced using Monte Carlo simulations. (orig.)

First 200 kW CW operation of a 60 GHz gyrotron

International Nuclear Information System (INIS)

Jory, H.; Bier, R.; Evans, S.; Felch, K.; Fox, L.; Huey, H.; Shively, J.; Spang, S.

1983-01-01

The gyrotron is a microwave tube which employs the electron cyclotron maser interaction to produce high power output at millimeter wavelengths. It has important and growing applications for heating of plasmas in controlled thermonuclear fusion experiments. The Varian 60 GHz gyrotron has recently generated microwave power in excess of 200 kW during CW operation, wth excellent dynamic range and operating stability. This is the highest average power ever produced by a microwave tube in the millimeter wave region. A description of the gyrotron design and test results are presented

Holistyczne kompetencje zawodowe studentów pielęgniarskich studiów magisterskich = The holistic nursing professional competence of students graduate

OpenAIRE

Brodowicz-Król, Magdalena; Zarzycka, Danuta; Stadnicka, Sabina; Bartoń, Elżbieta

2016-01-01

Brodowicz-Król Magdalena, Zarzycka Danuta, Stadnicka Sabina, Bartoń Elżbieta. Holistyczne kompetencje zawodowe studentów pielęgniarskich studiów magisterskich = The holistic nursing professional competence of students graduate. Journal of Education, Health and Sport. 2016;6(8):113-127. eISSN 2391-8306. DOI http://dx.doi.org/10.5281/zenodo.59880 http://ojs.ukw.edu.pl/index.php/johs/article/view/3736 The journal has had 7 points in Ministry of Science and Higher Educat...

Transient heat transfer phenomena of the liquid metal layer cooled by overlying R113 coolant

International Nuclear Information System (INIS)

Cho, J. S.; Seo, K. R.; Jung, C. H.; Park, R. J.; Kim, S. B.

1999-01-01

To understand the fundamental relationship of the natural convection heat transfer in the molten metal pool and the boiling mechanism of the overlying coolant, experiments were performed for the transient heat transfer of the liquid metal pool with overlying R113 coolant with boiling. The simulant molten pool material is tin (Sn) with the melting temperature of 232 deg C. The metal pool is heated from the bottom surface and the coolant is injected onto the molten metal pool. Tests were conducted by changing the bottom surface boundary condition. The bottom heating condition was varied from 8kW to 14kW. As a result the boiling mechanism of the R113 coolant is changed from the nuclear boiling to film boiling. The Nusselt number and the Rayleigh number in the molten metal pool region obtained as functions of time. Analysis was made for the relationship between the heat flux and the temperature difference of the metal layer surface temperature and the boiling coolant bulk temperature

The Lax operator approach for the Virasoro and the W-constraints in the generalized KdV hierarchy

International Nuclear Information System (INIS)

Panda, S.; Roy, S.

1992-08-01

We show directly in the Lax operator approach how the Virasoro and W-constraints on the τ-function arise in the p-reduced KP hierarchy or Generalized KdV hierarchy. In particular, we consider the KdV and the Boussinesq hierarchy to show that the Virasoro and the W-constraints follow from the string equation by expanding the ''additional symmetry'' operator in terms of the Lax operator. We also mention how this method could be generalized for higher KdV hierarchies. (author). 34 refs

Supplement to safety analysis report. 306-W building operations safety requirement

International Nuclear Information System (INIS)

Richey, C.R.

1979-08-01

The operations safety requirements (OSRs) presented in this report define the conditions, safe boundaries, and management control needed for safely conducting operations with radioactive materials in the Pacific Northwest Laboratory (PNL) 306-W building. The safety requirements are organized in five sections. Safety limits are safety-related process variables that are observable and measurable. Limiting conditions cover: equipment and technical conditions and characteristics of the facility and operations necessary for continued safe operation. Surveillance requirements prescribe the requirements for checking systems and components that are essential to safety. Equipment design controls require that changes to process equipment and systems be independently checked and approved to assure that the changes will have no adverse effect on safety. Administrative controls describe and discuss the organization and administrative systems and procedures to be used for safe operation of the facility. Details of the implementation of the operations safety requirements are prescribed by internal PNL documents such as criticality safety specifications and radiation work procedures

Inhibitors of the alpha-ketoglutarate dehydrogenase complex alter [1-13C]glucose and [U-13C]glutamate metabolism in cerebellar granule neurons.

Science.gov (United States)

Santos, Sónia Sá; Gibson, Gary E; Cooper, Arthur J L; Denton, Travis T; Thompson, Charles M; Bunik, Victoria I; Alves, Paula M; Sonnewald, Ursula

2006-02-15

Diminished activity of the alpha-ketoglutarate dehydrogenase complex (KGDHC), an important component of the tricarboxylic acid (TCA) cycle, occurs in several neurological diseases. The effect of specific KGDHC inhibitors [phosphonoethyl ester of succinyl phosphonate (PESP) and the carboxy ethyl ester of succinyl phosphonate (CESP)] on [1-13C]glucose and [U-13C]glutamate metabolism in intact cerebellar granule neurons was investigated. Both inhibitors decreased formation of [4-13C]glutamate from [1-13C]glucose, a reduction in label in glutamate derived from [1-13C]glucose/[U-13C]glutamate through a second turn of the TCA cycle and a decline in the amounts of gamma-aminobutyric acid (GABA), aspartate, and alanine. PESP decreased formation of [U-13C]aspartate and total glutathione, whereas CESP decreased concentrations of valine and leucine. The findings are consistent with decreased KGDHC activity; increased alpha-ketoglutarate formation; increased transamination of alpha-ketoglutarate with valine, leucine, and GABA; and new equilibrium position of the aspartate aminotransferase reaction. Overall, the findings also suggest that some carbon derived from alpha-ketoglutarate may bypass the block in the TCA cycle at KGDHC by means of the GABA shunt and/or conversion of valine to succinate. The results suggest the potential of succinyl phosphonate esters for modeling the biochemical and pathophysiological consequences of reduced KGDHC activity in brain diseases.

20 CFR 726.113 - Disclosure of confidential information.

Science.gov (United States)

2010-04-01

... MINE OPERATOR'S INSURANCE Authorization of Self-Insurers § 726.113 Disclosure of confidential... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Disclosure of confidential information. 726... authorized self-insurer or applicant for the authorization of self-insurance obtained by the Office shall be...

7 CFR 1421.113 - Recourse marketing assistance loans.

Science.gov (United States)

2010-01-01

... assistance loan collateral may not be delivered or forfeited to CCC in satisfaction of the loan indebtedness... 7 Agriculture 10 2010-01-01 2010-01-01 false Recourse marketing assistance loans. 1421.113 Section... CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS GRAINS AND SIMILARLY HANDLED...

Crystal structure of (OC5W(μ-dppeW(CO5

Directory of Open Access Journals (Sweden)

Hannah F. Drake

2016-10-01

Full Text Available The centrosymmetric title complex, [μ-ethane-1,2-diylbis(diphenylphosphane-κ2P:P′]bis[pentacarbonyltungsten(0], [W2(C26H24P2(CO10], consists of two W(CO5 moieties bridged by a bis(diphenylphosphanylethane (dppe ligand. The W0 atom has a slightly distorted octahedral coordination environment consisting of 5 carbonyl ligands and one P atom from the bridging dppe ligand with the nearest W0 atom 5.625 (5 Å away. The complex resides on a center of symmetry.

Physical states and scaling properties of W gravities and W strings

International Nuclear Information System (INIS)

Das, S.R.; Dhar, A.; Rama, S.K.

1992-01-01

In this paper the authors discuss some physical aspects of W gravities and W strings. The authors identify global characteristics in W gravities (in addition to the usual Euler characteristic) and show how the dependence of the partition function on the various chemical potentials involves these quantities. The authors find the operators which create physical states in W 3 and W 4 gravities and discuss their relationship with screening operators. W strings are discussed in the framework of a natural way of coupling matter to W gravity, and the issues of extra dimensions and critical dimensions are clarified. The authors find a remarkable relationship between pure W gravities and ordinary gravity coupled to c < 1 unitary minimal models

Reliability Analysis of Drilling Operation in Open Pit Mines / Analiza niezawodności urządzeń wiertniczych wykorzystywanych w kopalniach odkrywkowych

Science.gov (United States)

Rahimdel, M. J.; Ataei, M.; Kakaei, R.; Hoseinie, S. H.

2013-06-01

Considering the high investment and operation costs, reliability analysis of mining machineries is essential to achieve a lean operation and to prevent the unwanted stoppages. In open pit mining, drilling, as the initial stage of the exploitation operations, has a significant role in the other stages. Failure of drilling machines causes total delay in blasting operation. In this paper, the reliability of drilling operation has been analyzed using the Markov method. The failure and operation data of four heavy rotary drilling machines in Sarcheshme copper mine in Iran have been used as a case study. Failure rate and repair rate of all machines have been calculated using available data. Then, 16 possible operation states have been defined and the probability of being of drilling fleet in each of the states was calculated using Markov theory. The results showed that there was 77.2% probability that all machines in fleet were in operational condition. It means that, considering 360 working days per year, drilling operation will be in a reliable condition in 277.92 days. Biorąc pod uwagę wysokość kosztów inwestycyjnych a także eksploatacyjnych, przeprowadzenie analizy niezawodności maszyn i urządzeń górniczych jest sprawą kluczową dla zapewnienia sprawnego działania i dla wyeliminowania niepożądanych przestojów. W kopalniach odkrywkowych prace wiertnicze prowadzone w początkowych etapach eksploatacji mają ogromne znaczenie również w późniejszych fazach działalności przedsięwzięcia. Awaria urządzeń wiertniczych powoduje opóźnienia przy pracach strzałowych. W pracy tej przeanalizowano niezawodność urządzeń wiertniczych w oparciu o metodę Markowa. Jako studium przypadku wykorzystano dane zebrane w trakcie eksploatacji i awarii czterech obrotowych urządzeń wiertniczych wykorzystywanych w kopalni rud miedzi Sarcheshme w Iranie. Awaryjność maszyn i zakres oraz częstość napraw obliczono na podstawie dostępnych danych. Zdefiniowano 16

Optimal reducibility of all W states equivalent under stochastic local operations and classical communication

Energy Technology Data Exchange (ETDEWEB)

Rana, Swapan; Parashar, Preeti [Physics and Applied Mathematics Unit, Indian Statistical Institute, 203 BT Road, Kolkata (India)

2011-11-15

We show that all multipartite pure states that are stochastic local operation and classical communication (SLOCC) equivalent to the N-qubit W state can be uniquely determined (among arbitrary states) from their bipartite marginals. We also prove that only (N-1) of the bipartite marginals are sufficient and that this is also the optimal number. Thus, contrary to the Greenberger-Horne-Zeilinger (GHZ) class, W-type states preserve their reducibility under SLOCC. We also study the optimal reducibility of some larger classes of states. The generic Dicke states |GD{sub N}{sup l}> are shown to be optimally determined by their (l+1)-partite marginals. The class of ''G'' states (superposition of W and W) are shown to be optimally determined by just two (N-2)-partite marginals.

Operational test report for 2706-T complex liquid transfer system

International Nuclear Information System (INIS)

BENZEL, H.R.

1999-01-01

This document is the Operational Test Report (OTR). It enters the Record Copy of the W-259 Operational Test Procedure (HNF-3610) into the document retrieval system. Additionally, the OTR summarizes significant issues associated with testing the 2706-T waste liquid transfer and storage system

A 9.61-W, b-cut Tm,Ho:YAP laser in Q-switched mode operation

Science.gov (United States)

Li, Guoxing; Yang, Xining; Zhang, Ziqiu; Zhang, Hongda; Zhang, Liang

2018-02-01

A high energy of b-cut Tm, Ho:YAlO3 laser is reported in the paper. The laser operated in acousto-optical Qswitched mode at 2.12 μm. The output average power of 9.61 W was achieved at the pulse repetition frequency of 10 kHz ,and the power of 11.6 W was acquired in continuous wave mode. Moreover, the energy per pulse of 0.961 mJ in 64.4 ns was acquired at 10 kHz with a 14.92-kW peak power.

7 CFR 1220.113 - Marketing.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Marketing. 1220.113 Section 1220.113 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.113 Marketing. The term...

32 CFR 724.113 - Application.

Science.gov (United States)

2010-07-01

... 32 National Defense 5 2010-07-01 2010-07-01 false Application. 724.113 Section 724.113 National... Definitions § 724.113 Application. In the context of this Manual, a written application to the NDRB for the... must be used for the application. ...

42 CFR 66.113 - Publications.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Publications. 66.113 Section 66.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES FELLOWSHIPS, INTERNSHIPS, TRAINING NATIONAL RESEARCH SERVICE AWARDS Direct Awards § 66.113 Publications. Publication, distribution, and...

28 CFR 551.113 - Counseling.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Counseling. 551.113 Section 551.113... Pretrial Inmates § 551.113 Counseling. (a) When consistent with institution security and good order, pretrial inmates may be allowed the opportunity to receive counseling services with convicted inmates. (b...

21 CFR 113.60 - Containers.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Containers. 113.60 Section 113.60 Food and Drugs... CONSUMPTION THERMALLY PROCESSED LOW-ACID FOODS PACKAGED IN HERMETICALLY SEALED CONTAINERS Control of Components, Food Product Containers, Closures, and In-Process Materials § 113.60 Containers. (a) Closures...

Localization of the placenta on gamma chamber with 113m In-lambratene

International Nuclear Information System (INIS)

Shejretova, E.; Blazheva, P.; Kovacheva, S.; Tsanev, Ts.

1977-01-01

The authors describe their experience in applying the radioisotopic method for localization of the placenta on gamma chamber by means of 113m In-lambratene (113m In-cysteamine). This complex is chosen due to its valuable physical characteristics of 113m In as shortliving, with whom lambratene is labelled, with proven irradiation protective properties, with the purpose of lowering irradiation load of the fetus. The authors use unique apparatus, gamma chamber Pho-Gamma HP and conventional scanner during injection of 2 mCi 113m In-lambratene. The authors examined 81 women, 42 of whom were pregnant at 6 to 10 months of gestation and 39 women from the third to the fifth month of gestation because of bleedings, Rh isoimmunization with forthcoming amniocentesis, and state after cesarian section for the first group and impending interruption of pregnancy for the second group. The diagnosis of the placenta localization was supported by cesarian section, delivery and interruption of pregnancy. There was 100% coincidence of the diagnosis. (author)

13 CFR 113.405 - Housing.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Housing. 113.405 Section 113.405... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.405 Housing. (a... different fees or requirements, or offer different services or benefits related to housing, except as...

13 CFR 113.500 - Employment.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Employment. 113.500 Section 113... Discrimination on the Basis of Sex in Employment in Education Programs Or Activities Prohibited § 113.500 Employment. (a) General. (1) No person shall, on the basis of sex, be excluded from participation in, be...

DEAD-box helicase DDX27 regulates 3′ end formation of ribosomal 47S RNA and stably associates with the PeBoW-complex

Energy Technology Data Exchange (ETDEWEB)

Kellner, Markus; Rohrmoser, Michaela [Department of Molecular Epigenetics, Helmholtz Center Munich, Center for Integrated Protein Science Munich (CIPSM), Marchioninistr. 25, Munich 81377 (Germany); Forné, Ignasi [Adolf Butenandt Institute, Ludwig Maximilians University of Munich, Center for Integrated Protein Science Munich (CIPSM), Schillerstr. 44, Munich 80336 (Germany); Voss, Kirsten; Burger, Kaspar; Mühl, Bastian; Gruber-Eber, Anita [Department of Molecular Epigenetics, Helmholtz Center Munich, Center for Integrated Protein Science Munich (CIPSM), Marchioninistr. 25, Munich 81377 (Germany); Kremmer, Elisabeth [Institute of Molecular Immunology, Helmholtz Center Munich, Marchioninistr. 25, Munich 81377 (Germany); Imhof, Axel [Adolf Butenandt Institute, Ludwig Maximilians University of Munich, Center for Integrated Protein Science Munich (CIPSM), Schillerstr. 44, Munich 80336 (Germany); Eick, Dirk, E-mail: eick@helmholtz-muenchen.de [Department of Molecular Epigenetics, Helmholtz Center Munich, Center for Integrated Protein Science Munich (CIPSM), Marchioninistr. 25, Munich 81377 (Germany)

2015-05-15

PeBoW, a trimeric complex consisting of pescadillo (Pes1), block of proliferation (Bop1), and the WD repeat protein 12 (WDR12), is essential for processing and maturation of mammalian 5.8S and 28S ribosomal RNAs. Applying a mass spectrometric analysis, we identified the DEAD-box helicase DDX27 as stably associated factor of the PeBoW-complex. DDX27 interacts with the PeBoW-complex via an evolutionary conserved F×F motif in the N-terminal domain and is recruited to the nucleolus via its basic C-terminal domain. This recruitment is RNA-dependent and occurs independently of the PeBoW-complex. Interestingly, knockdown of DDX27, but not of Pes1, induces the accumulation of an extended form of the primary 47S rRNA. We conclude that DDX27 can interact specifically with the Pes1 and Bop1 but fulfils critical function(s) for proper 3′ end formation of 47S rRNA independently of the PeBoW-complex. - Highlights: • DEAD-box helicase DDX27 is a new constituent of the PeBoW-complex. • The N-terminal F×F motif of DDX27 interacts with the PeBoW components Pes1 and Bop1. • Nucleolar anchoring of DDX27 via its basic C-terminal domain is RNA dependent. • Knockdown of DDX27 induces a specific defect in 3′ end formation of 47S rRNA.

21 CFR 163.113 - Cocoa.

Science.gov (United States)

2010-04-01

... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a) Description. Cocoa is the food that conforms to the definition and standard of identity, and is subject to the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cocoa. 163.113 Section 163.113 Food and Drugs FOOD...

23 CFR 660.113 - Construction.

Science.gov (United States)

2010-04-01

... 23 Highways 1 2010-04-01 2010-04-01 false Construction. 660.113 Section 660.113 Highways FEDERAL... (DIRECT FEDERAL) Forest Highways § 660.113 Construction. (a) No construction shall be undertaken on any FH... construction of FHs will be performed by the contract method, unless construction by the FHWA, the FS, or a...

Design and operational experience and testing of 50 kW/120 kHz oscillator for 3 MeV, 30 kW DC accelerator

International Nuclear Information System (INIS)

Srivastava, S.K.; Bakhtsingh, R.I.; Saroj, P.C.

2011-01-01

A 3 MeV, 30 kW dc industrial electron beam Accelerator is being developed at EBC, Kharghar, Navi Mumbai. The 3 MV dc is generated by parallel coupled voltage multiplier operating at 120 kHz. This requires an input voltage of 150 kV-0-150 kV at 120 kHz. This is achieved by 50 kW/120 kHz power oscillator in conjunction with a tuned air-core step-up transformer. Input primary voltage of 6 kV-0-6 kV at 120 kHz is generated by an oscillator using BW1121J2 water cooled triodes in push-pull Colpitts configuration. The tank circuit for the oscillator is formed by the secondary winding inductance of the step-up transformer and capacitance formed by RF feeder electrodes of the voltage multiplier column. Grid feedback for the oscillator is derived by arranging a set of electrodes in the feeder assembly in a capacitive divider configuration. The oscillator is operated in class-C mode with grid leak bias for better efficiency which also has the advantages of self-adjustment with varying load conditions. High power test has been conducted in a simulated test set-up on dummy load up to 30kW. Subsequently, the power oscillator has been tested with HV multiplier at 1MeV level satisfactorily. This paper describes the design, test results and operational experiences of the oscillator. (author)

111In,113In-labelled platelets. I

International Nuclear Information System (INIS)

Komarek, P.; Poledne, R.; Charvat, J.; Konopkova, M.; Komarkova, I.

1983-01-01

111 In-8-hydroxyquinoline (oxine) is used for labelling blood platelets which serves diagnostic purposes in medicine. For the preparation of the complex of radioactive indium with oxine, 111 In and sup(113m)In were used under optimal conditions. Two different preparation methods for the labelled complex are described. Both methods studied the effect of pH, the amount of chelate agents and the mode of filtration on the yields of the labelled oxine. The blood platelets labelling is influenced not only by the quality of labelled oxine but also by their number. The organ distribution in laboratory animals proved that platelets were not impaired during separation and labelling and that they were suitable for diagnostic use. (author)

An automated system for selective fission product separations; decays of 113-115Pd

International Nuclear Information System (INIS)

Meikrantz, D.H.; Gehrke, R.J.; McIsaac, L.D.; Baker, J.D.; Greenwood, R.C.

1981-01-01

A microcomputer controlled radiochemical separation system has been developed for the isolation and study of fission products with half-lives of approx. >= 10 s. The system is based upon solvent extraction with three centrifugal contactors coupled in series, which provides both rapid and highly efficient separations with large decontamination factors. This automated system was utilized to study the radioactive decays of 113-115 Pd via solvent extraction of the Pd-dimethylglyoxime complex from 252 Cf fission products. As a result of this effort, γ-rays associated with the decay of approx. equal to 90-s sup(113,113m)Pd, 149-s 114 Pd and 47-s 115 Pd have been identified. The isotopic assignments to each of these Pd radioactivities have been confirmed from observation of the growth and decay curves of their respective Ag daughters. In addition, previously unreported Ag γ-rays have been assigned; one to the decay of 69-s 113 Ag, and two to the decay of 19-s 115 Ag. (orig.)

Operational Shock Complexity Theory

Science.gov (United States)

2005-05-26

Theory : Recommendations For The National Strategy To Defeat Terrorism.” Student Issue Paper, Center for Strategic Leadership , US Army War College, July...Lens of Complexity Theory : Recommendations For The National Strategy To Defeat Terrorism.” (Student Issue Paper, Center for Strategic Leadership , US...planners managed to cause confusion in the enemy’s internal model by operating in an unexpected manner. 140 Glenn E. James, “Chaos Theory : The

Norm estimates of complex symmetric operators applied to quantum systems

International Nuclear Information System (INIS)

Prodan, Emil; Garcia, Stephan R; Putinar, Mihai

2006-01-01

This paper communicates recent results in the theory of complex symmetric operators and shows, through two non-trivial examples, their potential usefulness in the study of Schroedinger operators. In particular, we propose a formula for computing the norm of a compact complex symmetric operator. This observation is applied to two concrete problems related to quantum mechanical systems. First, we give sharp estimates on the exponential decay of the resolvent and the single-particle density matrix for Schroedinger operators with spectral gaps. Second, we provide new ways of evaluating the resolvent norm for Schroedinger operators appearing in the complex scaling theory of resonances

Operating characteristics of a 0.87 kW-hr flywheel energy storage module

Science.gov (United States)

Loewenthal, S. H.; Scibbe, H. W.; Parker, R. D.; Zaretsky, E. V.

1985-01-01

Discussion is given of the design and loss characteristics of 0.87 kW-hr (peak) flywheel energy storage module suitable for aerospace and automotive applications. The maraging steel flywheel rotor, a 46-cm- (18-in-) diameter, 58-kg (128-lb) tapered disk, delivers 0.65 kW-hr of usable energy between operating speeds of 10,000 and 20,000 rpm. The rotor is supported by 20- and 25-mm bore diameter, deep-groove ball bearings, lubricated by a self-replenishing wick type lubrication system. To reduce aerodynamic losses, the rotor housing was evacuated to vacuum levels from 40 to 200 millitorr. Dynamic rotor instabilities uncovered during testing necessitated the use of an elastometric-bearing damper to limit shaft excursions. Spindown losses from bearing, seal, and aerodynamic drag at 50 millitorr typically ranged from 64 to 193 W at 10,000 and 20,000 rpm, respectively. Discharge efficiency of the flywheel system exceeded 96 percent at torque levels greater than 21 percent of rated torque.

14 CFR 1240.113 - Financial accounting.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Financial accounting. 1240.113 Section 1240.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION INVENTIONS AND CONTRIBUTIONS Awards for Scientific and Technical Contributions § 1240.113 Financial accounting. (a) An Award Check...

48 CFR 49.113 - Cost principles.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Cost principles. 49.113 Section 49.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.113 Cost principles. The cost principles and procedures in the...

Dicty_cDB: CHC113 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHC113 (Link to dictyBase) - - - Contig-U15579-1 CHC113P (Link... to Original site) CHC113F 198 CHC113Z 396 CHC113P 574 - - Show CHC113 Library CH (Link to library) Clone ID CHC113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...nif*KLENIIKKRNKLIFNYK KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICTPTPS

42 CFR 56.113 - Grantee accountability.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Grantee accountability. 56.113 Section 56.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR MIGRANT HEALTH SERVICES General Provisions § 56.113 Grantee accountability. (a) Accounting for grant award...

Test and evaluation plan for Project W-314 tank farm restoration and safe operations

International Nuclear Information System (INIS)

Hays, W.H.

1998-01-01

The ''Tank Farm Restoration and Safe Operations'' (TFRSO), Project W-314 will restore and/or upgrade existing Hanford Tank Farm facilities and systems to ensure that the Tank Farm infrastructure will be able to support near term TWRS Privatization's waste feed delivery and disposal system and continue safe management of tank waste. The capital improvements provided by this project will increase the margin of safety for Tank Farms operations, and will aid in aligning affected Tank Farm systems with compliance requirements from applicable state, Federal, and local regulations. Secondary benefits will be realized subsequent to project completion in the form of reduced equipment down-time, reduced health and safety risks to workers, reduced operating and maintenance costs, and minimization of radioactive and/or hazardous material releases to the environment. The original regulatory (e.g., Executive Orders, WACS, CFRS, permit requirements, required engineering standards, etc.) and institutional (e.g., DOE Orders, Hanford procedures, etc.) requirements for Project W-314 were extracted from the TWRS S/RIDs during the development of the Functions and Requirements (F and Rs). The entire family of requirements were then validated for TWRS and Project W-314. This information was contained in the RDD-100 database and used to establish the original CDR. The Project Hanford Management Contract (PHMC) team recognizes that safety, quality, and cost effectiveness in the Test and Evaluation (T and E) program is achieved through a planned systematic approach to T and E activities. It is to this end that the Test and Evaluation Plan (TEP) is created. The TEP for the TFRSO Project, was developed based on the guidance in HNF-IP-0842, and the Good Practice Guide GPG-FM-005, ''Test and Evaluation,'' which is derived from DOE Order 430.1, ''Life Cycle Asset Management.'' It describes the Test and Evaluation program for the TFRSO project starting with the definitive design phase and ending

24 CFR 27.113 - Foreclosure costs.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Foreclosure costs. 27.113 Section 27.113 Housing and Urban Development Office of the Secretary, Department of Housing and Urban... Single Family Mortgages § 27.113 Foreclosure costs. A commission may be allowed to the foreclosure...

10 CFR 71.113 - Document control.

Science.gov (United States)

2010-01-01

... 10 Energy 2 2010-01-01 2010-01-01 false Document control. 71.113 Section 71.113 Energy NUCLEAR....113 Document control. The licensee, certificate holder, and applicant for a CoC shall establish measures to control the issuance of documents such as instructions, procedures, and drawings, including...

Making Stability Operations Less Complex While Improving Interoperability

National Research Council Canada - National Science Library

Chaum, Erik; Christman, Gerard

2008-01-01

Military support for stability, security, transition, and reconstruction as well as humanitarian assistance / disaster relief operations is as important and complex an endeavor as is major combat operations...

The Plasmodium protein P113 supports efficient sporozoite to liver stage conversion in vivo.

Science.gov (United States)

Offeddu, Vittoria; Rauch, Manuel; Silvie, Olivier; Matuschewski, Kai

2014-02-01

Invasive stages of Plasmodium parasites possess distinct integral and peripheral membrane proteins that mediate host cell attachment and invasion. P113 is an abundant protein in detergent-resistant high molecular weight complexes in Plasmodium schizonts, but is unusual since expression extends to gametocytes and sporozoites. In this study, we tested whether P113 performs important functions for parasite propagation in Plasmodium berghei. We show that pre-erythrocytic expression of P113 displays key signatures of upregulated in infectious sporozoites (UIS) genes, including control by the liver stage master regulator SLARP. Targeted gene deletion resulted in viable blood stage parasites that displayed no signs of blood stage growth defects. p113(-) parasites propagated normally through the life cycle until mature sporozoites, but displayed defects during natural sporozoite transmission, leading to a delay to patency in infected animals. By comparative in vitro and in vivo analysis of pre-erythrocytic development and using a xeno-diagnostic test we show that ablation of P113 results in lower sporozoite to liver stage conversion and, as a consequence, reduced merozoite output in vivo, without delaying liver stage development. We conclude that p113 is dispensable for Plasmodium life cycle progression and plays auxiliary roles during pre-erythrocytic development. Copyright © 2014 Elsevier B.V. All rights reserved.

9 CFR 113.7 - Multiple fractions.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Multiple fractions. 113.7 Section 113... § 113.7 Multiple fractions. (a) When a biological product contains more than one immunogenic fraction, the completed product shall be evaluated by tests applicable to each fraction. (b) When similar...

49 CFR 194.113 - Information summary.

Science.gov (United States)

2010-10-01

... 49 Transportation 3 2010-10-01 2010-10-01 false Information summary. 194.113 Section 194.113... Response Plans § 194.113 Information summary. (a) The information summary for the core plan, required by... state(s). (b) The information summary for the response zone appendix, required in § 194.107, must...

Global epidemiology of capsular group W meningococcal disease (1970-2015): Multifocal emergence and persistence of hypervirulent sequence type (ST)-11 clonal complex.

Science.gov (United States)

Mustapha, Mustapha M; Marsh, Jane W; Harrison, Lee H

2016-03-18

Following an outbreak in Mecca Saudi Arabia in 2000, meningococcal strains expressing capsular group W (W) emerged as a major cause of invasive meningococcal disease (IMD) worldwide. The Saudi Arabian outbreak strain (Hajj clone) belonging to the ST-11 clonal complex (cc11) is similar to W cc11 causing occasional sporadic disease before 2000. Since 2000, W cc11 has caused large meningococcal disease epidemics in the African meningitis belt and endemic disease in South America, Europe and China. Traditional molecular epidemiologic typing suggested that a majority of current W cc11 burden represented global spread of the Hajj clone. However, recent whole genome sequencing (WGS) analyses revealed significant genetic heterogeneity among global W cc11 strains. While continued spread of the Hajj clone occurs in the Middle East, the meningitis belt and South Africa have co-circulation of the Hajj clone and other unrelated W cc11 strains. Notably, South America, the UK, and France share a genetically distinct W cc11 strain. Other W lineages persist in low numbers in Europe, North America and the meningitis belt. In summary, WGS is helping to unravel the complex genomic epidemiology of group W meningococcal strains. Wider application of WGS and strengthening of global IMD surveillance is necessary to monitor the continued evolution of group W lineages. Copyright © 2016 Elsevier Ltd. All rights reserved.

19 CFR 113.35 - Individual sureties.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Individual sureties. 113.35 Section 113.35 Customs... CUSTOMS BONDS Principals and Sureties § 113.35 Individual sureties. (a) Number required. If individuals...) Qualifications to act as surety—(1) Residency and citizenship. Each individual surety on a Customs bond must be...

7 CFR 1710.113 - Loan security.

Science.gov (United States)

2010-01-01

... 7 Agriculture 11 2010-01-01 2010-01-01 false Loan security. 1710.113 Section 1710.113 Agriculture... GENERAL AND PRE-LOAN POLICIES AND PROCEDURES COMMON TO ELECTRIC LOANS AND GUARANTEES Loan Purposes and Basic Policies § 1710.113 Loan security. (a) RUS makes loans only if, in the judgment of the...

Dicty_cDB: VFB113 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB113 (Link to dictyBase) - - - Contig-U16478-1 VFB113P (Link... to Original site) VFB113F 584 VFB113Z 643 VFB113P 1227 - - Show VFB113 Library VF (Link to library) Clone ID VFB113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...rlstttrlptttrlptttrlstttr lptttrlptttrlptttrlptttrlsttrlstttrlstswctswctswictrygswissr llcwynhs*l*t*c*sfkksn...sequence. 42 5e-29 8 U03413 |U03413.1 Dictyostelium discoideum AX2 calcium binding protein mRNA, complete cd

38 CFR 75.113 - Data breach.

Science.gov (United States)

2010-07-01

... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Data breach. 75.113 Section 75.113 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) INFORMATION SECURITY MATTERS Data Breaches § 75.113 Data breach. Consistent with the definition of data breach in § 75.112 of this subpart, a data breach...

A Survey On Mean Glandular Dose From Full-Field Digital Mammography Systems, Operate Using Mo/ Mo And W/Rh Target/ Filter Combinations

International Nuclear Information System (INIS)

Noriah Jamal; Siti Selina Abdul Hamid; Humairah Samad Cheung; Siti Kamariah Che Mohamed; Ellyda Muhammed Nordin; Radhiana Hassan; Rehir Dahalan

2013-01-01

We had conducted a survey on Mean Glandular Dose (MGD) from Full-Field Digital Mammography systems (FFDM) operate using Molybdenum/ Molybdenum (Mo/ Mo) and Tungsten/ Rhodium (W/ Rh) target/ filter combinations. A survey was carried out at two randomly selected mammography centres in Malaysia, namely National Cancer Society and International Islamic University of Malaysia. The first centre operates using a W/ Rh, while the second centre operates using an Mo/ Mo target/ filter combinations. On the basis of recorded information, data on mammographic views, MGD, age and Compressed Breast Thickness (CBT) were recorded for 100 patients, for each mammographic centre respectively. The MGD data were analyzed for variation with age group, with 5 years increment. The MGD data were also analyzed for variation with CBT, with 5 mm increment. We found that for both CC and MLO views, FFDM systems operated using Mo/ Mo and W/ Rh target/ filter combinations present the same trend on MGD. The average MGD decreases as age increases. While average MGD increases with the increasing of CBT. However, FFDM system operates using Mo/ Mo gives higher MGD as compared with FFDM system operates using W/ Rh. (author)

NLO QCD effective field theory analysis of W+W- production at the LHC including fermionic operators

Science.gov (United States)

Baglio, Julien; Dawson, Sally; Lewis, Ian M.

2017-10-01

We study the impact of anomalous gauge boson and fermion couplings on the production of W+W- pairs at the LHC. Helicity amplitudes are presented separately to demonstrate the sources of new physics contributions and the impact of QCD and electroweak corrections. The QCD corrections have important effects on the fits to anomalous couplings, in particular when one W boson is longitudinally polarized and the other is transversely polarized. In effective field theory language, we demonstrate that the dimension-6 approximation to constraining new physics effects in W+W- pair production fails at pT˜500 - 1000 GeV .

The relationship between automation complexity and operator error

International Nuclear Information System (INIS)

Ogle, Russell A.; Morrison, Delmar 'Trey'; Carpenter, Andrew R.

2008-01-01

One of the objectives of process automation is to improve the safety of plant operations. Manual operation, it is often argued, provides too many opportunities for operator error. By this argument, process automation should decrease the risk of accidents caused by operator error. However, some accident theorists have argued that while automation may eliminate some types of operator error, it may create new varieties of error. In this paper we present six case studies of explosions involving operator error in an automated process facility. Taken together, these accidents resulted in six fatalities, 30 injuries and hundreds of millions of dollars in property damage. The case studies are divided into two categories: low and high automation complexity (three case studies each). The nature of the operator error was dependent on the level of automation complexity. For each case study, we also consider the contribution of the existing engineering controls such as safety instrumented systems (SIS) or safety critical devices (SCD) and explore why they were insufficient to prevent, or mitigate, the severity of the explosion

Dry well conductivity monitoring report for Tanks W-8, W-9, and W-10, Oak Ridge National Laboratory, Oak Ridge, Tennessee

International Nuclear Information System (INIS)

1997-10-01

A treatability study and waste removal program are being implemented for the Gunite ad Associated Tanks Operable Unit at Oak Ridge National Laboratory, Oak Ridge, Tennessee. This report documents the instrumentation and monitoring efforts to establish baseline conductivity conditions. The simulated liquid release (SLR) testing reported here demonstrates the effectiveness of the Conductivity-monitoring method (CMM) as a liquid-release detection method for consolidation Tanks W-8 and W-9 and Tank W-10 in the South Tank Farm (STF). The results show the remarkable sensitivity of the CMM to even very small simulated releases from the tank. The SLR testing for DW-8, DW-9 and DW-10 show that the dry well conductivity monitoring will be effective in detecting potential releases from the tanks during waste removal operations. The data in this report also make clear statements about the inferred integrity of the tanks, tank pads, and drain system: (1) the data substantiate earlier work and show that Tanks W-8, W-9, and W-10 are not leaking; (2) the data show that the pads under Tanks W-8, W-9, and W-10 are integral and connected to the dry wells; (3) the STF drain system appears to be functioning properly. This report presents these results and describes the release monitoring plan for the consolidation tanks and during waste removal operations at all of the tanks in the STF

Comparing the operators' behavior in conducting emergency operating procedures with the complexity of procedural steps

International Nuclear Information System (INIS)

Park, Jin Kyun; Jung, Won Dea

2003-01-01

Many kinds of procedures have been used to reduce the operators' workload throughout various industries. However, significant portion of accidents or incidents was caused by procedure related human errors that are originated from non-compliance of procedures. According to related studies, several important factors for non-compliance behavior have been identified, and one if them is the complexity of procedures. This means that comparing the change of the operators' behavior with the complexity of procedures may be meaningful for investigating plausible reasons for the operators' non-compliance behavior. In this study, emergency training records were collected using a full scope simulator in order to obtain data related to the operators' non-compliance behavior. And then, collected data are compared with the complexity of procedural steps. As the result, two remarkable relationships are found, which indicate that the operators' behavior could be reasonably characterized by the complexity of procedural steps. Thus, these relationships can be used as meaningful clues not only to scrutinize the reason of non-compliance behavior but also to suggest appropriate remedies for the reduction of non-compliance behavior that can result in procedure related human errors

13 CFR 113.540 - Advertising.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Advertising. 113.540 Section 113.540 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL... Advertising. A recipient shall not in any advertising related to employment indicate preference, limitation...

48 CFR 32.113 - Customary contract financing.

Science.gov (United States)

2010-10-01

... financing. 32.113 Section 32.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.113 Customary contract financing. The solicitation must specify the customary contract financing offerors may...

48 CFR 432.113 - Customary contract financing.

Science.gov (United States)

2010-10-01

... financing. 432.113 Section 432.113 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 432.113 Customary contract financing. The contracting officer may determine the necessity for customary contract financing. The...

Preparation of an sup(113m) indium generator

International Nuclear Information System (INIS)

Ling, H.W.

1979-01-01

This paper describes the features related to the preparation of sup(113m) In from a generator for nuclear medicine application. 113 Sn radioisotope is adsorbed on a hidrated zirconium oxide column and sup(113m) In generated from the decay of 113 Sn is eluted with diluted hydrochloric acid. This procedure is simple and appropriate for the separation of the desired radionuclide. Parameters which may affect the adsorption of 113 Sn like tin and hydrochloric acid concentration and temperature are studied. The influence of eluent concentration and temperature and flow rate of elution on sup(113m) In separation yields are observed. The purity of eluted sup(113m) In is analysed and variation of elution yield in a generator prepared with enriched tin is studied. (Author) [pt

5 CFR 831.113 - Payments to children.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Payments to children. 831.113 Section 831.113 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) RETIREMENT Administration and General Provisions § 831.113 Payments to children. For purposes of...

Rotary mode core sampling approved checklist: 241-TX-113

International Nuclear Information System (INIS)

Fowler, K.D.

1998-01-01

The safety assessment for rotary mode core sampling was developed using certain bounding assumptions, however, those assumptions were not verified for each of the existing or potential flammable gas tanks. Therefore, a Flammable Gas/Rotary Mode Core Sampling Approved Checklist has been completed for tank 241-TX-113 prior to sampling operations. This transmittal documents the dispositions of the checklist items from the safety assessment

21 CFR 113.5 - Current good manufacturing practice.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 113.5 Section... CONTAINERS General Provisions § 113.5 Current good manufacturing practice. The criteria in §§ 113.10, 113.40..., methods, practices, and controls used by the commercial processor in the manufacture, processing, or...

Recommendation on changing interfaces of W-058 and W-236A

International Nuclear Information System (INIS)

Light, J.M.

1994-01-01

This position paper recommends changes to improve the interface between the Cross-Site Transfer System (Project W-058) and the Multi-Function Waste Tank Facility (Project W-236A) to handle planned waste retrieval and storage operations. Appendix A includes cost estimates and schedule impacts for each project. The cost estimates, schedule impacts, and this position paper will be the basis for writing a change request to formally implement these changes on Project W-236A and Project W-058/W-028. Recommendations are made on pipeline rerouting, pump and configuration, and flushing configuration

40 CFR 113.3 - Definitions.

Science.gov (United States)

2010-07-01

... Pollution Contingency Plan and identified in approved Regional Oil and Hazardous Substances Pollution Contingency Plans. (h) Oil means oil of any kind or in any form, including but not limited to, petroleum, fuel... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Definitions. 113.3 Section 113.3...

13 CFR 113.510 - Recruitment.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.510 Section 113... Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and hiring of employees. Where a recipient has been found to be presently...

19 CFR 113.0 - Scope.

Science.gov (United States)

2010-04-01

... general authority and powers of the Commissioner of Customs in requiring bonds, bond approval and... 19 Customs Duties 1 2010-04-01 2010-04-01 false Scope. 113.0 Section 113.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS...

34 CFR 668.113 - Request for review.

Science.gov (United States)

2010-07-01

... review determination in paragraph (a) of this section results from an administrative, accounting, or... 34 Education 3 2010-07-01 2010-07-01 false Request for review. 668.113 Section 668.113 Education... Program Review Determinations § 668.113 Request for review. (a) An institution or third-party servicer...

46 CFR 113.25-6 - Power supply.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.25-6 Section 113.25-6 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT General Emergency Alarm Systems § 113.25-6 Power supply. The emergency power source...

14 CFR 1214.113 - Allocation of risk.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Allocation of risk. 1214.113 Section 1214.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION SPACE FLIGHT General....113 Allocation of risk. The U.S. Government will assume no risk for damages to the customer resulting...

Modeling of complex gas distribution systems operating under any vacuum conditions: Simulations of the ITER divertor pumping system

International Nuclear Information System (INIS)

Vasileiadis, N.; Tatsios, G.; Misdanitis, S.; Valougeorgis, D.

2016-01-01

Highlights: • An integrated s/w for modeling complex rarefied gas distribution systems is presented. • Analysis is based on kinetic theory of gases. • Code effectiveness is demonstrated by simulating the ITER divertor pumping system. • The present s/w has the potential to support design work in large vacuum systems. - Abstract: An integrated software tool for modeling and simulation of complex gas distribution systems operating under any vacuum conditions is presented and validated. The algorithm structure includes (a) the input geometrical and operational data of the network, (b) the definition of the fundamental set of network loops and pseudoloops, (c) the formulation and solution of the mass and energy conservation equations, (d) the kinetic data base of the flow rates for channels of any length in the whole range of the Knudsen number, supporting, in an explicit manner, the solution of the conservation equations and (e) the network output data (mainly node pressures and channel flow rates/conductance). The code validity is benchmarked under rough vacuum conditions by comparison with hydrodynamic solutions in the slip regime. Then, its feasibility, effectiveness and potential are demonstrated by simulating the ITER torus vacuum system with the six direct pumps based on the 2012 design of the ITER divertor. Detailed results of the flow patterns and paths in the cassettes, in the gaps between the cassettes and along the divertor ring, as well as of the total throughput for various pumping scenarios and dome pressures are provided. A comparison with previous results available in the literature is included.

Crystallization and preliminary X-ray crystallographic analysis of Thermotoga maritima CheA P3-P4-P5 domains in complex with CheW

International Nuclear Information System (INIS)

Park, SangYoun; Kim, Keon Young; Kim, Sunmin; Crane, Brian R.

2012-01-01

T. maritima CheA P3-P4-P5 domains were crystallized in complex with CheW. Low-resolution diffraction data were collected to ∼8 Å using synchrotron X-ray radiation. The CheA–CheW complex plays a key role in bacterial chemotaxis signal transduction by initiating phosphotransfer to response regulators via coupling to the chemoreceptors. CheA (P3-P4-P5 domains) and CheW from Thermotoga maritima were overexpressed in Escherichia coli and crystallized as a complex at 298 K using ammonium dihydrogen phosphate as a precipitant. X-ray diffraction data were collected to ∼8 Å resolution at 100 K using synchrotron radiation. The crystal belonged to space group I222 or I2 1 2 1 2 1 , with unit-cell parameters a = 184.2, b = 286.4, c = 327.7 Å. The asymmetric unit may contain six to ten CheA–CheW molecules

6 CFR 11.3 - Demand for payment.

Science.gov (United States)

2010-01-01

... 6 Domestic Security 1 2010-01-01 2010-01-01 false Demand for payment. 11.3 Section 11.3 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CLAIMS § 11.3 Demand for payment. (a) Notice requirements. Generally, before DHS starts the collection actions described in this subpart, DHS...

9 CFR 113.4 - Exemptions to tests.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Exemptions to tests. 113.4 Section 113.4 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... § 113.4 Exemptions to tests. (a) The test methods and procedures contained in all applicable Standard...

Społeczeństwo informacyjne w gminie Sędziszów Małopolski

OpenAIRE

Kolbusz, Janusz; Gątarski, Jakub; Hajder, Piotr

2014-01-01

Rozdział trzynasty w monografii wieloautorskiej pt. „Innowacyjna Gmina. Informatyka w jednostkach samorządu terytorialnego”. W pracy, scharakteryzowano społeczeństwo informacyjne oraz wykluczenie cyfrowe w gminie Sędziszów Małopolski. Zaprezentowano wyniki badań dostępności sieci Internet dla mieszkańców gminy oferowanej przez operatorów przewodowych i bezprzewodowych. Mariusz Nycz

New advanced operational regime on the W7-AS stellarator

International Nuclear Information System (INIS)

McCormick, K.; Grigull, P.; Burhenn, R.; Brakel, R.; Ehmler, H.; Feng, Y.; Gadelmeier, F.; Giannone, L.; Hildebrandt, D.; Hirsch, M.; Jaenicke, R.; Kisslinger, J.; Klinger, T.; Klose, S.; Knauer, J. P.; Koenig, R.; Kuehner, G.; Laqua, H. P.; Naujoks, D.; Niedermeyer, H.

2002-01-01

A promising new plasma operational regime on the Wendelstein stellarator W7-AS has been discovered. It is extant above a threshold density and characterized by flat density profiles, high energy and low impurity confinement times, and edge-localized radiation. Impurity accumulation is avoided. Quasistationary discharges with line-averaged densities n-bar e to 4x10 20 m -3 , radiation levels to 90% , and partial plasma detachment at the divertor target plates can be simultaneously realized. Energy confinement is up to twice that of a standard scaling. At B t =0.9 T , an average β value of 3.1% is achieved. The high n-bar e values allow demonstration of electron Bernstein wave heating using linear mode conversion

46 CFR 113.05-7 - Environmental tests.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Environmental tests. 113.05-7 Section 113.05-7 Shipping... SYSTEMS AND EQUIPMENT General Provisions § 113.05-7 Environmental tests. Communication, alarm system, control, and monitoring equipment must meet the environmental tests of— (a) Section 4-9-7, Table 9, of ABS...

9 CFR 113.33 - Mouse safety tests.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mouse safety tests. 113.33 Section 113.33 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... Procedures § 113.33 Mouse safety tests. One of the mouse safety tests provided in this section shall be...

sup(113m)In chelate complexes

International Nuclear Information System (INIS)

Abram, S.; Abram, U.; Spies, H.; Muenze, R.

1985-01-01

A series of 7 indiumdialkyldithiocarbamates (R=ethyl, n-propyl, i-propyl, n-butyl, i-butyl, -(CH 2 ) 5 -, -(CH 2 ) 2 -O-(CH 2 ) 2 -) has been prepared by reacting InCl 3 with aqueous solutions of the ligands. The products have been investigated at various concentration levels. The properties of the products at the lower concentration levels have been studied by thin-layer chromatography, electrophoresis and by determination of the octanol/water partition. A comparison of the results with the behaviour of the well-characterized tris(dialkyldithiocarbamato)indium(III) complexes is given. (author)

9 CFR 113.326 - Avian Pox Vaccine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Avian Pox Vaccine. 113.326 Section 113... Vaccines § 113.326 Avian Pox Vaccine. Fowl Pox Vaccine and Pigeon Pox Vaccine shall be prepared from virus... established as follows: (1) Fowl pox susceptible birds all of the same age and from the same source, shall be...

9 CFR 113.39 - Cat safety tests.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Cat safety tests. 113.39 Section 113... Procedures § 113.39 Cat safety tests. The safety tests provided in this section shall be conducted when... recommended for use in cats. (a) The cat safety test provided in this paragraph shall be used when the Master...

46 CFR 113.10-9 - Power supply.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.10-9 Section 113.10-9 Shipping COAST... SYSTEMS AND EQUIPMENT Fire and Smoke Detecting and Alarm Systems § 113.10-9 Power supply. (a) General... battery, the charger must be supplied from the final emergency power source. Upon loss of power to the...

46 CFR 113.43-5 - Power supply.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.43-5 Section 113.43-5 Shipping COAST... SYSTEMS AND EQUIPMENT Steering Failure Alarm Systems § 113.43-5 Power supply. Each steering failure alarm system must be supplied by a circuit that: (a) Is independent of other steering gear system and steering...

9 CFR 113.40 - Dog safety tests.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Dog safety tests. 113.40 Section 113... Procedures § 113.40 Dog safety tests. The safety tests provided in this section shall be conducted when... recommended for use in dogs. Serials which are not found to be satisfactory when tested pursuant to the...

Higher dimensional uniformisation and W-geometry

International Nuclear Information System (INIS)

Govindarajan, S.

1995-01-01

We formulate the uniformisation problem underlying the geometry of W n -gravity using the differential equation approach to W-algebras. We construct W n -space (analogous to superspace in supersymmetry) as an (n-1)-dimensional complex manifold using isomonodromic deformations of linear differential equations. The W n -manifold is obtained by the quotient of a Fuchsian subgroup of PSL(n,R) which acts properly discontinuously on a simply connected domain in bfCP n-1 . The requirement that a deformation be isomonodromic furnishes relations which enable one to convert non-linear W-diffeomorphisms to (linear) diffeomorphisms on the W n -manifold. We discuss how the Teichmueller spaces introduced by Hitchin can then be interpreted as the space of complex structures or the space of projective structures with real holonomy on the W n -manifold. The projective structures are characterised by Halphen invariants which are appropriate generalisations of the Schwarzian. This construction will work for all ''generic'' W-algebras. (orig.)

Identifying cognitive complexity factors affecting the complexity of procedural steps in emergency operating procedures of a nuclear power plant

International Nuclear Information System (INIS)

Park, Jinkyun; Jeong, Kwangsup; Jung, Wondea

2005-01-01

In complex systems such as a nuclear and chemical plant, it is well known that the provision of understandable procedures that allow operators to clarify what needs to be done and how to do it is one of the requisites to secure their safety. As a previous study in providing understandable procedures, the step complexity (SC) measure that can quantify the complexity of procedural steps in emergency operating procedures (EOPs) of a nuclear power plant (NPP) was suggested. However, the necessity of additional complexity factors that can consider a cognitive aspect in evaluating the complexity of procedural steps is raised. To this end, the comparisons between operators' performance data measured by the form of a step performance time with their behavior in carrying out the prescribed activities of procedural steps are conducted in this study. As a result, two kinds of complexity factors (the abstraction level of knowledge and the level of engineering decision) that could affect an operator's cognitive burden are identified. Although a well-designed experiment is indispensable for confirming the appropriateness of the additional complexity factors, it is strongly believed that the change of operators' performance data can be more authentically explained if the additional complexity factors are taken into consideration

Identifying cognitive complexity factors affecting the complexity of procedural steps in emergency operating procedures of a nuclear power plant

Energy Technology Data Exchange (ETDEWEB)

Park, Jinkyun [Integrated Safety Assessment Division, Korea Atomic Energy Research Institute, P.O. Box 105, Duckjin-Dong, Yusong-Ku, Taejon 305-600 (Korea, Republic of)]. E-mail: kshpjk@kaeri.re.kr; Jeong, Kwangsup [Integrated Safety Assessment Division, Korea Atomic Energy Research Institute, P.O. Box 105, Duckjin-Dong, Yusong-Ku, Taejon 305-600 (Korea, Republic of); Jung, Wondea [Integrated Safety Assessment Division, Korea Atomic Energy Research Institute, P.O. Box 105, Duckjin-Dong, Yusong-Ku, Taejon 305-600 (Korea, Republic of)

2005-08-01

In complex systems such as a nuclear and chemical plant, it is well known that the provision of understandable procedures that allow operators to clarify what needs to be done and how to do it is one of the requisites to secure their safety. As a previous study in providing understandable procedures, the step complexity (SC) measure that can quantify the complexity of procedural steps in emergency operating procedures (EOPs) of a nuclear power plant (NPP) was suggested. However, the necessity of additional complexity factors that can consider a cognitive aspect in evaluating the complexity of procedural steps is raised. To this end, the comparisons between operators' performance data measured by the form of a step performance time with their behavior in carrying out the prescribed activities of procedural steps are conducted in this study. As a result, two kinds of complexity factors (the abstraction level of knowledge and the level of engineering decision) that could affect an operator's cognitive burden are identified. Although a well-designed experiment is indispensable for confirming the appropriateness of the additional complexity factors, it is strongly believed that the change of operators' performance data can be more authentically explained if the additional complexity factors are taken into consideration.

Identifying cognitive complexity factors affecting the complexity of procedural steps in emergency operating procedures of a nuclear power plant

Energy Technology Data Exchange (ETDEWEB)

Jinkyun Park; Kwangsup Jeong; Wondea Jung [Korea Atomic Energy Research Institute, Taejon (Korea). Integrated Safety Assessment Division

2005-08-15

In complex systems such as a nuclear and chemical plant, it is well known that the provision of understandable procedures that allow operators to clarify what needs to be done and how to do it is one of the requisites to secure their safety. As a previous study in providing understandable procedures, the step complexity (SC) measure that can quantify the complexity of procedural steps in emergency operating procedures (EOPs) of a nuclear power plant (NPP) was suggested. However, the necessity of additional complexity factors that can consider a cognitive aspect in evaluating the complexity of procedural steps is raised. To this end, the comparisons between operator' performance data measured by the form of a step performance time with their behavior in carrying out the prescribed activities of procedural steps are conducted in this study. As a result, two kinds of complexity factors (the abstraction level of knowledge and the level of engineering decision) that could affect an operator's cognitive burden are identified. Although a well-designed experiment is indispensable for confirming the appropriateness of the additional complexity factors, it is strongly believed that the change of operators' performance data can be more authentically explained if the additional complexity factors are taken into consideration. (author)

Design review report: 200 East upgrades for Project W-314, tank farm restoration and safe operations

International Nuclear Information System (INIS)

Boes, K.A.

1998-01-01

This Design Review Report (DRR) documents the contractor design verification methodology and records associated with project W-314's 200 East (200E) Upgrades design package. The DRR includes the documented comments and their respective dispositions for this design. Acceptance of the comment dispositions and closure of the review comments is indicated by the signatures of the participating reviewers. Project W-314 is a project within the Tank Waste Remediation System (TWRS) Tank Waste Retrieval Program. This project provides capital upgrades for the existing Hanford tank farm waste transfer, instrumentation, ventilation, and electrical infrastructure systems. To support established TWRS programmatic objectives, the project is organized into two distinct phases. The initial focus of the project (i.e., Phase 1) is on waste transfer system upgrades needed to support the TWRS Privatization waste feed delivery system. Phase 2 of the project will provide upgrades to support resolution of regulatory compliance issues, improve tank infrastructure reliability, and reduce overall plant operating/maintenance costs. Within Phase 1 of the W-314 project, the waste transfer system upgrades are further broken down into six major packages which align with the project's work breakdown structure. Each of these six sub-elements includes the design, procurement, and construction activities necessary to accomplish the specific tank farm upgrades contained within the package. The first design package (AN Valve Pit Upgrades) was completed in November 1997, and the associated design verification activities are documented in HNF-1893. The second design package, 200 East (200E) Upgrades, was completed in March 1998. This design package identifies modifications to existing valve pits 241-AX-B and 241-A-B, as well as several new waste transfer pipelines to be constructed within the A Farm Complex of the 200E Area. The scope of the valve pit modifications includes new pit cover blocks, valve

Operational State Complexity of Deterministic Unranked Tree Automata

Directory of Open Access Journals (Sweden)

Xiaoxue Piao

2010-08-01

Full Text Available We consider the state complexity of basic operations on tree languages recognized by deterministic unranked tree automata. For the operations of union and intersection the upper and lower bounds of both weakly and strongly deterministic tree automata are obtained. For tree concatenation we establish a tight upper bound that is of a different order than the known state complexity of concatenation of regular string languages. We show that (n+1 ( (m+12^n-2^(n-1 -1 vertical states are sufficient, and necessary in the worst case, to recognize the concatenation of tree languages recognized by (strongly or weakly deterministic automata with, respectively, m and n vertical states.

Single Cell Oil Production from Hydrolysates of Inulin by a Newly Isolated Yeast Papiliotrema laurentii AM113 for Biodiesel Making.

Science.gov (United States)

Wang, Guangyuan; Liu, Lin; Liang, Wenxing

2018-01-01

Microbial oils are among the most attractive alternative feedstocks for biodiesel production. In this study, a newly isolated yeast strain, AM113 of Papiliotrema laurentii, was identified as a potential lipid producer, which could accumulate a large amount of intracellular lipids from hydrolysates of inulin. P. laurentii AM113 was able to produce 54.6% (w/w) of intracellular oil in its cells and 18.2 g/l of dry cell mass in a fed-batch fermentation. The yields of lipid and biomass were 0.14 and 0.25 g per gram of consumed sugar, respectively. The lipid productivity was 0.092 g of oil per hour. Compositions of the fatty acids produced were C 14:0 (0.9%), C 16:0 (10.8%), C 16:1 (9.7%), C 18:0 (6.5%), C 18:1 (60.3%), and C 18:2 (11.8%). Biodiesel obtained from the extracted lipids could be burnt well. This study not only provides a promising candidate for single cell oil production, but will also probably facilitate more efficient biodiesel production.

49 CFR 214.113 - Head protection.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Head protection. 214.113 Section 214.113 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... conform to the national consensus standards for industrial head protection (American National Standards...

33 CFR 136.113 - Other compensation.

Science.gov (United States)

2010-07-01

...) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY TRUST FUND; CLAIMS PROCEDURES; DESIGNATION OF SOURCE; AND ADVERTISEMENT General Procedure § 136.113 Other compensation. A... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Other compensation. 136.113...

Complex matrix multiplication operations with data pre-conditioning in a high performance computing architecture

Science.gov (United States)

Eichenberger, Alexandre E; Gschwind, Michael K; Gunnels, John A

2014-02-11

Mechanisms for performing a complex matrix multiplication operation are provided. A vector load operation is performed to load a first vector operand of the complex matrix multiplication operation to a first target vector register. The first vector operand comprises a real and imaginary part of a first complex vector value. A complex load and splat operation is performed to load a second complex vector value of a second vector operand and replicate the second complex vector value within a second target vector register. The second complex vector value has a real and imaginary part. A cross multiply add operation is performed on elements of the first target vector register and elements of the second target vector register to generate a partial product of the complex matrix multiplication operation. The partial product is accumulated with other partial products and a resulting accumulated partial product is stored in a result vector register.

Conceptual design report for tank farm restoration and safe operations, project W-314

Energy Technology Data Exchange (ETDEWEB)

Briggs, S.R., Westinghouse Hanford

1996-05-02

This Conceptual Design Report (CDR) presents the conceptual level design approach that satisfies the established technical requirements for Project W-314, `Tank Farm Restoration and Safe Operations.` The CDR also addresses the initial cost and schedule baselines for performing the proposed Tank Farm infrastructure upgrades. The scope of this project includes capital improvements to Hanford`s existing tank farm facilities(primarily focused on Double- Shell Tank Farms) in the areas of instrumentation/control, tank ventilation, waste transfer, and electrical systems.

Tungsten phosphanylarylthiolato complexes [W{PhP(2-SC6H4)2-kappa3S,S',P} 2] and [W{P(2-SC6H4)3-kappa4S,S',S",P}2]: synthesis, structures and redox chemistry.

Science.gov (United States)

Hildebrand, Alexandra; Lönnecke, Peter; Silaghi-Dumitrescu, Luminita; Hey-Hawkins, Evamarie

2008-09-14

PhP(2-SHC6H4)2 (PS2H2) reacts with WCl6 with reduction of tungsten to give the air-sensitive tungsten(IV) complex [W{PhP(2-SC6H4)2-kappa(3)S,S',P}2] (1). 1 is oxidised in air to [WO{PhPO(2-SC6H4)2-kappa(3)S,S',O}{PhP(2-SC6H4)2-kappa(3)S,S',P}] (2). The attempted synthesis of 2 by reaction of 1 with iodosobenzene as oxidising agent was unsuccessful. [W{P(2-SC6H4)3-kappa(4)S,S',S",P}2] (3) was formed in the reaction of P(2-SHC6H4)3 (PS3H3) with WCl6. The W(VI) complex 3 contains two PS3(3-) ligands, each coordinated in a tetradentate fashion resulting in a tungsten coordination number of eight. The reaction of 3 with AgBF4 yields the dinuclear tungsten complex [W2{P(2-SC6H4)3-kappa(4)S,S',S",P}3]BF4 (4). Complexes 1-4 were characterised by spectral methods and X-ray structure determination.

7 CFR 1955.113 - Price (housing).

Science.gov (United States)

2010-01-01

... 7 Agriculture 14 2010-01-01 2009-01-01 true Price (housing). 1955.113 Section 1955.113 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... REGULATIONS (CONTINUED) PROPERTY MANAGEMENT Disposal of Inventory Property Rural Housing (rh) Real Property...

Toda theories, W-algebras, and minimal models

International Nuclear Information System (INIS)

Mansfield, P.; Spence, B.

1991-01-01

We discuss the classical W-algebra symmetries of Toda field theories in terms of the pseudo-differential Lax operator associated with the Toda Lax pair. We then show how the W-algebra transformations can be understood as the non-abelian gauge transformations which preserve the form of the Lax pair. This provides a new understanding of the W-algebras, and we discuss their closure and co-cycle structure using this approach. The quantum Lax operator is investigated, and we show that this operator, which generates the quantum W-algebra currents, is conserved in the conformally extended Toda theories. The W-algebra minimal model primary fields are shown to arise naturally in these theories, leading to the conjecture that the conformally extended Toda theories provide a lagrangian formulation of the W-algebra minimal models. (orig.)

23 CFR 636.113 - Is the stipend amount eligible for Federal participation?

Science.gov (United States)

2010-04-01

... ENGINEERING AND TRAFFIC OPERATIONS DESIGN-BUILD CONTRACTING General § 636.113 Is the stipend amount eligible.... (b) Unless prohibited by State law, you may retain the right to use ideas from unsuccessful offerors... the stipend to qualifying offerors. The acceptance of any stipend must be optional on the part of the...

Slug Test Characterization Results for Multi-Test/Depth Intervals Conducted During the Drilling of CERCLA Operable Unit OU ZP-1 Wells 299-W11-43, 299-W15-50, and 299-W18-16

Energy Technology Data Exchange (ETDEWEB)

Spane, Frank A.; Newcomer, Darrell R.

2010-06-21

The following report presents test descriptions and analysis results for multiple, stress level slug tests that were performed at selected test/depth intervals within three Operable Unit (OU) ZP-1 wells: 299-W11-43 (C4694/Well H), 299-W15-50 (C4302/Well E), and 299-W18-16 (C4303/Well D). These wells are located within south-central region of the Hanford Site 200-West Area (Figure 1.1). The test intervals were characterized as the individual boreholes were advanced to their final drill depths. The primary objective of the hydrologic tests was to provide information pertaining to the areal variability and vertical distribution of hydraulic conductivity with depth at these locations within the OU ZP-1 area. This type of characterization information is important for predicting/simulating contaminant migration (i.e., numerical flow/transport modeling) and designing proper monitor well strategies for OU and Waste Management Area locations.

Design criteria of the bolometer diagnostic for steady-state operation of the W7-X stellaratora

NARCIS (Netherlands)

Zhang, D.; Burhenn, R.; König, R.; Giannone, L.; Grodzki, P.A.; Klein, B.; Grosser, K.; Baldzuhn, J.; Ewert, K.; Erckmann, V.; Hirsch, M.; Laqua, H.P.; Oosterbeek, J.W.

2010-01-01

A bolometric diagnostic system with features necessary for steady-state operation in the superconducting stellarator W7-X was designed. During a pulse length of 1800 s with an ECRH (electron cyclotron resonance heating) power of 10 MW, the components suffer not only from a large thermal load but

A Discussion on Risk in Complex Operational Settings

Energy Technology Data Exchange (ETDEWEB)

Ellis, K., E-mail: ken.ellis@wano.org [WANO, London (United Kingdom)

2014-10-15

Full text: Many apparatus today are complicated in that they consist of many components. The risk associated with these complicated apparatus is a product of their unreliable system components and sub-components. The components are a collection of inter-related individual components/ sub-components that can be correlated in a direct cause and effect manner and thus failures can be historically retraced or predicted. Once the confines of the complicated apparatus is extended to include such inputs as humans operating the equipment, man-machine interfaces, multiple processes surrounding the operation of the apparatus, etc., the whole system becomes complex. Complex systems are based on interdependencies versus dependencies, and risk becomes a product of improperly aligned or poorly integrated activities. Cause and effect becomes more loosely coupled and both path and circumstance dependent. To better understand and improve our defence in depth strategies we need to better understand and discuss complex systems and hence allow better erection of protective barriers. (author)

Product variety, product complexity and manufacturing operational performance: A systematic literature review

DEFF Research Database (Denmark)

Trattner, Alexandria Lee; Hvam, Lars; Herbert-Hansen, Zaza Nadja Lee

Manufacturing in the twenty-first century has been wrought with the struggle to satisfy the rising demand for greater product variety and more complex products while still maintaining efficient manufacturing operations. However, the literature lacks an overview of which operational performance...... measures are most affected by increased variety and complexity. This study presents a systematic literature review of the recent scholarly literature on variety, complexity and manufacturing operational performance (MOP). Results show that product variety has a consistently negative relationship with MOP...... across different time, cost, quality and flexibility measures while product complexity lacks evidence of strong relationships with MOP measures....

Ethylenediaminetetramethylene phosphate labelled with Indium-113 m (sup(113m)In-EDTMP) in bone scintigraphy

International Nuclear Information System (INIS)

Guzman Acevedo, C.

1981-08-01

Studies aimed at evaluating the utility of sup(113m)In-EDTMP as a bone imaging agent in regions of the world where supplies of sup(99m)Tc are difficult to ensure are reported. Preliminary studies were concerned with characterization of unlabelled EDTMP, its toxicity in rats, its labelling with sup(113m)In and the radiochemical purity of the labelled product. Dosimetric studies were carried out with the labelled product on 15 normal human volunteers after intravenous administration of the labelled material. Preliminary imaging studies were carried out on 5 normal human volunteers. Finally, clinical studies were carried out on 199 patients with various diseases involving bone. It is concluded that sup(113m)In-EDTMP is a appropriate agent to use for bone imaging where sup(99m)Tc is unavailable

9 CFR 113.2 - Testing aids.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Testing aids. 113.2 Section 113.2... Testing aids. To better ensure consistent and reproducible test results when Standard Requirement tests... Agriculture, may provide testing aids, when available, to licensees, permittees, and applicants for licenses...

27 CFR 21.113 - Isopropyl alcohol.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Isopropyl alcohol. 21.113 Section 21.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS FORMULAS FOR DENATURED ALCOHOL AND RUM Specifications for Denaturants § 21...

9 CFR 113.451 - Tetanus Antitoxin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Tetanus Antitoxin. 113.451 Section 113.451 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... which conforms to the National Institute of Standards and Technology requirements shall be used. The...

9 CFR 11.3 - Scar rule.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Scar rule. 11.3 Section 11.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL... inflammation, and, other bilateral evidence of abuse indicative of soring including, but not limited to...

Installation and operation of the 400 kW 140 GHz gyrotron on the MTX experiment

International Nuclear Information System (INIS)

Ferguson, S.W.; Felker, B.; Jackson, M.C.; Petersen, D.E.; Sewall, N.R.; Stever, R.D.

1991-09-01

This paper describes the installation and operation of the 400 kW 140 GHz gyrotron used for plasma heating on the Microwave Tokamak Experiment (MTX) at Lawrence Livermore National Laboratory (LLNL). The Varian VGT-8140 gyrotron has operated at a power level of 400 kW for 100 ms in conjunction with MTX plasma shots. The gyrotron system is comprised of a high voltage (-80 kV) modulated power supply, a multistation CAMAC computer control, a 5-tesla superconducting magnet, a series of conventional copper magnets, a circulating fluorinert (FC75) window cooling system, a circulating oil cooling system, a water cooling system, and microwave frequency and power diagnostics. Additionally, a Vlasov launcher is used to convert the gyrotron TE 15,2 mode to a Gaussian beam. Two versions of the Vlasov launcher have been used on the gyrotron, one version designed by LLNL and one version designed by the Japan Atomic Energy Research Institute (JAERI). The Gaussian beam from the Vlasov launcher is transported to the MTX tokamak by a series of 5 mirrors in a 35-meter-long, high-efficiency, quasioptical beam transport system. A twist polarizer is built into one of the mirrors to adjust for horizontal polarization in the tokamak. No windows are used between the Vlasov reflector and the MTX tokamak. A laser alignment system is used to perform the initial system alignment. A summary of the design and operating characteristics of each of these systems is included. Also included is a summary of the system operation and performance

Design criteria of the bolometer diagnostic for steady-state operation of the W7-X stellarator

International Nuclear Information System (INIS)

Zhang, D.; Burhenn, R.; Koenig, R.; Giannone, L.; Grodzki, P. A.; Klein, B.; Grosser, K.; Baldzuhn, J.; Ewert, K.; Erckmann, V.; Hirsch, M.; Laqua, H. P.; Oosterbeek, J. W.

2010-01-01

A bolometric diagnostic system with features necessary for steady-state operation in the superconducting stellarator W7-X was designed. During a pulse length of 1800 s with an ECRH (electron cyclotron resonance heating) power of 10 MW, the components suffer not only from a large thermal load but also from stray radiation of the nonabsorbed isotropic microwaves. This paper gives an overview of the technical problems encountered during the design work and the solutions to individual problems to meet the special requirements in W7-X, e.g., component thermal protection, detector offset thermal drift suppression, as well as a microwave shielding technique.

Design criteria of the bolometer diagnostic for steady-state operation of the W7-X stellaratora)

Science.gov (United States)

Zhang, D.; Burhenn, R.; Koenig, R.; Giannone, L.; Grodzki, P. A.; Klein, B.; Grosser, K.; Baldzuhn, J.; Ewert, K.; Erckmann, V.; Hirsch, M.; Laqua, H. P.; Oosterbeek, J. W.

2010-10-01

A bolometric diagnostic system with features necessary for steady-state operation in the superconducting stellarator W7-X was designed. During a pulse length of 1800 s with an ECRH (electron cyclotron resonance heating) power of 10 MW, the components suffer not only from a large thermal load but also from stray radiation of the nonabsorbed isotropic microwaves. This paper gives an overview of the technical problems encountered during the design work and the solutions to individual problems to meet the special requirements in W7-X, e.g., component thermal protection, detector offset thermal drift suppression, as well as a microwave shielding technique.

Evaluation of waste temperatures in AWF tanks for bypass mode operation of the 702-AZ ventilation system (Project W-030)

International Nuclear Information System (INIS)

Sathyanarayana, K.

1997-01-01

This report describes the results of thermal hydraulic analysis performed to provide data in support of Project W-030 to startup new 702-AZ Primary Ventilation System. During the startup of W-030 system, the ventilation system will be operating in bypass mode. In bypass made of operation, the system is capable of supplying 1000 cfm total flow for all four AWF doubleshell tanks. The design of the W-030 system is based on the assumption that both the recirculation loop of the primary ventilation system and the secondary ventilation which provides cooling would be operating. However, during the startup neither the recirculation system nor the secondary ventilation system will be operating. A minimum flow of 100 cfm is required to prevent any flammable gas associated risk. The remaining 600 cfm flow can be divided among the four tanks as necessary to keep the peak sludge temperatures below the operating temperature limit. For the purpose of determining the minimum flow required for cooling each tank, the thermal hydraulic analysis is performed to predict the peak sludge temperatures in AY/AZ tanks under different ventilation flows. The heat load for AZ farm tanks is taken from characterization reports and for the AY farm tanks, the heat load was estimated by thermal analysis using the measured waste temperatures and the waste liquid evaporation rates. The tank 241-AZ-101 and the tank 241-AZ-102 have heat loads of 241,600 and 199,500 Btu/hr respectively. The tank 241-AY-101 and tank 241-AY-102 have heat loads of 41,000 and 33,000 Btu/hr respectively. Using the ambient meteorological conditions of temperature and relative humidity for the air and tank, some soil surface and the sludge levels reported in recent documents, the peak sludge and supernatant temperatures were predicted for various primary ventilation flows ranging from 100 to 400 cfm for AZ tanks and 100 and 150 cfm for AY tanks. The results of these thermal hydraulic analyses are presented. Based on the

13 CFR 113.410 - Comparable facilities.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Comparable facilities. 113.410... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.410 Comparable facilities. A recipient may provide separate toilet, locker room, and shower facilities on the basis of sex, but...

21 CFR 113.81 - Product preparation.

Science.gov (United States)

2010-04-01

...) Blanching by heat, when required in the preparation of food for canning, should be effected by heating the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Product preparation. 113.81 Section 113.81 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR...

The BRST complex as the square root of the Casimir operator

International Nuclear Information System (INIS)

Holten, J.W. van

1990-02-01

The authors investigate the BRST cohomology of compact Lie algebras. An anti-BRST operator different from the one usually defined is introduced to construct a BRST invariant operator W, the zero-modes of which are in one-to-one correspondence with the BRST cohomology. Solutions to the BRST cohomology conditions with different ghost number are shown to exist, all of which can be used to define a physical state space for a constrained quantum system. A connection with sypersymmetric topological quantum theories is observed. (author). 17 refs

49 CFR 230.113 - Wheels and tire defects.

Science.gov (United States)

2010-10-01

... tires may not have a seam running lengthwise that is within 33/4 inches of the flange. (g) Worn flanges... 49 Transportation 4 2010-10-01 2010-10-01 false Wheels and tire defects. 230.113 Section 230.113... Tenders Wheels and Tires § 230.113 Wheels and tire defects. Steam locomotive and tender wheels or tires...

Operating experience and reliability improvements on the 5 kW CW klystron at Jefferson Lab

International Nuclear Information System (INIS)

Nelson, R.; Holben, S.

1997-01-01

With substantial operating hours on the RF system, considerable information on reliability of the 5 kW CW klystrons has been obtained. High early failure rates led to examination of the operating conditions and failure modes. Internal ceramic contamination caused premature failure of gun potting material and ultimate tube demise through arcing or ceramic fracture. A planned course of reporting and reconditioning of approximately 300 klystrons, plus careful attention to operating conditions and periodic analysis of operational data, has substantially reduced the failure rate. It is anticipated that implementation of planned supplemental monitoring systems for the klystrons will allow most catastrophic failures to be avoided. By predicting end of life, tubes can be changed out before they fail, thus minimizing unplanned downtime. Initial tests have also been conducted on this same klystron operated at higher voltages with resultant higher output power. The outcome of these tests will provide information to be considered for future upgrades to the accelerator

20 CFR 645.215 - What must a WtW operating entity that serves noncustodial parent participants do?

Science.gov (United States)

2010-04-01

... and children who may be at risk of domestic violence, the operating entity must consult with domestic violence prevention and intervention organizations in the development of its WtW project serving... school, (B) Earning a general equivalency degree, or (C) Participating in other education directly...

Searching for Order Within Chaos: Complexity Theorys Implications to Intelligence Support During Joint Operational Planning

Science.gov (United States)

2017-06-09

joint operational planning . 15. SUBJECT TERMS Complexity Theory , Complex Systems Theory , Complex Adaptive Systems, Dynamical Systems, Joint...complexity theory to analyze military problems and increase joint staff understanding of the operational environment during joint operational planning ?” the...13). Complex Systems Theory : “the study of the behavior of [complex adaptive] systems” (Ilachinski 2004, 4). For the purpose of this thesis there is

Transition Metal Complexes of Cr, Mo, W and Mn Containing η¹(S)-2,5-Dimethylthiophene, Benzothiophene and Dibenzothiophene Ligands

Energy Technology Data Exchange (ETDEWEB)

Reynolds, Michael [Iowa State Univ., Ames, IA (United States)

2000-09-21

The UV photolysis of hexanes solutions containing the complexes M(CO)₆ (M=Cr, Mo, W) or CpMn(CO)₃ (Cp=η⁵-C₅H₅) and excess thiophene (T*) (T*=2,5-dimethylthiophene (2,5-Me₂T), benzothiophene (BT), and dibenzothiophene (DBT)) produces the η¹(S)-T* complexes (CO)₅M(η¹(S)-T*) 1-8 or Cp(CO)₂Mn(η¹(S)-T*)9-11, respectively. However, when T*=DBT, and M=Mo, a mixture of two products result which includes the η¹(S)-DBT complex (CO)₅Mo(η¹(S)-DBT) 4a and the unexpected π-complex (CO)₃Mo(η{sup 6}-DBT) 4b as detected by ¹H NMR. The liability of the η¹(S)-T* ligands is illustrated by the rapid displacement of DBT in the complex (CO)₅W(η¹(S)-DBT) (1) by THF, and also in the complexes (CO)₅Cr(η¹(S)-DBT) (5) and CpMn(CO)₂(η¹(S)-DBT) (9) by CO (1 atm) at room temperature. Complexes 1-11 have been characterized spectroscopically (¹H NMR, IR) and when possible isolated as analytically pure solids (elemental analysis, EIMS). Single crystal, X-ray structural determinations are reported for (Cη)₅W(η¹(S)-DBT) and Cp(CO)₂Mn(η¹(S)-DBT).

Quiver W-algebras

Science.gov (United States)

Kimura, Taro; Pestun, Vasily

2018-06-01

For a quiver with weighted arrows, we define gauge-theory K-theoretic W-algebra generalizing the definition of Shiraishi et al. and Frenkel and Reshetikhin. In particular, we show that the qq-character construction of gauge theory presented by Nekrasov is isomorphic to the definition of the W-algebra in the operator formalism as a commutant of screening charges in the free field representation. Besides, we allow arbitrary quiver and expect interesting applications to representation theory of generalized Borcherds-Kac-Moody Lie algebras, their quantum affinizations and associated W-algebras.

47 CFR 25.113 - Station licenses and launch authority.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false Station licenses and launch authority. 25.113 Section 25.113 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Applications and Licenses General Application Filing Requirements § 25.113 Station...

Remarks on the Schroedinger operator with singular complex potentials

International Nuclear Information System (INIS)

Brezis, Haim; Kato, Tosio

1979-01-01

To describe this method in a simple case Section 2 begin with real valued potentials. The main results in Section 2 are essentially known. In Section 3 the case of complex potentials is exposed. Schroedinger operators with complex potentials have been studied by Nelson. This results were extended. Here more general singularities are exposed

Simple addition of silica to an alkane solution of Wilkinson WMe6 or Schrock W alkylidyne complex give active complex for saturated and unsaturated hydrocarbons metathesis

KAUST Repository

Callens, Emmanuel

2015-08-24

Addition of PDA silica to a solution of the Wilkinson WMe6 as well as the Schrock W neopentilidyne tris neopentyl complex catalyzes linear or cyclic alkanes to produce respectively a distribution of linear alkanes from methane up to triacontane or a mixture of cyclic and macrocyclic hydrocarbons. This single catalytic system transforms also linear α-olefins into higher and lower homologues via isomerization/metathesis mechanism (ISOMET). This complex is also efficient towards functionalized olefins. Unsaturated fatty acid esters (FAEs) are converted into diesters corresponding to self-metathesis products.

Operational range and transport barrier of the H-mode in the stellarator W7-AS

International Nuclear Information System (INIS)

Hirsch, M.; Amadeo, P.; Anton, M.; Baldzuhn, J.; Brakel, R.; Bleuel, J.; Fiedler, S.; Geist, T.; Grigull, P.; Hartfuss, H.J.; Jaenicke, R.; Kick, M.; Kisslinger, J.; Koponen, J.; Wagner, F.; Weller, A.; Wobig, H.; Zoletnik, S.; Holzhauer, E.

1998-01-01

In W7-AS the H-mode is characterized by an edge transport barrier localized in the first 3-4 cm inside the separatrix. In the ELMy H-mode preceding the quiescent state ELMs appear as a sudden breakdown of the edge transport barrier in coincidence with bursts of fluctuations. Between ELMs fluctuations are identical to those of the quiescent H-mode. The operational range of the quiescent H-mode is determined by narrow windows of the edge rotational transform and a threshold edge electron density. In contrast, ELM-like events are observed for a variety of plasma conditions by far exceeding the narrow operational windows for the quiescent state. (author)

9 CFR 113.208 - Avian Encephalomyelitis Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

..., Killed Virus. 113.208 Section 113.208 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.208 Avian Encephalomyelitis Vaccine, Killed Virus. Avian...

9 CFR 113.210 - Feline Calicivirus Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... Virus. 113.210 Section 113.210 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.210 Feline Calicivirus Vaccine, Killed Virus. Feline Calicivirus...

9 CFR 113.211 - Feline Rhinotracheitis Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... Virus. 113.211 Section 113.211 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.211 Feline Rhinotracheitis Vaccine, Killed Virus. Feline...

9 CFR 113.216 - Bovine Rhinotracheitis Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... Virus. 113.216 Section 113.216 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.216 Bovine Rhinotracheitis Vaccine, Killed Virus. Infectious Bovine...

9 CFR 113.203 - Feline Panleukopenia Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... Virus. 113.203 Section 113.203 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.203 Feline Panleukopenia Vaccine, Killed Virus. Feline Panleukopenia...

Managing complexity challenges for industrial engineering and operations management

CERN Document Server

López-Paredes, Adolfo; Pérez-Ríos, José

2014-01-01

This book presents papers by experts in the field of Industrial Engineering, covering topics in business strategy; modelling and simulation in operations research; logistics and production; service systems; innovation and knowledge; and project management. The focus of operations and production management has evolved from product and manufacturing to the capabilities of firms and collaborative management. Nowadays, Industrial Engineering is concerned with the study of how to design, modify, control and improve the performance of complex systems. It has extended its scope to any physical landscape populated by social agents. This raises a major challenge to Industrial Engineering:  managing complexity. This volume shows how experts are dealing with this challenge.

14 CFR 13.113 - Noncompliance with the investigative process.

Science.gov (United States)

2010-01-01

... process. 13.113 Section 13.113 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... an Order of Investigation § 13.113 Noncompliance with the investigative process. If any person fails... Officer or the designee of the Presiding Officer, judicial enforcement may be initiated against that...

9 CFR 113.205 - Newcastle Disease Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... Virus. 113.205 Section 113.205 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.205 Newcastle Disease Vaccine, Killed Virus. Newcastle Disease Vaccine...

9 CFR 113.104 - Leptospira Grippotyphosa Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Grippotyphosa Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.104 Leptospira Grippotyphosa Bacterin. Leptospira Grippotyphosa Bacterin shall be produced from a culture of Leptospira grippotyphosa which has been inactivated...

9 CFR 113.122 - Salmonella Choleraesuis Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Choleraesuis Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.122 Salmonella Choleraesuis Bacterin. Salmonella Choleraesuis Bacterin shall be prepared from a culture of Salmonella choleraesuis which has been inactivated and is...

9 CFR 113.120 - Salmonella Typhimurium Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Typhimurium Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.120 Salmonella Typhimurium Bacterin. Salmonella Typhimurium Bacterin shall be prepared from a culture of Salmonella typhimurium which has been inactivated and is...

37 CFR 11.3 - Suspension of rules.

Science.gov (United States)

2010-07-01

... Section 11.3 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE REPRESENTATION OF OTHERS BEFORE THE UNITED STATES PATENT AND TRADEMARK OFFICE General Provisions General Information § 11.3 Suspension of rules. (a) In an extraordinary situation, when justice requires...

Preparation of sup(113m)In-labelled compounds of radiopharmaceutical interest. Part of a coordinated programme on radiopharmaceuticals

International Nuclear Information System (INIS)

Servian, J.; Robles, A.

1975-06-01

Techniques for the preparation and control of already known and new sup(113m)In-radiopharmaceuticals were investigated. New rapid procedures for the control and preparation of a number of radiopharmaceuticals were developed and standardized. After biological distribution studies and clinical tests, new techniques for the preparation of the following indium-113 radiopharmaceuticals were adopted: a) Indium - labelled colloids of: S, Al(OH) 3 , Fe(OH) 3 and AlPO 4 for liver and spleen scintigraphy. b) Indium labelled chelates using the ligands EDTA, DTPA, TTHA (Triethylene-tetramine-hexaacetic acid) and DHPTA (Diamino-hydroxy-propane-tetraacetic acid) for brain scintigraphy. c) Indium labelled Fe(OH) 3 macroaggregates and microspheres for lung scintigraphy. d) Several complexes of sup(113m)In with different ligands (fluoride, tartrate, pyrophosphate, tripolyphosphate, trimetaphosphate, EHDP (or ethane-1-hydroxy-1, 1-diphosphonate), ethylendiamine-pyrophosphate were synthesized and its potential use as bone-scanning agents were evaluated. It was found that the complexes with tartrate, tripolyphosphate and EHDP show appreciable skeletal uptake (bone/muscle ratio are 9.0, 5.5, and 4.7 respectively), although they are inferior to the sup(99m)Tc bone-scanning agents. e) A new simple technique is proposed for the preparation of highly concentrated sup(113m)In solutions. The technique is based on the precipitation of In(OH) 3 , millipore filtration and redissolution in a small volume of 0.05 N HCl

Preparation of Radio-pharmaceuticals-III: An evaluation of the eluate from a {sup 113}Sn-{sup 113m}In cow system

Energy Technology Data Exchange (ETDEWEB)

Kim, You Sun; Kim, Tae Young [Korea Atomic Research Institue, Seoul (Korea, Republic of)

1969-03-15

In 1968 total 94,660 mc of radioactive iodocompound were prepared and distributed to the urers. In order to obtain an effective liver scanning {sup 113m}Incolloidal of even partical size from a {sup 113}Sn-{sup 113m}In cow, the eluate(pH; 1.5) was examined by a radio paper partition chromatography. It was found that the eluate was composed of two components, ionic from and colloidal form. The ionid from could be eliminated by cation exchange resine and the eluate from the ion exchange resine was of even particle size to give an excellent liver scanning results. Labelling of {sup 113m}In to human serum albumine was attempted.

STABILITY OF WHEELED VEHICLES AS COMPLEX OPERATIONAL PROPERTIES

Directory of Open Access Journals (Sweden)

N. Artemov

2011-01-01

Full Text Available Different views on the definition of «stability of wheeled vehicles» are considered and the author’s own definition is offered. A version of the structure of stability properties as a complex op-erational property is offered.

9 CFR 113.317 - Parvovirus Vaccine (Canine).

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Parvovirus Vaccine (Canine). 113.317... Virus Vaccines § 113.317 Parvovirus Vaccine (Canine). Parvovirus Vaccine recommended for use in dogs... from each dog shall be individually tested for neutralizing antibody against canine parvovirus to...

Ibuprofen-in-cyclodextrin-in-W/O/W emulsion - Improving the initial and long-term encapsulation efficiency of a model active ingredient.

Science.gov (United States)

Hattrem, Magnus N; Kristiansen, Kåre A; Aachmann, Finn L; Dille, Morten J; Draget, Kurt I

2015-06-20

A challenge in formulating water-in-oil-in-water (W/O/W) emulsions is the uncontrolled release of the encapsulated compound prior to application. Pharmaceuticals and nutraceuticals usually have amphipathic nature, which may contribute to leakage of the active ingredient. In the present study, cyclodextrins (CyDs) were used to impart a change in the relative polarity and size of a model compound (ibuprofen) by the formation of inclusion complexes. Various inclusion complexes (2-hydroxypropyl (HP)-β-CyD-, α-CyD- and γ-CyD-ibuprofen) were prepared and presented within W/O/W emulsions, and the initial and long-term encapsulation efficiency was investigated. HP-β-CyD-ibuprofen provided the highest encapsulation of ibuprofen in comparison to a W/O/W emulsion with unassociated ibuprofen confined within the inner water phase, with a four-fold increase in the encapsulation efficiency. An improved, although lower, encapsulation efficiency was obtained for the inclusion complex γ-CyD-ibuprofen in comparison to HP-β-CyD-ibuprofen, whereas α-CyD-ibuprofen had a similar encapsulation efficiency to that of unassociated ibuprofen. The lower encapsulation efficiency of ibuprofen in combination with α-CyD and γ-CyD was attributed to a lower association constant for the γ-CyD-ibuprofen inclusion complex and the ability of α-CyD to form inclusion complexes with fatty acids. For the W/O/W emulsion prepared with HP-β-CyD-ibuprofen, the highest encapsulation of ibuprofen was obtained at hyper- and iso-osmotic conditions and by using an excess molar ratio of CyD to ibuprofen. In the last part of the study, it was suggested that the chemical modification of the HP-β-CyD molecule did not influence the encapsulation of ibuprofen, as a similar encapsulation efficiency was obtained for an inclusion complex prepared with mono-1-glucose-β-CyD. Copyright © 2015 Elsevier B.V. All rights reserved.

Performance of Fluidized bed Fenton process in Degrading Acid Blue 113

Science.gov (United States)

Bello, M. M.; Raman, A. A.

2017-06-01

The performance of a fluidized bed Fenton process in degrading Acid Blue 113 (AB 113) was investigated. Fluidized bed Fenton process is a modification of conventional Fenton oxidation, aimed at reducing sludge generation and improving process performance. Response surface methodology was used to study the effects of operational parameter on the color removal from the dye. Dimensionless factors, Dye/Fe2+, H2O2/Fe2+ and pH were used as the independent variables in Box-Behnken Design (BDD). Reduced quadratic model was developed to predict the color removal. The process could remove up to 99 % of the initial color. The most significant factor for color removal was found to be Dye/Fe2+, followed by H2O2/Fe2+. Unlike conventional Fenton, the initial pH of the solution does not have a significant effect on the color removal.

Interdependence of Pes1, Bop1, and WDR12 controls nucleolar localization and assembly of the PeBoW complex required for maturation of the 60S ribosomal subunit.

Science.gov (United States)

Rohrmoser, Michaela; Hölzel, Michael; Grimm, Thomas; Malamoussi, Anastassia; Harasim, Thomas; Orban, Mathias; Pfisterer, Iris; Gruber-Eber, Anita; Kremmer, Elisabeth; Eick, Dirk

2007-05-01

The PeBoW complex is essential for cell proliferation and maturation of the large ribosomal subunit in mammalian cells. Here we examined the role of PeBoW-specific proteins Pes1, Bop1, and WDR12 in complex assembly and stability, nucleolar transport, and pre-ribosome association. Recombinant expression of the three subunits is sufficient for complex formation. The stability of all three subunits strongly increases upon incorporation into the complex. Only overexpression of Bop1 inhibits cell proliferation and rRNA processing, and its negative effects could be rescued by coexpression of WDR12, but not Pes1. Elevated levels of Bop1 induce Bop1/WDR12 and Bop1/Pes1 subcomplexes. Knockdown of Bop1 abolishes the copurification of Pes1 with WDR12, demonstrating Bop1 as the integral component of the complex. Overexpressed Bop1 substitutes for endogenous Bop1 in PeBoW complex assembly, leading to the instability of endogenous Bop1. Finally, indirect immunofluorescence, cell fractionation, and sucrose gradient centrifugation experiments indicate that transport of Bop1 from the cytoplasm to the nucleolus is Pes1 dependent, while Pes1 can migrate to the nucleolus and bind to preribosomal particles independently of Bop1. We conclude that the assembly and integrity of the PeBoW complex are highly sensitive to changes in Bop1 protein levels.

Yeast Interacting Proteins Database: YBR228W, YLR135W [Yeast Interacting Proteins Database

Lifescience Database Archive (English)

Full Text Available YBR228W SLX1 Subunit of a complex, with Slx4p, that hydrolyzes 5' branches from duplex...of a complex, with Slx4p, that hydrolyzes 5' branches from duplex DNA in response to stalled or converging r

Explicit resolutions for the complex of several Fueter operators

Science.gov (United States)

Bureš, Jarolim; Damiano, Alberto; Sabadini, Irene

2007-02-01

An analogue of the Dolbeault complex is introduced for regular functions of several quaternionic variables and studied by means of two different methods. The first one comes from algebraic analysis (for a thorough treatment see the book [F. Colombo, I. Sabadini, F. Sommen, D.C. Struppa, Analysis of Dirac systems and computational algebra, Progress in Mathematical Physics, Vol. 39, Birkhäuser, Boston, 2004]), while the other one relies on the symmetry of the equations and the methods of representation theory (see [F. Colombo, V. Souček, D.C. Struppa, Invariant resolutions for several Fueter operators, J. Geom. Phys. 56 (2006) 1175-1191; R.J. Baston, Quaternionic Complexes, J. Geom. Phys. 8 (1992) 29-52]). The comparison of the two results allows one to describe the operators appearing in the complex in an explicit form. This description leads to a duality theorem which is the generalization of the classical Martineau-Harvey theorem and which is related to hyperfunctions of several quaternionic variables.

Large scale IRAM 30 m CO-observations in the giant molecular cloud complex W43

Science.gov (United States)

Carlhoff, P.; Nguyen Luong, Q.; Schilke, P.; Motte, F.; Schneider, N.; Beuther, H.; Bontemps, S.; Heitsch, F.; Hill, T.; Kramer, C.; Ossenkopf, V.; Schuller, F.; Simon, R.; Wyrowski, F.

2013-12-01

We aim to fully describe the distribution and location of dense molecular clouds in the giant molecular cloud complex W43. It was previously identified as one of the most massive star-forming regions in our Galaxy. To trace the moderately dense molecular clouds in the W43 region, we initiated W43-HERO, a large program using the IRAM 30 m telescope, which covers a wide dynamic range of scales from 0.3 to 140 pc. We obtained on-the-fly-maps in 13CO (2-1) and C18O (2-1) with a high spectral resolution of 0.1 km s-1 and a spatial resolution of 12''. These maps cover an area of ~1.5 square degrees and include the two main clouds of W43 and the lower density gas surrounding them. A comparison to Galactic models and previous distance calculations confirms the location of W43 near the tangential point of the Scutum arm at approximately 6 kpc from the Sun. The resulting intensity cubes of the observed region are separated into subcubes, which are centered on single clouds and then analyzed in detail. The optical depth, excitation temperature, and H2 column density maps are derived out of the 13CO and C18O data. These results are then compared to those derived from Herschel dust maps. The mass of a typical cloud is several 104 M⊙ while the total mass in the dense molecular gas (>102 cm-3) in W43 is found to be ~1.9 × 106 M⊙. Probability distribution functions obtained from column density maps derived from molecular line data and Herschel imaging show a log-normal distribution for low column densities and a power-law tail for high densities. A flatter slope for the molecular line data probability distribution function may imply that those selectively show the gravitationally collapsing gas. Appendices are available in electronic form at http://www.aanda.orgThe final datacubes (13CO and C18O) for the entire survey are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (ftp://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/560/A24

9 CFR 113.315 - Feline Rhinotracheitis Vaccine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Feline Rhinotracheitis Vaccine. 113.315 Section 113.315 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... Inspection Service and observed each day for 14 days post-challenge. The rectal temperature of each animal...

9 CFR 113.67 - Erysipelothrix Rhusiopathiae Vaccine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Erysipelothrix Rhusiopathiae Vaccine. 113.67 Section 113.67 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Health Inspection Service. (4) A satisfactory challenge shall be evidenced in the controls by a high body...

19 CFR 113.33 - Corporations as principals.

Science.gov (United States)

2010-04-01

... president, treasurer, or secretary of the corporation. The officer's signature shall be prima facie evidence... 19 Customs Duties 1 2010-04-01 2010-04-01 false Corporations as principals. 113.33 Section 113.33 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE...

9 CFR 113.101 - Leptospira Pomona Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Pomona Bacterin. 113.101... Inactivated Bacterial Products § 113.101 Leptospira Pomona Bacterin. Leptospira Pomona Bacterin shall be produced from a culture of Leptospira pomona which has been inactivated and is nontoxic. Each serial of...

9 CFR 113.103 - Leptospira Canicola Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Canicola Bacterin. 113.103... Inactivated Bacterial Products § 113.103 Leptospira Canicola Bacterin. Leptospira Canicola Bacterin shall be produced from a culture of Leptospira canicola which has been inactivated and is nontoxic. Each serial of...

9 CFR 113.105 - Leptospira Hardjo Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Hardjo Bacterin. 113.105... Inactivated Bacterial Products § 113.105 Leptospira Hardjo Bacterin. Leptospira Hardjo Bacterin shall be produced from a culture of Leptospira hardjo which has been inactivated and is nontoxic. Each serial of...

9 CFR 113.65 - Brucella Abortus Vaccine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Brucella Abortus Vaccine. 113.65... Bacterial Vaccines § 113.65 Brucella Abortus Vaccine. Brucella Abortus Vaccine shall be prepared as a desiccated live culture bacterial vaccine from smooth colonial forms of the Brucella abortus organism...

9 CFR 113.123 - Salmonella Dublin Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Dublin Bacterin. 113.123... Inactivated Bacterial Products § 113.123 Salmonella Dublin Bacterin. Salmonella Dublin Bacterin shall be prepared from a culture of Salmonella dublin which has been inactivated and is nontoxic. Each serial of...

Green-diode-pumped femtosecond Ti:Sapphire laser with up to 450 mW average power.

Science.gov (United States)

Gürel, K; Wittwer, V J; Hoffmann, M; Saraceno, C J; Hakobyan, S; Resan, B; Rohrbacher, A; Weingarten, K; Schilt, S; Südmeyer, T

2015-11-16

We investigate power-scaling of green-diode-pumped Ti:Sapphire lasers in continuous-wave (CW) and mode-locked operation. In a first configuration with a total pump power of up to 2 W incident onto the crystal, we achieved a CW power of up to 440 mW and self-starting mode-locking with up to 200 mW average power in 68-fs pulses using semiconductor saturable absorber mirror (SESAM) as saturable absorber. In a second configuration with up to 3 W of pump power incident onto the crystal, we achieved up to 650 mW in CW operation and up to 450 mW in 58-fs pulses using Kerr-lens mode-locking (KLM). The shortest pulse duration was 39 fs, which was achieved at 350 mW average power using KLM. The mode-locked laser generates a pulse train at repetition rates around 400 MHz. No complex cooling system is required: neither the SESAM nor the Ti:Sapphire crystal is actively cooled, only air cooling is applied to the pump diodes using a small fan. Because of mass production for laser displays, we expect that prices for green laser diodes will become very favorable in the near future, opening the door for low-cost Ti:Sapphire lasers. This will be highly attractive for potential mass applications such as biomedical imaging and sensing.

A Study on Liver Scan using 113mIn Colloid

International Nuclear Information System (INIS)

Koh, Chang Soon; Rhee, Chong Hoen; Chang, Kochang; Hong, Chang Gi

1969-01-01

There have been reported numberous cases of liver scanning in use of 198 Au colloid by many investigators, however, one in use of 113m In colloid has not been reported as yet in this country. The dose of 113 mIn for high diagnostic value in examination of each organ was determined and the diagnostic interpretability of liver scanning with the use of 113m In was carefully evaluated in comparison with the results of the liver scanning by the conventionally applied radioisotope. The comparative study of both figures of liver scanning with the use of 113m In colloid and 198 Au colloid delivered following results:1) The liver uptake rate and clearance into peripheral blood were accentuated more in case of 113m In colloid than in case of 198 Au colloid. 2) The interpretability of space occupying lesion in liver scanning with 113m In was also superior to one with 198 Au. 3) The figure of liver scanning with 113m In colloid corresponds not always to the figure with 198 Au. This difference can be explained by difference of phagocytic ability of reticuloendothelial system within liver. 4) In the liver scanning with 113m In colloid, the spleen is also visualized even in normal examine. 5) In the cases of disturbed liver function, uptake is more decreased in use of 113m In colloid than in 198 Au, in the spleen, however, the way is contrary. 6) With use of 113m In colloid, the time required for scanning could be shortened in comparison with 198 Au. 7) The filtration of 113m In colloid for scanning prior to human administration gives an expectation for better scanning figure.

Concentrations of /sup 113m/Cd in the marine environment

Energy Technology Data Exchange (ETDEWEB)

Noshkin, V.E.; Wong, K.M.; Eagle, R.J.; Anglin, D.L.

1980-09-18

Reports on the detection of /sup 113m/Cd in any type of environmental sample have been rare. The 113 mass chain yield is small relative to other longer-lived fission products, such as /sup 90/Sr and /sup 137/Cs, produced from uranium, plutonium and thorium fissions. Also, only a small fraction of the 113 chain yield decays to /sup 113m/Cd. Salter estimated that the /sup 113m/Cd//sup 90/Sr activity quotient in thermonuclear fission should be 0.003. He stated that this ratio is in good agreement with data from a few samples measured in the northern hemisphere prior to 1962 which have no /sup 109/Cd. This, to our knowledge, was the first report of the detection of fission-produced /sup 113m/Cd in the environment. Salter also calculated that 0.062 MCi of /sup 113m/Cd and 0.25 MCi of /sup 109/Cd were produced by activation during the atmospheric detonation of the 1.4-megaton Starfish device on 9 July 1962 over Johnston Atoll. As both /sup 109/Cd and /sup 113m/Cd are produced during neutron activation of stable cadmium, and /sup 109/Cd is not a fission product, the last part of Salter's statement is significant. The absence of /sup 109/Cd in samples collected before 1962 indicates that all nuclear testing before this time, which included all tests conducted at Enewetak and Bikini Atolls in the Marshall Islands, could have generated /sup 113m/Cd only as a fission product. It is therefore important to recognize that /sup 113m/Cd could be present in other environments contaminated with fission product wastes discharged to the aquatic environment from other nuclear facilities. /sup 113m/Cd has a half life of 14.6 +- 0.1 y and decays predominantly by beta-particle emission. We present here a preliminary report of /sup 113m/Cd concentrations measured in sediment and tissue samples of marine organisms collected around different atolls in the Marshall Islands.

The operative management of children with complex perianal Crohn's disease.

Science.gov (United States)

Seemann, Natashia M; King, Sebastian K; Elkadri, Abdul; Walters, Thomas; Fish, Joel; Langer, Jacob C

2016-12-01

Perianal Crohn's disease (PCD) can affect both quality of life and psychological wellbeing. A subset of pediatric patients with complex PCD require surgical intervention, although appropriate timing and treatment regimens remain unclear. This study aimed to describe a large pediatric cohort in a tertiary center to determine the range of surgical management in children with complex PCD. A retrospective review of children requiring operative intervention for PCD over 13 years (2002-2014) was performed. PCD was divided into simple and complex based on the type of surgical procedure, and the two groups were compared. The 57 children were divided into two groups: the simple group (N=43) underwent abscess drainage ± seton insertion alone, and the complex group (N=14) underwent loop ileostomy ± more extensive surgery. In the complex group, females were more predominant (57% of complex vs 30% of simple), and the average age at diagnosis was lower. Anti-TNF therapy was utilized in 79.1% of simple and 100% of complex PCD. All 14 complex patients underwent a defunctioning ileostomy, with 7 requiring further operations (subtotal colectomy=4, proctocolectomy ± anal sparing=5, plastic surgery reconstruction with perineal flap/graft=4). Complex PCD represents a small but challenging subset of patients in which major surgical intervention may be necessary to alleviate the symptoms of this debilitating condition. retrospective case study with no control group - level IV. Copyright © 2016 Elsevier Inc. All rights reserved.

9 CFR 113.329 - Newcastle Disease Vaccine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Newcastle Disease Vaccine. 113.329 Section 113.329 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF.... Challenge virus shall be provided or approved by Animal and Plant Health Inspection Service. (4) If at least...

9 CFR 113.106 - Clostridium Chauvoei Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Clostridium Chauvoei Bacterin. 113.106 Section 113.106 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF... Animal and Plant Health Inspection Service, shall be used for challenge 14 to 15 days following the last...

9 CFR 113.107 - Clostridium Haemolyticum Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Clostridium Haemolyticum Bacterin. 113.107 Section 113.107 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... challenge 14 to 15 days following the last injection of the product. Each of eight vaccinates and each of...

9 CFR 113.306 - Canine Distemper Vaccine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Canine Distemper Vaccine. 113.306... Virus Vaccines § 113.306 Canine Distemper Vaccine. Canine Distemper Vaccine shall be prepared from virus... distemper virus, each of five canine distemper susceptible ferrets shall be injected with a sample of the...

9 CFR 113.302 - Distemper Vaccine-Mink.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Distemper Vaccine-Mink. 113.302... Virus Vaccines § 113.302 Distemper Vaccine—Mink. Distemper Vaccine—Mink shall be prepared from virus... follows: (1) To detect virulent canine distemper virus, each of two distemper susceptible mink or ferrets...

Operational history of Fermilab's 1500 W refrigerator used for energy saver magnet production testing

International Nuclear Information System (INIS)

Bianchi, A.J.; Barger, R.K.; Johnson, F.B.; McGuire, K.J.; Pinyan, K.D.; Wilson, F.W.; Cooper, W.E.

1985-09-01

The 1500 W helium refrigerator system utilizes two oil-injected screw compressors staged to feed a liquid nitrogen pre-cooled cold box. Refrigeration is provided by two Sulzer TGL-22 magnetic/gas bearing turbines. The refrigerator feeds six magnet test stands via a 10,000 L dewar and subcooler equipped distribution box. The design of the controls has permitted the system to be routinely operated 24 hours/day, seven days/week with only five operators. It has operated approximately 90% of the 4-1/2 years prior to shutting down in 1984 for a period of one year to move the compressor skid. Scheduled maintenance, failures, repairs and holidays are about equal to the 10% off time. The equipment described was used to test approximately 1200 superconducting magnets for the Fermilab accelerator ring. The seven year operating experience is presented as an equipment and technique review. Compressor hours currently exceed 42,000 and turbine hours exceed 39,000 each. Failure rates, causes, preventive maintenance, monitoring practices and equipment, and modifications are examined along with notes on some of the more successful applications of technique and equipment. 4 refs

Whole genome typing of the recently emerged Canadian serogroup W Neisseria meningitidis sequence type 11 clonal complex isolates associated with invasive meningococcal disease.

Science.gov (United States)

Tsang, Raymond S W; Ahmad, Tauqeer; Tyler, Shaun; Lefebvre, Brigitte; Deeks, Shelley L; Gilca, Rodica; Hoang, Linda; Tyrrell, Gregory; Van Caeseele, Paul; Van Domselaar, Gary; Jamieson, Frances B

2018-04-01

This study was performed to analyze the Canadian invasive serogroup W Neisseria meningitidis (MenW) sequence type 11 (ST-11) clonal complex (CC) isolates by whole genome typing and to compare Canadian isolates with similar isolates from elsewhere. Whole genome typing of 30 MenW ST-11 CC, 20 meningococcal group C (MenC) ST-11 CC, and 31 MenW ST-22 CC isolates was performed on the Bacterial Isolate Genome Sequence database platform. Canadian MenW ST-11 CC isolates were compared with the 2000 MenW Hajj outbreak strain, as well as with MenW ST-11 CC from other countries. Whole genome typing showed that the Canadian MenW ST-11 CC isolates were distinct from the traditional MenW ST-22 CC; they were not capsule-switched contemporary MenC strains that incorporated MenW capsules. While some recent MenW disease cases in Canada were caused by MenW ST-11 CC isolates showing relatedness to the 2000 MenW Hajj strain, many were non-Hajj isolates similar to current MenW ST-11 isolates found globally. Geographical and temporal variations in genotypes and surface protein antigen genes were found among the MenW ST-11 CC isolates. The current MenW ST-11 isolates did not arise by capsule switching from contemporary MenC ST-11 isolates. Both the Hajj-related and non-Hajj MenW ST-11 CC strains were associated with invasive meningococcal disease in Canada. Copyright © 2018 The Authors. Published by Elsevier Ltd.. All rights reserved.

Whole genome typing of the recently emerged Canadian serogroup W Neisseria meningitidis sequence type 11 clonal complex isolates associated with invasive meningococcal disease

Directory of Open Access Journals (Sweden)

Raymond S.W. Tsang

2018-04-01

Full Text Available Objectives: This study was performed to analyze the Canadian invasive serogroup W Neisseria meningitidis (MenW sequence type 11 (ST-11 clonal complex (CC isolates by whole genome typing and to compare Canadian isolates with similar isolates from elsewhere. Methods: Whole genome typing of 30 MenW ST-11 CC, 20 meningococcal group C (MenC ST-11 CC, and 31 MenW ST-22 CC isolates was performed on the Bacterial Isolate Genome Sequence database platform. Canadian MenW ST-11 CC isolates were compared with the 2000 MenW Hajj outbreak strain, as well as with MenW ST-11 CC from other countries. Results: Whole genome typing showed that the Canadian MenW ST-11 CC isolates were distinct from the traditional MenW ST-22 CC; they were not capsule-switched contemporary MenC strains that incorporated MenW capsules. While some recent MenW disease cases in Canada were caused by MenW ST-11 CC isolates showing relatedness to the 2000 MenW Hajj strain, many were non-Hajj isolates similar to current MenW ST-11 isolates found globally. Geographical and temporal variations in genotypes and surface protein antigen genes were found among the MenW ST-11 CC isolates. Conclusions: The current MenW ST-11 isolates did not arise by capsule switching from contemporary MenC ST-11 isolates. Both the Hajj-related and non-Hajj MenW ST-11 CC strains were associated with invasive meningococcal disease in Canada. Keywords: Neisseria meningitidis, Invasive meningococcal disease, Whole genome typing

Pollen sources in the Bojanów forest complex identified on honeybee pollen load by microscopic analysis

Directory of Open Access Journals (Sweden)

Ernest Stawiarz

2017-11-01

Full Text Available The aim of this study was to determine sources of pollen for the honeybee in the Bojanów forest complex, Nowa Dęba Forest District (southeastern Poland. Sampling of pollen loads from bees extended from the beginning of May until the end of September 2016 and was carried out at 7-day intervals using pollen traps mounted at the entrance of beehives. A total of 73 pollen load samples were collected from the study area. Fifty-nine taxa from 31 plant families were identified in the analyzed material. From 4 to 21 taxa (average 9.5 were recorded in one sample. The pollen of Brassicaceae (“others”, Taraxacum type, Solidago type, and Rumex had the highest frequency in the pollen loads examined. Apart from these four taxa, pollen grains of Rubus type, Poaceae (“others”, Calluna, Fagopyrum, Trifolium repens s. l., Phacelia, Aster type, Melampyrum, Quercus, Cornus, and Veronica were recorded in the dominant pollen group. The forest habitat taxa that provided pollen rewards to honeybees in the Bojanów forest complex were the following: Rubus, Calluna, Prunus, Tilia, Frangula alnus, Pinus, Quercus, Cornus, Robinia pseudoacacia, Salix, and Vaccinium. Apart from forest vegetation, the species from meadows and wastelands adjacent to this forest complex, represented by Taraxacum, Rumex, Plantago, Poaceae, Trifolium repens, and Solidago, proved to be an important source of pollen. The study indicates that forest communities are a valuable source of pollen for pollinating insects from early spring through to late fall.

Complex operator method of the hydrogen atom

International Nuclear Information System (INIS)

Jiang, X.

1989-01-01

Frequently the hydrogen atom eigenvalue problem is analytically solved by solving a radial wave equation for a particle in a Coulomb field. In this article, complex coordinates are introduced, and an expression for the energy levels of the hydrogen atom is obtained by means of the algebraic solution of operators. The form of this solution is in accord with that of the analytical solution

Gadolinium heteropoly complex K 17[Gd(P 2W 17O 61) 2] as a potential MRI contrast agent

Science.gov (United States)

Sun, Guoying; Feng, Jianghua; Wu, Huifeng; Pei, Fengkui; Fang, Ke; Lei, Hao

2004-10-01

Gadolinium heteropoly complex K17[Gd(P2W17O61)2] has been evaluated by in vitro and in vivo experiments as a potential contrast agent for magnetic resonance imaging (MRI). The thermal analysis and conductivity study indicate that this complex has good thermal stability and wide pH stability range. The T1 relaxivity is 7.59 mM-1 s-1 in aqueous solution and 7.97 mM-1 s-1 in 0.725 mmol l-1 bovine serum albumin (BSA) solution at 25 °C and 9.39 T, respectively. MR imaging of three male Sprague-Dawley rats showed remarkable enhancement in rat liver after intravenous injection, which persisted longer than with Gd-DTPA. The signal intensity increased by 57.1±16.9% during the whole imaging period at 0.082 mmol kg-1dose. Our preliminary in vitro and in vivo studies indicate that K17[Gd(P2W17O61)2] is a potential liver-specific MRI contrast agent.

Investigations on the indium-113m isotope generators

International Nuclear Information System (INIS)

Oniciu, L.; Veglia, A.

1975-01-01

Methods for the determination of sup(113Sn) in the eluate of an sup(113m)In generator are proposed. The techniques for the chemical and radionuclidic purity analysis of the eluate are also described: colorimetry, gamma-ray spectrometry, thin-film chromatography, and electrophoretic separation were used. Two generators of different origins were studied. The presence of the isotopes sup(113)Sn, sup(125)Sb, sup(125m)Te, and the elements Zr, Si and Fe were detected in the eluate. Recommendations for the use of these isotope cows are made. (G.Gy.)

13 CFR 113.3-3 - Structural accommodations for handicapped clients.

Science.gov (United States)

2010-01-01

... handicapped clients. 113.3-3 Section 113.3-3 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... ADMINISTRATOR General Provisions § 113.3-3 Structural accommodations for handicapped clients. (a) Existing... by handicapped clients. Where structural changes are necessary to make the recipient's goods or...

Experiment planning using high-level component models at W7-X

International Nuclear Information System (INIS)

Lewerentz, Marc; Spring, Anett; Bluhm, Torsten; Heimann, Peter; Hennig, Christine; Kühner, Georg; Kroiss, Hugo; Krom, Johannes G.; Laqua, Heike; Maier, Josef; Riemann, Heike; Schacht, Jörg; Werner, Andreas; Zilker, Manfred

2012-01-01

Highlights: ► Introduction of models for an abstract description of fusion experiments. ► Component models support creating feasible experiment programs at planning time. ► Component models contain knowledge about physical and technical constraints. ► Generated views on models allow to present crucial information. - Abstract: The superconducting stellarator Wendelstein 7-X (W7-X) is a fusion device, which is capable of steady state operation. Furthermore W7-X is a very complex technical system. To cope with these requirements a modular and strongly hierarchical component-based control and data acquisition system has been designed. The behavior of W7-X is characterized by thousands of technical parameters of the participating components. The intended sequential change of those parameters during an experiment is defined in an experiment program. Planning such an experiment program is a crucial and complex task. To reduce the complexity an abstract, more physics-oriented high-level layer has been introduced earlier. The so-called high-level (physics) parameters are used to encapsulate technical details. This contribution will focus on the extension of this layer to a high-level component model. It completely describes the behavior of a component for a certain period of time. It allows not only defining simple value ranges but also complex dependencies between physics parameters. This can be: dependencies within components, dependencies between components or temporal dependencies. Component models can now be analyzed to generate various views of an experiment. A first implementation of such an analyze process is already finished. A graphical preview of a planned discharge can be generated from a chronological sequence of component models. This allows physicists to survey complex planned experiment programs at a glance.

Design and operating experience on the U.S. Department of Energy Experimental Mod-O 100 kW Wind Turbine

Science.gov (United States)

Glasgow, J. C.; Birchenough, A. G.

1978-01-01

The Mod-O 100 kW Experimental Wind Turbine was designed and fabricated by NASA, as part of the Federal Wind Energy Program, to assess technology requirements and engineering problems of large wind turbines. The machine became operational in October 1975 and has demonstrated successful operation in all of its design modes. During the course of its operations the machine has generated a wealth of experimental data and has served as a prototype developmental test bed for the Mod-OA operational wind turbines which are currently used on utility networks. This paper describes the mechanical and control systems as they evolved in operational tests and describes some of the experience with various systems in the downwind rotor configuration.

75 FR 10026 - Proposed Collection; Comment Request for Forms W-2, W-2c, W-2AS, W-2GU, W-2VI, W-3, W-3c, W-3cPR...

Science.gov (United States)

2010-03-04

... W-2, W-2c, W-2AS, W-2GU, W-2VI, W-3, W-3c, W-3cPR, W-3PR, and W-3SS AGENCY: Internal Revenue Service....C. 3506(c)(2)(A)). Currently, the IRS is soliciting comments concerning Forms W-2, W-2c, W-2AS, W-2GU, W-2VI, W-3, W-3c, W- 3cPR, W-3PR, and W-3SS. DATES: Written comments should be received on or...

48 CFR 18.113 - Interagency acquisitions under the Economy Act.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Interagency acquisitions under the Economy Act. 18.113 Section 18.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Available Acquisition Flexibilities 18.113 Interagency acquisitions under...

9 CFR 113.64 - General requirements for live bacterial vaccines.

Science.gov (United States)

2010-01-01

... bacterial vaccines. 113.64 Section 113.64 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Live Bacterial Vaccines § 113.64 General requirements for live bacterial vaccines... bacterial vaccine shall meet the requirements in this section. (a) Purity test. Final container samples of...

32 CFR Appendix A to Part 113 - Certificate of Compliance

Science.gov (United States)

2010-07-01

... 113 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN INDEBTEDNESS PROCEDURES OF MILITARY PERSONNEL Pt. 113, App. A Appendix A to Part 113—Certificate... consumer credit transaction to which this form refers. (If the unpaid balance has been adjusted as a...

46 CFR 113.35-9 - Mechanical engine order telegraph systems.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Mechanical engine order telegraph systems. 113.35-9 Section 113.35-9 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT Engine Order Telegraph Systems § 113.35-9 Mechanical engine order...

27 CFR 40.113 - Change in location to another region.

Science.gov (United States)

2010-04-01

... another region. 40.113 Section 40.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... Products Changes in Location of Factory § 40.113 Change in location to another region. Whenever a manufacturer of tobacco products intends to remove his factory to another region, the manufacturer shall...

9 CFR 113.300 - General requirements for live virus vaccines.

Science.gov (United States)

2010-01-01

... vaccines. 113.300 Section 113.300 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... REQUIREMENTS Live Virus Vaccines § 113.300 General requirements for live virus vaccines. When prescribed in an applicable Standard Requirement or in the filed Outline of Production, a live virus vaccine shall meet the...

13 CFR 113.520 - Job classification and structure.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Job classification and structure. 113.520 Section 113.520 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION... males or for females; (b) Maintain or establish separate lines of progression, seniority lists, career...

Study of W boson polarisations and Triple Gauge boson Couplings in the reaction $e^{+}e^{-} \\to W^{+}W^{-}$ at LEP 2

CERN Document Server

Abdallah, J.; Adam, W.; Adzic, P.; Albrecht, T.; Alemany-Fernandez, R.; Allmendinger, T.; Allport, P.P.; Amaldi, U.; Amapane, N.; Amato, Sandra F.; Anashkin, E.; Andreazza, A.; Andringa, Sofia; Anjos, N.; Antilogus, Pierre; Apel, W-D.; Arnoud, Y.; Ask, S.; Asman, B.; Augustin, Jean-Eudes; Augustinus, A.; Baillon, P.; Ballestrero, A.; Bambade, P.; Barbier, R.; Bardin, D.; Barker, G.J.; Baroncelli, Antonio; Battaglia, Marco; Baubillier, M.; Becks, K-H.; Begalli, M.; Behrmann, A.; Ben-Haim, Eli; Benekos, N.; Benvenuti, A.; Berat, C.; Berggren, Mikael; Bertrand, D.; Besancon, Marc; Besson, N.; Bloch, Daniel; Blom, M.; Bluj, Michal; Bonesini, Maurizio; Boonekamp, M.; Booth, P.S.L.; Borisov, G.; Botner, Olga; Bouquet, B.; Bowcock, T.J.V.; Boyko, I.; Bracko, Marko; Brenner, R.; Brodet, E.; Bruckman, P.; Brunet, J.M.; Buschbeck, B.; Buschmann, P.; Calvi, M.; Camporesi, Tiziano; Canale, V.; Carena, F.; Castro, Nuno Filipe; Cavallo, F.; Chapkin, M.; Charpentier, Ph.; Checchia, Paolo; Chierici, R.; Chliapnikov, P.; Chudoba, J.; Chung, Suh-Urk; Cieslik, K.; Collins, P.; Contri, Roberto; Cosme, G.; Cossutti, Fabio; Costa, M.J.; Crennell, D.; Cuevas, Javier; D'Hondt, J.; da Silva, T.; Da Silva, W.; Della Ricca, Giuseppe; De Angelis, Alessandro; De Boer, W.; De Clercq, C.; De Lotto, Barbara; De Maria, N.; De Min, A.; de Paula, L.; Di Ciaccio, L.; Di Simone, A.; Doroba, K.; Eigen, G.; Ekelof, Tord; Ellert, Mattias; Elsing, M.; Espirito Santo, Maria Catarina; Fanourakis, George K.; Feindt, Michael; Fernandez, J.; Ferrer, Antonio; Ferro, F.; Flagmeyer, U.; Foeth, H.; Fokitis, E.; Fulda-Quenzer, F.; Fuster, J.; Gandelman, Miriam; Garcia, C.; Gavillet, Philippe; Gazis, Evangelos; Gomez-Ceballos, G.; Goncalves, P.; Graziani, E.; Grosdidier, G.; Grzelak, K.; Guy, J.; Haag, C.; Hallgren, A.; Hamacher, Klaus; Hamilton, K.; Haug, S.; Hauler, F.; Hedberg, Vincent; Hennecke, M.; Herr, H.; Hoffman, J.; Holmgren, S-O.; Holt, P.J.; Houlden, M.A.; Jackson, John Neil; Jarlskog, Goran; Jarry, P.; Jeans, D.; Johansson, E.K.; Jonsson, P.; Joram, C.; Jungermann, L.; Kapusta, Frederic; Katsanevas, S.; Katsoufis, E.; Kernel, Gabrijel; Kerzel, U.; King, B.T.; Kjaer, N.J.; Kluit, Peter; Kokkinias, P.; Kourkoumelis, C.; Kouznetsov, O.; Krumstein, Z.; Kucharczyk, M.; Lamsa, J.; Leder, G.; Ledroit, F.; Leinonen, L.; Leitner, R.; Lemonne, Jacques; Lepeltier, V.; Lesiak, T.; Liebig, W.; Liko, D.; Lipniacka, A.; Lopes, J.H.; Lopez, J.M.; Loukas, D.; Lutz, Pierre; Lyons, Louis; MacNaughton, J.; Malek, A.; Maltezos, S.; Mandl, F.; Marco, J.; Marco, R.; Marechal, B.; Margoni, M.; Marin, J-C.; Mariotti, C.; Markou, A.; Martinez-Rivero, C.; Masik, J.; Mastroyiannopoulos, N.; Matorras, F.; Matteuzzi, C.; Mazzucato, F.; Mazzucato, M.; Nulty, R.Mc; Meroni, C.; Migliore, E.; Mitaroff, W.; Mjoernmark, U.; Moa, T.; Moch, M.; Monge, R.; Montenegro, J.; Moraes, D.; Moreno, S.; Morettini, P.; Muller, Ulrich; Muenich, K.; Mulders, M.; Mundim Filho, Luiz Martins; Murray, W.; Muryn, B.; Myatt, G.; Myklebust, T.; Nassiakou, M.; Navarria, F.; Nawrocki, K.; Nicolaidou, R.; Oblakowska-Mucha, A.; Obraztsov, V.; Olshevski, A.; Onofre, A.; Orava, R.; Osterberg, K.; Ouraou, A.; Oyanguren, A.; Paganoni, M.; Paiano, S.; Palacios, J.P.; Palka, Henryk; Papadopoulou, Th.D.; Pape, L.; Parkes, C.; Parodi, F.; Parzefall, U.; Passeri, A.; Passon, O.; Peralta, L.; Perepelitsa, V.; Perrotta, Andrea; Petrolini, Alessandro; Piedra, Jonatan; Pieri, L.; Pierre, Francois; Pimenta, M.; Piotto, E.; Poireau, V.; Pol, M.E.; Polok, G.; Pozdniakov, V.; Pukhaeva, N.; Pullia, A.; Radojicic, D.; Rames, J.; Read, A.; Rebecchi, P.; Rehn, J.; Reid, D.; Reinhardt, R.; Renton, Peter; Richard, F.; Ridky, Jan; Rivero, M.; Rodriguez, D.; Romero, A.; Ronchese, Paolo; Roudeau, P.; Rovelli, T.; Ruhlmann, Vanina; Ryabtchikov, D.; Sadovsky, A.; Salmi, L.; Salt, J.; Sander, C.; Savoy-Navarro, A.; Schwickerath, U.; Segar, A.; Sekulin, R.; Siebel, Martin; Sisakian, A.; Smadja, G.; Smirnova, O.; Sokolov, Andrei Valerevich; Sopczak, A.; Sosnowski, R.; Spassov, T.; Stanitzki, M.; Stocchi, A.; Strauss, J.; Stugu, B.; Szczekowski, M.; Szeptycka, M.; Szumlak, T.; Tabarelli de Fatis, T.; Taffard, A.C.; Tegenfeldt, F.; Timmermans, Jan; Tkatchev, L.; Tobin, M.; Todorovova, S.; Tome, B.; Tonazzo, A.; Tortosa, P.; Travnicek, Petr; Treille, D.; Tristram, G.; Trochimczuk, M.; Troncon, Clara; Turluer, M-L.; Tyapkin, I.A.; Tyapkin, P.; Tzamarias, S.; Uvarov, V.; Valenti, Giovanni; Van Dam, P.; Van Eldik, J.; Van Lysebetten, A.; van Remortel, N.; Van Vulpen, I.; Vegni, G.; Veloso, Filipe; Venus, W.; Verdier, Patrice; Verzi, V.; Vilanova, D.; Vitale, Lorenzo; Vrba, V.; Wahlen, H.; Washbrook, A.J.; Weiser, C.; Wicke, D.; Wickens, J.; Wilkinson, G.; Winter, M.; Witek, M.; Yushchenko, O.; Zalewska, A.; Zalewski, P.; Zavrtanik, Danilo; Zhuravlov, V.; Zimine, N.I.; Zintchenko, Alexandre

2008-01-01

A determination of the single W Spin Density Matrix (SDM) elements in the reaction e+e- -> W+W- -> l nu q qbar (l=e/mu) is reported at centre-of-mass energies between 189 and 209 GeV. The data sample used corresponds to an integrated luminosity of 520 pb^{-1} taken by DELPHI between 1998 and 2000. The single W SDM elements, rho_{tau tau'}^{W+-} (tau,tau' = +/-1 or 0), are determined as a function of the W- production angle with respect to the e- beam direction and are obtained from measurements of the W decay products by the application of suitable projection operators, Lambda_{tau tau'}, which assume the V-A coupling of the W boson to fermions. The measured SDM elements are used to obtain the fraction of longitudinally polarised Ws, with the result: sigma_L/sigma_tot = 24.9 +/- 4.5(stat) +/- 2.2(syst) % at a mean energy of 198 GeV. The SDM elements are also used to determine the Triple Gauge Couplings Delta g_1^Z, Delta kappa_gamma, lambda_gamma and g_4^Z, ~kappa_Z and ~lambda_Z. For the CP-violating couplin...

Complex-potential description of the damped harmonic oscillator

International Nuclear Information System (INIS)

Exner, P.

1981-01-01

Multidimensional damped harmonic oscillator is treated by means of a non-selfadjoint Hamiltonian with complex potential. The latter is chosen as V(x)=xx(A-iW)x with positive matrices A, W, By a perturbation-theory argument, the corresponding Hamiltonian H=-1/2Δ+V with the natural domain is shown to be closed and such that Vsub(t)=exp(-iHt) is a continuous contractive semigroup. Explicit integral-operator form of Vsub(t) is found by use of Lie-Trotter formula [ru

Structural insights into the regulation of Bacillus subtilis SigW activity by anti-sigma RsiW.

Directory of Open Access Journals (Sweden)

Shankar Raj Devkota

Full Text Available Bacillus subtilis SigW is localized to the cell membrane and is inactivated by the tight interaction with anti-sigma RsiW under normal growth conditions. Whereas SigW is discharged from RsiW binding and thus initiates the transcription of its regulon under diverse stress conditions such as antibiotics and alkaline shock. The release and activation of SigW in response to extracytoplasmic signals is induced by the regulated intramembrane proteolysis of RsiW. As a ZAS (Zinc-containing anti-sigma family protein, RsiW has a CHCC zinc binding motif, which implies that its anti-sigma activity may be regulated by the state of zinc coordination in addition to the proteolytic cleavage of RsiW. To understand the regulation mode of SigW activity by RsiW, we determined the crystal structures of SigW in complex with the cytoplasmic domain of RsiW, and compared the conformation of the CHCC motif in the reduced/zinc binding and the oxidized states. The structures revealed that RsiW inhibits the promoter binding of SigW by interacting with the surface groove of SigW. The interaction between SigW and RsiW is not disrupted by the oxidation of the CHCC motif in RsiW, suggesting that SigW activity might not be regulated by the zinc coordination states of the CHCC motif.

The classical limit of W-algebras

International Nuclear Information System (INIS)

Figueroa-O'Farrill, J.M.; Ramos, E.

1992-01-01

We define and compute explicitly the classical limit of the realizations of W n appearing as hamiltonian structures of generalized KdV hierarchies. The classical limit is obtained by taking the commutative limit of the ring of pseudodifferential operators. These algebras - denoted w n - have free field realizations in which the generators are given by the elementary symmetric polynomials in the free fields. We compute the algebras explicitly and we show that they are all reductions of a new algebra w KP , which is proposed as the universal classical W-algebra for the w n series. As a deformation of this algebra we also obtain w 1+∞ , the classical limit of W 1+∞ . (orig.)

9 CFR 113.69 - Pasteurella Multocida Vaccine, Bovine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Multocida Vaccine, Bovine. 113.69 Section 113.69 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Animal and Plant Health Inspection Service. (4) A satisfactory challenge shall be evidenced in the...

21 CFR 211.113 - Control of microbiological contamination.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Control of microbiological contamination. 211.113 Section 211.113 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Production and...

Designs of Langmuir probes for W7-X

International Nuclear Information System (INIS)

Laube, Ralph; Laux, Michael; Ye, Min You; Greuner, Henri; Lindig, Stefan

2011-01-01

Several designs of Langmuir probes for the stellarator Wendelstein 7-X (W7-X) are described. Different types of probes are proposed for the different divertors to be used during different operational phases of W7-X. Comb-like arrays of stiff probes, arrays of flexible probes, and fixed inlay probes are reviewed. For the initial phase of W7-X it was decided to install arrays of fixed inlay probes. Two mockups were manufactured and one of them was tested with success in the high heat flux test facility GLADIS. For long-pulse operation of W7-X different conceptual designs are proposed and are still developed further. This paper summarizes the different design constrains for the Langmuir probes in the different divertor surroundings, describes the design of the array of inlay probes for the initial phase and the result of the GLADIS test, and gives a preview of the conceptual designs of probes for the long-pulse operational phase of W7-X.

Development and installation in cell of generators of 113Sn/sup(113m)In in the Argentine National Atomic Energy Commission

International Nuclear Information System (INIS)

Bianco de Salas, G.N.; Arciprete, J.A.; Mitta, A.E.A.

1978-05-01

The preparation of 113 Sn/sup(113m)In generators is described as well as its installation in cell. The chemical and radiochemical controls and the conditions to concentrate the eluate, if necessary, are described in detail. Production and exportation figures are given. (author) [es

Yeast Interacting Proteins Database: YNL189W, YDR318W [Yeast Interacting Proteins Database

Lifescience Database Archive (English)

Full Text Available ponent of the COMA complex (Ctf19p, Okp1p, Mcm21p, Ame1p) that bridges kinetochore subunits that are in cont...t of the COMA complex (Ctf19p, Okp1p, Mcm21p, Ame1p) that bridges kinetochore subunits that are in contact w

Development of 10kW SOFC module

Energy Technology Data Exchange (ETDEWEB)

Hisatome, N.; Nagata, K. [Mitsubishi Heavy Industries, Ltd., Nagasaki (Japan); Kakigami, S. [Electric Power Development Co., Inc., Tokyo (Japan)] [and others

1996-12-31

Mitsubishi Heavy industries, Ltd. (MHI) has been developing tubular type Solid Oxide Fuel Cells (SOFC) since 1984. A 1 kW module of SOFC has been continuously operated for 3,000 hours with 2 scheduled thermal cycles at Electric Power Development Co., Inc. (EPDC) Wakamatsu Power Station in 1993. We have obtained of 34% (HHV as H{sub 2}) module efficiency and deterioration rate of 2% Per 1,000 hours in this field test. As for next step, we have developed 10 kW module in 1995. The 10 kW module has been operated for 5,000 hours continuously. This module does not need heating support to maintain the operation temperature, and the module efficiency was 34% (HHV as H{sub 2}). On the other hand, we have started developing the technology of pressurized SOFC. In 1996, pressurized MW module has been tested at MHI Nagasaki Shipyard & Machinery, Works. We are now planning the development of pressurized 10 kW module.

9 CFR 113.68 - Pasteurella Haemolytica Vaccine, Bovine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Haemolytica Vaccine, Bovine. 113.68 Section 113.68 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Service. (4) A satisfactory challenge shall be evidenced in the controls by progression of clinical signs...

9 CFR 113.409 - Tuberculin-PPD Bovis, Intradermic.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Tuberculin-PPD Bovis, Intradermic. 113... REQUIREMENTS Diagnostics and Reagents § 113.409 Tuberculin—PPD Bovis, Intradermic. Tuberculin—PPD Bovis... completed product from each serial shall be subjected to a comparison specificity test using a Reference PPD...

9 CFR 113.206 - Wart Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Wart Vaccine, Killed Virus. 113.206... AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.206 Wart Vaccine, Killed Virus. Wart Vaccine, Killed Virus, shall be prepared...

40 CFR 600.113-78 - Fuel economy calculations.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-78... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-78 Fuel economy calculations. The...

40 CFR 600.113-88 - Fuel economy calculations.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-88... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-88 Fuel economy calculations. The...

40 CFR 600.113-93 - Fuel economy calculations.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-93... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-93 Fuel economy calculations. The...

A determination of the mass and width of the W boson at LEP2

CERN Document Server

Palacios, J P

2001-01-01

During 1998 and 1999 LEP produced electron-positron collisions at centre of mass energies ranging between 189 and 202 GeV. An integrated luminosity of 372 pb sup - sup 1 was collected by the DELPHI experiment during this period. From these data, samples of events with e nu-bar sub e qq-bar', mu nu-bar submu qq-bar' and tau nu-bar subtau qq-bar' final states were selected. These were analysed to obtain values for the mass and width of the W boson using the method of invariant mass direct reconstruction. Combining the results obtained for both running periods and the three l nu-bar sub l qq-bar' channels, the following values are obtained: M sub w = 80.308 +- 0.113 (stat) +- 0.038 (syst) GeV GAMMA sub w = 1.857 +- 0.298 (stat) +- 0.155 (syst) GeV

The relation between quantum W algebras and Lie algebras

International Nuclear Information System (INIS)

Boer, J. de; Tjin, T.

1994-01-01

By quantizing the generalized Drinfeld-Sokolov reduction scheme for arbitrary sl 2 embeddings we show that a large set W of quantum W algebras can be viewed as (BRST) cohomologies of affine Lie algebras. The set W contains many known W algebras such as W N and W 3 (2) . Our formalism yields a completely algorithmic method for calculating the W algebra generators and their operator product expansions, replacing the cumbersome construction of W algebras as commutants of screening operators. By generalizing and quantizing the Miura transformation we show that any W algebra in W can be embedded into the universal enveloping algebra of a semisimple affine Lie algebra which is, up to shifts in level, isomorphic to a subalgebra of the original affine algebra. Therefore any realization of this semisimple affine Lie algebra leads to a realization of the W algebra. In particular, one obtains in this way a general and explicit method for constructing the free field realizations and Fock resolutions for all algebras in W. Some examples are explicitly worked out. (orig.)

Design, performance, and economics of 50-kW and 500-kW vertical axis wind turbines

Science.gov (United States)

Schienbein, L. A.; Malcolm, D. J.

1983-11-01

A review of the development and performance of the DAF Indal 50-kW vertical axis Darrieus wind turbine shows that a high level of technical development and reliability has been achieved. Features of the drive train, braking and control systems are discussed and performance details are presented. Details are also presented of a 500-kW VAWT that is currently in production. A discussion of the economics of both the 50-kW and 500-kW VAWTs is included, showing the effects of charge rate, installed cost, operating cost, performance, and efficiency.

9 CFR 113.209 - Rabies Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rabies Vaccine, Killed Virus. 113.209... Killed Virus Vaccines § 113.209 Rabies Vaccine, Killed Virus. Rabies Vaccine (Killed Virus) shall be prepared from virus-bearing cell cultures or nerve tissues obtained from animals that have developed rabies...

9 CFR 202.113 - Rule 13: Written hearing.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Rule 13: Written hearing. 202.113 Section 202.113 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION... waiver of the right to file such evidence. (g) Extension of time for depositions. If any party timely...

13 CFR 113.455 - Textbooks and curricular material.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Textbooks and curricular material. 113.455 Section 113.455 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE PROGRAMS OF SBA-EFFECTUATION OF POLICIES OF FEDERAL GOVERNMENT AND SBA ADMINISTRATOR Nondiscrimination on the Basis of Se...

Operational conditions and characteristics of ELM-events during H-mode plasmas in the stellarator W7-AS

International Nuclear Information System (INIS)

Hirsch, M.; Grigull, P.; Wobig, H.; Kisslinger, J.; McCormick, K.; Anton, M.; Baldzuhn, J.; Fiedler, S.; Fuchs, Ch.; Geiger, J.; Giannone, L.; Hartfuss, H.-J.; Holzhauer, E.; Hirsch, M.; Jaenicke, R.; Kick, M.; Maassberg, H.; Wagner, F.; Weller, A.

2000-01-01

H-mode operation in the low-shear stellarator W7-AS is achieved for specific plasma edge topologies characterized by three 'operational windows' of the edge rotational transform. An explanation for this strong influence of the magnetic configuration could be the increase of viscous damping if rational surfaces and thus island structures occur within the relevant plasma edge layer, thereby impeding the development of an edge transport barrier. Prior to the final transition to a quiescent state, the plasma edge passes a rich phenomenology of dynamic behaviour such as dithering and ELMs. Plasma edge parameters indicate that a quiescent H-mode occurs if a certain edge pressure is achieved. (author)

27 CFR 11.3 - Application.

Science.gov (United States)

2010-04-01

... THE TREASURY LIQUORS CONSIGNMENT SALES Scope of Regulations § 11.3 Application. (a) General. The regulations in this part apply to transactions between industry members and trade buyers. (b) Transactions...

9 CFR 113.312 - Rabies Vaccine, Live Virus.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rabies Vaccine, Live Virus. 113.312... Virus Vaccines § 113.312 Rabies Vaccine, Live Virus. Rabies Vaccine shall be prepared from virus-bearing... administration. (iii) Observe all animals for signs of rabies until scheduled time to sacrifice. If animals show...

9 CFR 113.38 - Guinea pig safety test.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Guinea pig safety test. 113.38 Section... Standard Procedures § 113.38 Guinea pig safety test. The guinea pig safety test provided in this section... be injected either intramuscularly or subcutaneously into each of two guinea pigs and the animals...

Design review report: AN valve pit upgrades for Project W-314, tank farm restoration and safe operations

International Nuclear Information System (INIS)

Boes, K.A.

1998-01-01

This Design Review Report (DRR) documents the contractor design verification methodology and records associated with project W-314's AN Valve Pit Upgrades design package. The DRR includes the documented comments and their respective dispositions for this design. Acceptance of the comment dispositions and closure of the review comments is indicated by the signatures of the participating reviewers. Project W-314, Tank Farm Restoration and Safe Operations, is a project within the Tank Waste Remediation System (TWRS) Tank Waste Retrieval Program. This project provides capital upgrades for the existing Hanford tank farms' waste transfer, instrumentation, ventilation, and electrical infrastructure systems. To support established TWRS programmatic objectives, the project is organized into two distinct phases. The initial focus of the project (i.e., Phase 1) is on waste transfer system upgrades needed to support the TWRS Privatization waste feed delivery system. Phase 2 of the project will provide upgrades to support resolution of regulatory compliance issues, improve tank infrastructure reliability, and reduce overall plant operating/maintenance costs. Within Phase 1 of the W-314 project, the waste transfer system upgrades are further broken down into six major packages which align with the project's work breakdown structure. Each of these six sub-elements includes the design, procurement, and construction activities necessary to accomplish the specific tank farm upgrades contained within the package. The first package to be performed is the AN Valve Pit Upgrades package. The scope of the modifications includes new pit cover blocks, valve manifolds, leak detectors, transfer line connections (for future planned transfer lines), and special protective coating for the 241-AN-A and 241-AN-B valve pits

Sniffer probe measurements in W7-AS

International Nuclear Information System (INIS)

Wolff, H.; Grigull, P.; Poschenrieder, W.; Roth, J.; Pech, P.

1992-01-01

Wendelstein W7-AS is a modular Advanced Stellarator with a major radius R=2 m, effective plasma radius a≤0.2 m, fivefold symmetry of the configuration and B≤2.5 Tesla. The rotational transform z can be varied between 0.25 and 0.7, the vacuum shear being low. W7-AS allows an operation free of net plasma current using ECRH and/or NBI up to 3 seconds. Typical plasma parameters obtained with ECRH are T e ≤3 keV, T i ≤0.7 keV with central densities n eo 19 m -3 . The maximum electron density obtained with NBI heating was n eo =3x10 20 m -3 , the energy confinement ranges between 5 and 30 ms. The edge plasma has a complex structure reflecting the 5/m symmetry of ''natural'' magnetic islands. A degradation of both energy and particle confinement is found at low order rational values of z(a) at the plasma edge, whereas optimum confinement can be established in narrow z-windows close to the resonances at z=1/3 and z=1/2. The poloidal cross-section of the plasma changes five times around the torus according to the fivefold periodicity from a vertical ellipse via a triangular shape to a vertical ellipse again. At low z the minor plasma radius is defined by two movable limiters whereas above z=1/2 the edge structure becomes separatrix dominated. The complex edge structure varying with z gives rise to inhomogeneous particle and energy flows to the wall and in-vessel installations which determine on the other hand the working gas recycling and the impurity generation affecting on their part the confinement properties of the plasma. The latter issues are essential topics of the experimental edge plasma programme of W7-AS. (author) 4 refs., 4 figs

Galilean contractions of W-algebras

Directory of Open Access Journals (Sweden)

Jørgen Rasmussen

2017-09-01

Full Text Available Infinite-dimensional Galilean conformal algebras can be constructed by contracting pairs of symmetry algebras in conformal field theory, such as W-algebras. Known examples include contractions of pairs of the Virasoro algebra, its N=1 superconformal extension, or the W3 algebra. Here, we introduce a contraction prescription of the corresponding operator-product algebras, or equivalently, a prescription for contracting tensor products of vertex algebras. With this, we work out the Galilean conformal algebras arising from contractions of N=2 and N=4 superconformal algebras as well as of the W-algebras W(2,4, W(2,6, W4, and W5. The latter results provide evidence for the existence of a whole new class of W-algebras which we call Galilean W-algebras. We also apply the contraction prescription to affine Lie algebras and find that the ensuing Galilean affine algebras admit a Sugawara construction. The corresponding central charge is level-independent and given by twice the dimension of the underlying finite-dimensional Lie algebra. Finally, applications of our results to the characterisation of structure constants in W-algebras are proposed.

On W algebras commuting with a set of screenings

Energy Technology Data Exchange (ETDEWEB)

Litvinov, Alexey [Landau Institute for Theoretical Physics,Akademika Semenova av., 1-A , Chernogolovka (Russian Federation); Kharkevich Institute for Information Transmission Problems,Bolshoy Karetny per. 19-1, Moscow, 127051 (Russian Federation); Spodyneiko, Lev [Landau Institute for Theoretical Physics,Akademika Semenova av., 1-A , Chernogolovka (Russian Federation); California Institute of Technology, Department of Physics,1200 East California Boulevard, Pasadena, 91125 (United States)

2016-11-22

We consider the problem of classification of all W algebras which commute with a set of exponential screening operators. Assuming that the W algebra has a nontrivial current of spin 3, we find equations satisfied by the screening operators and classify their solutions.

Operating a wide-area remote observing system for the W. M. Keck Observatory

Science.gov (United States)

Wirth, Gregory D.; Kibrick, Robert I.; Goodrich, Robert W.; Lyke, James E.

2008-07-01

For over a decade, the W. M. Keck Observatory's two 10-meter telescopes have been operated remotely from its Waimea headquarters. Over the last 6 years, WMKO remote observing has expanded to allow teams at dedicated sites in California to observe either in collaboration with colleagues in Waimea or entirely from the U.S. mainland. Once an experimental effort, the Observatory's mainland observing capability is now fully operational, supported on all science instruments (except the interferometer) and regularly used by astronomers at eight mainland sites. Establishing a convenient and secure observing capability from those sites required careful planning to ensure that they are properly equipped and configured. It also entailed a significant investment in hardware and software, including both custom scripts to simplify launching the instrument interface at remote sites and automated routers employing ISDN backup lines to ensure continuation of observing during Internet outages. Observers often wait until shortly before their runs to request use of the mainland facilities. Scheduling these requests and ensuring proper system operation prior to observing requires close coordination between personnel at WMKO and the mainland sites. An established protocol for approving requests and carrying out pre-run checkout has proven useful in ensuring success. The Observatory anticipates enhancing and expanding its remote observing system. Future plans include deploying dedicated summit computers for running VNC server software, implementing a web-based tracking system for mainland-based observing requests, expanding the system to additional mainland sites, and converting to full-time VNC operation for all instruments.

49 CFR 215.113 - Defective plain bearing wedge.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Defective plain bearing wedge. 215.113 Section 215... Suspension System § 215.113 Defective plain bearing wedge. A railroad may not place or continue in service a car, if a plain bearing wedge on that car is— (a) Missing; (b) Cracked; (c) Broken; or (d) Not located...

19 CFR 113.55 - Cancellation of export bonds.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Cancellation of export bonds. 113.55 Section 113... export bonds. (a) Manner of cancellation. A bond to assure exportation as defined in § 101.1 of this... shall be signed by a revenue officer of the foreign country to which the merchandise is exported, unless...

A Simulation for Managing Complexity in Sales and Operations Planning Decisions

Science.gov (United States)

DuHadway, Scott; Dreyfus, David

2017-01-01

Within the classroom it is often difficult to convey the complexities and intricacies that go into making sales and operations planning decisions. This article describes an in-class simulation that allows students to gain hands-on experience with the complexities in making forecasting, inventory, and supplier selection decisions as part of the…

9 CFR 113.6 - Animal and Plant Health Inspection Service testing.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Animal and Plant Health Inspection Service testing. 113.6 Section 113.6 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Applicability § 113.6 Animal and Plant Health Inspection Service testing. A...

Red and orange laser operation of Pr:KYF4 pumped by a Nd:YAG/LBO laser at 469.1 nm and a InGaN laser diode at 444 nm.

Science.gov (United States)

Xu, B; Starecki, F; Pabœuf, D; Camy, P; Doualan, J L; Cai, Z P; Braud, A; Moncorgé, R; Goldner, Ph; Bretenaker, F

2013-03-11

We report the basic luminescence properties and the continuous-wave (CW) laser operation of a Pr(3+)-doped KYF(4) single crystal in the Red and Orange spectral regions by using a new pumping scheme. The pump source is an especially developed, compact, slightly tunable and intra-cavity frequency-doubled diode-pumped Nd:YAG laser delivering a CW output power up to about 1.4 W around 469.1 nm. At this pump wavelength, red and orange laser emissions are obtained at about 642.3 and 605.5 nm, with maximum output powers of 11.3 and 1 mW and associated slope efficiencies of 9.3% and 3.4%, with respect to absorbed pump powers, respectively. For comparison, the Pr:KYF(4) crystal is also pumped by a InGaN blue laser diode operating around 444 nm. In this case, the same red and orange lasers are obtained, but with maximum output powers of 7.8 and 2 mW and the associated slope efficiencies of 7 and 5.8%, respectively. Wavelength tuning for the two lasers is demonstrated by slightly tilting the crystal. Orange laser operation and laser wavelength tuning are reported for the first time.

Simultaneous qubit-loss-free fusion of three multiple W states

Science.gov (United States)

Wang, Meiyu; Hao, Quanzhi; Yan, Fengli; Gao, Ting

2018-05-01

Qubit-loss-free fusion for two W states introduced by Li K et al (2016 Phys. Rev. A 94 062315) clearly increases the final size of the obtained W state and greatly reduces the number of fusion steps to achieve a W state of a target size. Motivated by this idea, we propose a qubit-loss-free fusion scheme for fusing three polarization entangled W states simultaneously. The elements of a two-outcome positive-operator valued measurement and the appropriate joint unitary operation for realizing a positive-operator valued measurement measurement are given. As an example, with the assistance of weak cross-Kerr nonlinearities, an optical setup for fusing three W states is proposed. We analyze the success probability of the scheme and the resource cost of the present scheme, as compared to previous work.

Disruption and functional analysis of seven ORFs on chromosome IV: YDL057w, YDL012c, YDL010w, YDL009c, YDL008w (APC11), YDL005c (MED2) and YDL003w (MCD1).

Science.gov (United States)

Smith, K N; Iwanejko, L; Loeillet, S; Fabre, F; Nicolas, A

1999-09-15

In the context of the EUROFAN project, we have carried out the systematic disruption of seven ORFs on chromosome IV of Saccharomyces cerevisiae using the long flanking homology technique to replace each ORF with the KanMX cassette. Targeted disruption of YDL057w, YDL012c, or YDL010w with YDL009c (the two ORFs overlap) confers no overt defects in haploid growth on a variety of media at different temperatures, in mating, or in the sporulation of diploids homozygous for the disruption. By contrast, YDL008w and YDL003w disruptants are non-viable. The product of YDL008w (elsewhere identified as APC11) is a component of the anaphase promoting complex. YDL003w (also termed MCD1) is a homologue of Schizosaccharomyces pombe rad21, an essential gene implicated in DNA double-strand break repair and nuclear organization in fission yeast. In budding yeast, this ORF has been shown by several laboratories to encode a protein involved in sister chromatid cohesion and chromosome condensation. The remaining ORF, YDL005c (also termed MED2), encodes a component of the transcriptional activator complex known as Mediator. Disruption of YDL005c confers a modest slow growth phenotype on rich medium and a more severe phenotype on minimal medium, aberrant cellular morphology, and mating defects; diploids homozygous for the disruption cannot sporulate. Copyright 1999 John Wiley & Sons, Ltd.

Development of Si–W transient tolerant plasma facing material

Energy Technology Data Exchange (ETDEWEB)

Wong, C.P.C., E-mail: wongc@fusion.gat.com [General Atomics, PO Box 85608, San Diego, CA 92186-5608 (United States); Chen, B. [General Atomics, PO Box 85608, San Diego, CA 92186-5608 (United States); Hollmann, E.M.; Rudakov, D.L. [University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093-0417 (United States); Wall, D.; Tao, R. [General Atomics, PO Box 85608, San Diego, CA 92186-5608 (United States); Wright, M. [Ultramet, 12173 Montague Street, Pacoima, CA 91331 (United States)

2013-07-15

Solid W is projected as the preferred plasma facing material. Unfortunately, W surfaces could suffer radiation damage under DT operation and will melt under Type-I edge localized modes and disruption events. A possible approach is the use of a low-Z sacrificial material, like Si deposited on the W-surface to withstand a few type-I ELMs and/or disruptions via the vapor shielding effect. Accordingly, sets of Si–W test buttons were fabricated and exposed in the DIII-D lower divertor. We found that when the Si–W buttons were exposed to a few DIII-D vertical displacement event disruptions, tungsten–silicide was formed which melts at 1414 °C. This clearly indicates that the Si–W combination cannot be used as a transient tolerance surface material, since the W surface can be damaged. Even when Si is used as a wall conditioning material the Si–W surface temperature should be operated at much lower than 1400 °C.

Human endogenous retrovirus type W (HERV-W) in schizophrenia: a new avenue of research at the gene-environment interface.

Science.gov (United States)

Leboyer, Marion; Tamouza, Ryad; Charron, Dominique; Faucard, Raphaél; Perron, Hervé

2013-03-01

Provide a synthetic review of recent studies evidencing an association between human endogenous retrovirus-W (HERV-W) and schizophrenia. Bibliography analysis and contextual synthesis. Epidemiological studies suggest that the aetiology of schizophrenia is complex and involves a complex interplay of genetic and environmental factors such as infections. Eight percentof the human genome consists of human endogenous retroviruses (HERV), and this part of the genome was previously thought to be without importance, but new research has refuted this. HERVs share similarities with viruses and it is assumed that HERVs are present in the genome as a result of retroviruses infecting germ line cells many million years ago. A specific type of HERVs, called HERV-W, has through several recent studies been associated with schizophrenia. Elevated transcription of HERV-W elements has been documented, and antigens of HERV-W envelope and capsid proteins have been found in blood samples from patients. Viruses that have been implicated in pathology of schizophrenia, such as herpes and influenza, have been shown to activate HERV-W elements, and such activation has been associated with elevated biomarkers of systemic inflammation. New research indicates that HERV-W may be an important genetic factor interplaying with the environmental risk factor of infections and that, through this, HERV-W may be important for disease pathogenesis. A lifelong scenario of a detrimental interaction between infectious agents and HERV-W genes may decipher the actual development and course of schizophrenia. Further research is needed to find out if specific treatment strategies could reduce the expression of HERV-W and if this will be associated with remission.

Project W-211 Initial Tank Retrieval Systems (ITRS) Description of Operations for 241-AZ-102

Energy Technology Data Exchange (ETDEWEB)

BRIGGS, S.R.

2000-02-25

The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTs) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operation (DOO) defines the control philosophy for the waste retrieval system for Tank 241-AZ-102 (AZ-102). This DOO provides a basis for the detailed design of the Project W-211 Retrieval Control System (RCS) for AZ-102 and also establishes test criteria for the RCS.

Project W-211 Initial Tank Retrieval Systems (ITRS) Description of Operations for 241-AZ-102

International Nuclear Information System (INIS)

BRIGGS, S.R.

2000-01-01

The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTs) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operation (DOO) defines the control philosophy for the waste retrieval system for Tank 241-AZ-102 (AZ-102). This DOO provides a basis for the detailed design of the Project W-211 Retrieval Control System (RCS) for AZ-102 and also establishes test criteria for the RCS

Performance of 100-W HVM LPP-EUV source

Science.gov (United States)

Mizoguchi, Hakaru; Nakarai, Hiroaki; Abe, Tamotsu; Nowak, Krzysztof M.; Kawasuji, Yasufumi; Tanaka, Hiroshi; Watanabe, Yukio; Hori, Tsukasa; Kodama, Takeshi; Shiraishi, Yutaka; Yanagida, Tatsuya; Soumagne, Georg; Yamada, Tsuyoshi; Yamazaki, Taku; Okazaki, Shinji; Saitou, Takashi

2015-08-01

At Gigaphoton Inc., we have developed unique and original technologies for a carbon dioxide laser-produced tin plasma extreme ultraviolet (CO2-Sn-LPP EUV) light source, which is the most promising solution for high-power high-volume manufacturing (HVM) EUV lithography at 13.5 nm. Our unique technologies include the combination of a pulsed CO2 laser with Sn droplets, the application of dual-wavelength laser pulses for Sn droplet conditioning, and subsequent EUV generation and magnetic field mitigation. Theoretical and experimental data have clearly shown the advantage of our proposed strategy. Currently, we are developing the first HVM light source, `GL200E'. This HVM light source will provide 250-W EUV power based on a 20-kW level pulsed CO2 laser. The preparation of a high average-power CO2 laser (more than 20 kW output power) has been completed in cooperation with Mitsubishi Electric Corporation. Recently, we achieved 140 W at 50 kHz and 50% duty cycle operation as well as 2 h of operation at 100 W of power level. Further improvements are ongoing. We will report the latest status and the challenge to reach stable system operation of more than 100 W at about 4% conversion efficiency with 20-μm droplets and magnetic mitigation.

W-087 Operational test report. Revision 1

Energy Technology Data Exchange (ETDEWEB)

Joshi, A.W.

1997-06-10

This Acceptance Test Procedure/Operational Test Procedure (ATP/OTP) has been prepared to demonstrate that the Electrical/Instrumentation and Mechanical systems function as required by project criteria and to verify proper operation of the integrated system including the interlocks. The equipment to be tested includes the following: a. Leak detection system operation and controls. b. Electrical interlocks.- C. Transfer pump oper ation. d. Vacuum breaker system interlocks.

40 CFR 745.113 - Certification and acknowledgment of disclosure.

Science.gov (United States)

2010-07-01

... disclosure. 745.113 Section 745.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... may produce permanent neurological damage, including learning disabilities, reduced intelligence... required by § 745.110(a); or (ii) Waived the opportunity. (6) When one or more agents are involved in the...

Selecting a MAPLE research reactor core for 1-10 mW operation

International Nuclear Information System (INIS)

Smith, H.J.; Roy, M.-F.; Carlson, P.A.

1986-06-01

The MAPLE class of research reactors is designed so that a single reactor concept can satisfy a wide range of practical applications. This paper reports the results of physics studies performed on a number of potential core configurations fuelled with either 5 w/o or 8 w/o enriched UO 2 or 20 w/o U 3 Si-Al and assesses the relative merits of each. Recommended core designs are given to maximize the neutron fluxes available for scientific application and isotope production

Operational tests of the BNL 24.8 kW, 3.80K helium refrigerator

International Nuclear Information System (INIS)

Brown, D.P.; Farah, Y.; Gibbs, R.J.; Schlafke, A.P.; Sondericker, J.H.

1986-01-01

The BNL 24.8 kW refrigeration system is completely installed and major portions of the acceptance tests have been completed. So far, the equipment tested has performed at or above design levels. The room temperature helium compressor station has been completely tested and accepted. The two-stage oil injected screw compressor system exhibited an isothermal efficiency of 57% while delivering a helium flow in excess of 4400 g/s. Data on the performance of the make-up gas cryogenic purifier is also given. The refrigerator turbomachinery, 13 expanders and three cold compressors, has been tested at room temperature for mechanical integrity and control stability. The first cooldown to operating temperature will be attempted in late August, 1985

Induced codeposition of nanocrystalline Co-W coatings and their mechanical properties

International Nuclear Information System (INIS)

Belevskij, Stanislav

2012-01-01

The aim of the research: the complex investigation of induced codeposition mechanism of Co-W coatings obtaining from citrate electrolyte and determining the conditions of electrodeposition that provide the coatings the properties that could compete with the hard chromium electroplating coatings. The scientific novelty and originality of the work: for the first time it is demonstrated that citrate electrolyte used for electrodeposition of Co-W alloy is a mixture of complex compounds, whose composition is determined by the pH. At high pH values, its main component is hetero polynuclear complex with a molecular weight over 1200 g / mol. The totality of the results obtained by different methods (gel-chromatography, voltammetry, the methods of physicochemical hydrodynamics, determination of the composition of coatings, the current efficiency, etc.), can conclude that the chemical composition of electrodeposited Co-W coatings is determined by the hetero polynuclear complex composition on the one hand and the pH near-electrode layer on the other. However, the pH near-electrode layer depends on the rate of the parallel hydrogen evolution reaction (defined by the potential of electrodeposition and the hydrodynamic conditions). The increasing of the pH near-electrode layer shifts the chemical equilibrium toward to the formation of complex products with high molecular weight. It was confirmed the existence of hetero polynuclear Co-W-citrate complex compound, where the atomic ratio of Co:W is equal to 1:1. Solved scientific problem: The experimental proof of the fact that the formation of cobalt-tungsten coatings from citric electrolyte is the result of electrochemical reduction of polynuclear heterometallic complex. The research object is the chemical composition of citrate electrolyte (identification of the contained complexes) and induced codeposition of Co-W coatings from citrate electrolyte. The determination of the influence of the degree of the electrodeposition

Noncommutative analysis, operator theory and applications

CERN Document Server

Cipriani, Fabio; Colombo, Fabrizio; Guido, Daniele; Sabadini, Irene; Sauvageot, Jean-Luc

2016-01-01

This book illustrates several aspects of the current research activity in operator theory, operator algebras and applications in various areas of mathematics and mathematical physics. It is addressed to specialists but also to graduate students in several fields including global analysis, Schur analysis, complex analysis, C*-algebras, noncommutative geometry, operator algebras, operator theory and their applications. Contributors: F. Arici, S. Bernstein, V. Bolotnikov, J. Bourgain, P. Cerejeiras, F. Cipriani, F. Colombo, F. D'Andrea, G. Dell'Antonio, M. Elin, U. Franz, D. Guido, T. Isola, A. Kula, L.E. Labuschagne, G. Landi, W.A. Majewski, I. Sabadini, J.-L. Sauvageot, D. Shoikhet, A. Skalski, H. de Snoo, D. C. Struppa, N. Vieira, D.V. Voiculescu, and H. Woracek.

Effective field theory analysis of new physics in e{sup +}e{sup -}{yields}W{sup +}W{sup -} at a linear collider

Energy Technology Data Exchange (ETDEWEB)

Buchalla, G.; Cata, O.; Rahn, R. [Muenchen Univ. (Germany). Fakultaet fuer Physik; Schlaffer, M. [Muenchen Univ. (Germany). Fakultaet fuer Physik; Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)

2013-02-15

We analyze new physics contributions to e{sup +}e{sup -}{yields}W{sup +}W{sup -} at the TeV energy scale, employing an effective field theory framework. A complete basis of next-to-leading order operators in the standard model effective Lagrangian is used, both for the nonlinear and the linear realization of the electroweak sector. The elimination of redundant operators via equations-of-motion constraints is discussed in detail. Polarized cross sections for e{sup +}e{sup -}{yields}W{sup +}W{sup -} (on-shell) are computed and the corrections to the standard model results are given in an expansion for large s/M{sup 2}{sub W}. The dominant relative corrections grow with s and can be fully expressed in terms of modified gauge-fermion couplings. These corrections are interpreted in the context of the Goldstone boson equivalence theorem. Explicit new physics models are considered to illustrate the generation and the potential size of the coefficients in the effective Lagrangian. Brief comments are made on the production of W{sup +}W{sup -} pairs at the LHC.

9 CFR 113.42 - Detection of lymphocytic choriomeningitis contamination.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of lymphocytic choriomeningitis contamination. 113.42 Section 113.42 Animals and Animal Products ANIMAL AND PLANT HEALTH... contamination. The test for detection of lymphocytic choriomeningitis (LCM) virus provided in this section shall...

Rola leptyny w regulacji metabolizmu lipidów i węglowodanów

Directory of Open Access Journals (Sweden)

Patrycja Gogga*

2011-01-01

Full Text Available Leptyna jest białkiem wydzielanym głównie przez tkankę tłuszczową, a jej stężenie we krwi jest ściśle związane z ilością zapasów energetycznych zgromadzonych w adipocytach. Jako hormon leptyna ma niezwykle szeroki zakres działania. Białko to bezpośrednio lub za pośrednictwem układu współczulnego bierze udział w regulacji metabolizmu energetycznego. Leptyna hamuje biosyntezę triacylogliceroli w wątrobie i tkance tłuszczowej, a także w mięśniach szkieletowych, obniżając tym samym ilość odkładanych w nich lipidów. W adipocytach leptyna zmniejsza ekspresję genów kodujących syntazę kwasów tłuszczowych (FAS i karboksylazę acetylo-CoA (ACC – główne enzymy szlaku biosyntezy kwasów tłuszczowych. Zwiększa z kolei ekspresję genu kodującego lipazę zależną od hormonów (HSL, co stymuluje hydrolizę triacylogliceroli w tkance tłuszczowej. Ponadto leptyna wzmaga utlenianie kwasów tłuszczowych w adipocytach, mięśniach szkieletowych oraz w mięśniu sercowym, wywołując wzrost ekspresji genów kodujących podstawowe dla tego procesu enzymy, palmitoilotransferazę karnitynową 1 (CPT1 i dehydrogenazę acylo-CoA o średniej długości łańcucha (MCAD. Wykazano również, że hormon ten zwiększa wrażliwość tkanek na insulinę i poprawia tolerancję glukozy – pod wpływem leptyny wzrasta transport glukozy do komórek oraz intensywność glikolizy.Wiadomo, że leptyna bierze udział w długoterminowej regulacji pobierania pokarmu, jednak coraz więcej badań wskazuje, że ma ona również wpływ na przemiany substratów energetycznych w tkankach obwodowych. Leptyna może zatem kontrolować homeostaz�� energetyczną organizmu wywołując zmiany metabolizmu lipidów i węglowodanów, przede wszystkim w tkance tłuszczowej i w mięśniach.

Reductive trapping of [(OC){sub 5}W-W(CO){sub 5}]{sup 2-} in a mixed-valent Sm{sup II/III} calix[4]pyrrolide sandwich

Energy Technology Data Exchange (ETDEWEB)

Deacon, Glen B.; Guo, Zhifang [School of Chemistry, Monash University, VIC (Australia); Junk, Peter C.; Wang, Jun [College of Science and Engineering, James Cook University, Townsville, QLD (Australia)

2017-07-10

Reduction of tungsten hexacarbonyl by the divalent samarium(II) complex [Sm{sub 2}(N{sub 4}Et{sub 8})(thf){sub 4}] ((N{sub 4}Et{sub 8}){sup 4-}=meso-octaethylcalix[4]pyrrolide) in toluene at ambient temperature gave the remarkable heteronuclear mixed-valent samarium(II/III)/tungsten complex [{(thf)_2Sm"I"I(N_4Et_8)Sm"I"I"I(thf)}{sub 2}{(μ-OC)_2W_2(CO)_8}], which features the trapping of a rare [W{sub 2}(CO){sub 10}]{sup 2-} anion with an unsupported W-W bond. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

9 CFR 113.207 - Encephalomyelitis Vaccine, Eastern, Western, and Venezuelan, Killed Virus.

Science.gov (United States)

2010-01-01

..., Western, and Venezuelan, Killed Virus. 113.207 Section 113.207 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.207 Encephalomyelitis...

ECRH and W7-X: An intriguing pair

Science.gov (United States)

Erckmann, V.; Braune, H.; Gantenbein, G.; Jelonnek, J.; Kasparek, W.; Laqua, H. P.; Lechte, C.; Marushchenko, N. B.; Michel, G.; Plaum, B.; Thumm, M.; Weissgerber, M.; Wolf, R.; W7-X ECRH Teams

2014-02-01

The construction of the W7-X basic machine is almost completed and the device is approaching the commissioning phase. W7-X operation will be supported by ECRH working at 140 GHz in 2nd harmonic X- or O-mode with 10 MW cw power. Presently the activities at W7-X concentrate on the implementation of wall-armour, in-vessel components and diagnostics. The ECRH-system is in stand by with 5 out of 10 gyrotrons operational. The status of both, the W7-X device and the ECRH system is reported. Further R&D activities concentrate on extending the launching capability for sophisticated confinement investigations with remote steering launchers in a poloidal plane with weak magnetic field gradient.

[Operative treatment for complex tibial plateau fractures].

Science.gov (United States)

Song, Qi-Zhi; Li, Tao

2012-03-01

To explore the surgical methods and clinical evaluation of complex tibial plateau fractures resulted from high-energy injuries. From March 2006 to May 2009,48 cases with complex tibial plateau fractures were treated with open reduction and plate fixation, including 37 males and 11 females, with an average age of 37 years (ranged from 18 to 63 years). According to Schatzker classification, 16 cases were type IV, 20 cases type V and 12 cases type VI. All patients were examined by X-ray flim and CT scan. The function of knee joint were evaluated according to postoperative follow-up X-ray and Knee Merchant Rating. Forty-eight patients were followed up with a mean time of 14 months. According to Knee Merchant Rating, 24 cases got excellent results, 16 cases good, 6 cases fair and 2 cases poor. Appropriate operation time, anatomical reduction, suitable bone graft and reasonable rehabilitation exercises can maximally recovery the function of knee joint.

13 CFR 113.535 - Effect of state or local law or other requirements.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Effect of state or local law or other requirements. 113.535 Section 113.535 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... obligation to comply with §§ 113.500 through 113.550 is not obviated or alleviated by the existence of any...

Commissioning and Operational Experience with 1 kW Class Helium Refrigerator/Liquefier for SST-1

Science.gov (United States)

Dhard, C. P.; Sarkar, B.; Misra, Ruchi; Sahu, A. K.; Tanna, V. L.; Tank, J.; Panchal, P.; Patel, J. C.; Phadke, G. D.; Saxena, Y. C.

2004-06-01

The helium refrigerator/liquefier (R/L) for the Steady State Super conducting Tokamak (SST-1) has been developed with very stringent specifications for the different operational modes. The total refrigeration capacity is 650 W at 4.5 K and liquefaction capacity of 200 l/h. A cold circulation pump is used for the forced flow cooling of 300 g/s supercritical helium (SHe) for the magnet system (SCMS). The R/L has been designed also to absorb a 200 W transient heat load of the SCMS. The plant consists of a compressor station, oil removal system, on-line purifier, Main Control Dewar (MCD) with associated heat exchangers, cold circulation pump and warm gas management system. An Integrated Flow Control and Distribution System (IFDCS) has been designed, fabricated and installed for distribution of SHe in the toroidal and poloidal field coils as well as liquid helium for cooling of 10 pairs of current leads. A SCADA based control system has been designed using PLC for R/L as well as IFDCS. The R/L has been commissioned and required parameters were achieved confirming to the process. All the test results and commissioning experiences are discussed in this paper.

Linear Time Logics around PSL: Complexity, Expressiveness, and a little bit of Succinctness

DEFF Research Database (Denmark)

Lange, Martin

2007-01-01

We consider linear time temporal logic enriched with semi-extended regular expressions through various operators that have been proposed in the literature, in particular in Accelera's Property Specification Language. We obtain results about the expressive power of fragments of this logic when...... restricted to certain operators only: basically, all operators alone suffice for expressive completeness w.r.t.\\ omega-regular expressions, just the closure operator is too weak. We also obtain complexity results. Again, almost all operators alone suffice for EXPSPACE-completeness, just the closure operator...

14 CFR 1221.113 - Use of the NASA Flags.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Use of the NASA Flags. 1221.113 Section 1221.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION THE NASA SEAL AND OTHER DEVICES, AND THE CONGRESSIONAL SPACE MEDAL OF HONOR NASA Seal, NASA Insignia, NASA Logotype, NASA Program...

27 CFR 22.113 - Receipt of tax-free alcohol.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Receipt of tax-free alcohol. 22.113 Section 22.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTRIBUTION AND USE OF TAX-FREE ALCOHOL Withdrawal and...

STS-107 M.S. Laurel Clark during TCDT M113 training activities

Science.gov (United States)

2002-01-01

KENNEDY SPACE CENTER, FLA. -- STS-107 Mission Specialist Laurel Clark (in yellow cap) is instructed on the operation of an M113 armored personnel carrier during Terminal Countdown Demonstration Test activities, a standard part of launch preparations. STS-107 is a mission devoted to research and will include more than 80 experiments that will study Earth and space science, advanced technology development, and astronaut health and safety. Launch is planned for Jan. 16, 2003, between 10 a.m. and 2 p.m. EST aboard Space Shuttle Columbia.

9 CFR 113.55 - Detection of extraneous agents in Master Seed Virus.

Science.gov (United States)

2010-01-01

... Master Seed Virus. 113.55 Section 113.55 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Ingredient Requirements § 113.55 Detection of extraneous agents in Master Seed Virus...

Young Stellar Objects in the Massive Star-forming Regions W51 and W43

Energy Technology Data Exchange (ETDEWEB)

Saral, G.; Audard, M. [Department of Astronomy, University of Geneva, Ch. d’Ecogia 16, 1290 Versoix (Switzerland); Hora, J. L.; Martínez-Galarza, J. R.; Smith, H. A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Koenig, X. P. [Yale University, Department of Astronomy, 208101, New Haven, CT 06520-8101 (United States); Motte, F. [Institut de Plantologie et d’Astrophysique de Grenoble, Univ. Grenoble Alpes—CNRS-INSU, BP 53, F-38041 Grenoble Cedex 9 (France); Nguyen-Luong, Q. [National Astronomical Observatory of Japan, Chile Observatory, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Saygac, A. T. [Istanbul University, Faculty of Science, Astronomy and Space Sciences Department, Istanbul-Turkey (Turkey)

2017-04-20

We present the results of our investigation of the star-forming complexes W51 and W43, two of the brightest in the first Galactic quadrant. In order to determine the young stellar object (YSO) populations in W51 and W43 we used color–magnitude relations based on Spitzer mid-infrared and 2MASS/UKIDSS near-infrared data. We identified 302 Class I YSOs and 1178 Class II/transition disk candidates in W51, and 917 Class I YSOs and 5187 Class II/transition disk candidates in W43. We also identified tens of groups of YSOs in both regions using the Minimal Spanning Tree (MST) method. We found similar cluster densities in both regions, even though Spitzer was not able to probe the densest part of W43. By using the Class II/I ratios, we traced the relative ages within the regions and, based on the morphology of the clusters, we argue that several sites of star formation are independent of one another in terms of their ages and physical conditions. We used spectral energy distribution-fitting to identify the massive YSO (MYSO) candidates since they play a vital role in the star formation process, and then examined them to see if they are related to any massive star formation tracers such as UCH ii regions, masers, or dense fragments. We identified 17 MYSO candidates in W51, and 14 in W43, respectively, and found that groups of YSOs hosting MYSO candidates are positionally associated with H ii regions in W51, though we do not see any MYSO candidates associated with previously identified massive dense fragments in W43.

7 CFR 760.113 - Refunds; joint and several liability.

Science.gov (United States)

2010-01-01

... 7 Agriculture 7 2010-01-01 2010-01-01 false Refunds; joint and several liability. 760.113 Section... Agricultural Disaster Assistance Programs § 760.113 Refunds; joint and several liability. (a) In the event that... provided that interest will in all cases run from the date of the original disbursement. (b) All persons...

on differential operators on w 1,2 space and fredholm operators

African Journals Online (AJOL)

A selfadjoint differential operator defined over a closed and bounded interval on Sobolev space which is a dense linear subspace of a Hilbert space over the same interval is considered and shown to be a Fredholm operator with index zero. KEY WORDS: Sobolev space, Hilbert space, dense subspace, Fredholm operator

Application of REVEAL-W to risk-based configuration control

International Nuclear Information System (INIS)

Dezfuli, H.; Meyer, J.; Modarres, M.

1994-01-01

Over the past two years, the concept of risk-based configuration control has been introduced to the US Nuclear Regulatory Commission and the nuclear industry. Converting much of the current, deterministically based regulation of nuclear power plants to risk-based regulation can result in lower levels of risk while relieving unnecessary burdens on power plant operators and regulatory staff. To achieve the potential benefits of risk-based configuration control, the risk models developed for nuclear power plants should be (1) flexible enough to effectively support necessary risk calculations, and (2) transparent enough to encourage their use by all parties. To address these needs, SCIENTECH, Inc., has developed the PC-based REVEAL W (formerly known as SMART). This graphic-oriented and user-friendly application software allows the user to develop transparent complex logic models based on the concept of the master plant logic diagram. The logic model is success-oriented and compact. The analytical capability built into REVEAL W is generic, so the software can support different types of risk-based evaluations, such as probabilistic safety assessment, accident sequence precursor analysis, design evaluation and configuration management. In this paper, we focus on the application of REVEAL W to support risk-based configuration control of nuclear power plants. (author)

Operational tests of the BNL 24.8 kW, 3.8 K helium refrigerator

International Nuclear Information System (INIS)

Brown, D.P.; Farah, Y.; Gibbs, R.J.

1985-01-01

The BNL 24.8 kW refrigeration system is completely installed and major portions of the acceptance tests have been completed. So far, the equipment tested has performed at or above design levels. The room temperature helium compressor station has been completely tested and accepted. The two-stage oil injected screw compressor system exhibited an isothermal efficiency of 57% while delivering a helium flow in excess of 4400 g/s. Data on the performance of the make-up gas cryogenic purifier is given. The refrigerator turbomachinery, 13 expanders and three cold compressors, has been tested at room temperature for mechanical integrity and control stability. The first cooldown to operating temperature will be attempted in late August, 1985. 2 refs., 5 figs

Time cycle calculation procedure for the special crew during the mining mobile machine complex operation

International Nuclear Information System (INIS)

Shmurygin, V; Lukyanov, V; Maslovsky, A

2015-01-01

The relevance of the research is specified by the necessity to optimize the delft mobile tunneling equipment operation. Target of the research is tunneling time cycle justification for the special crew during the mining mobile machine complex operation. Methods of the research included the consideration of operation organization schemes in the drifting face and effective use of the mobile equipment during mine exploratory working operations. Time cycle calculation procedures for major processes have been considered. This has been done for the special crew during the mobile machine complex operations for several working faces and various organization schemes

113Cd NMR as a Probe of the Active Sites of Metalloenzymes

NARCIS (Netherlands)

Armitage, Ian M.; Schoot Uiterkamp, Antonius J.M.; Chlebowski, Jan F.; Coleman, Joseph E.

1978-01-01

113Cd NMR has been used to study the active site metal ion(s) of the 113Cd(II) derivatives of four Zn(II) metalloenzymes, carboxypeptidase A, carbonic anhydrases, alkaline phosphatase, and superoxide dismutase. The resonances of the enzyme-bound 113Cd(II) ions are extremely sensitive to ligand

13 CFR 113.425 - Counseling and use of appraisal and counseling materials.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Counseling and use of appraisal and counseling materials. 113.425 Section 113.425 Business Credit and Assistance SMALL BUSINESS... Activities Prohibited § 113.425 Counseling and use of appraisal and counseling materials. (a) Counseling. A...

Application of World Wide Web (W3) Technologies in Payload Operations

Science.gov (United States)

Sun, Charles; Windrem, May; Picinich, Lou

1996-01-01

World Wide Web (W3) technologies are considered in relation to their application to space missions. It is considered that such technologies, including the hypertext transfer protocol and the Java object-oriented language, offer a powerful and relatively inexpensive framework for distributed application software development. The suitability of these technologies for payload monitoring systems development is discussed, and the experience gained from the development of an insect habitat monitoring system based on W3 technologies is reported.

Operating experience with a 250 kW el molten carbonate fuel cell (MCFC) power plant

Science.gov (United States)

Bischoff, Manfred; Huppmann, Gerhard

The MTU MCFC program is carried out by a European consortium comprising the German companies MTU Friedrichshafen GmbH, Ruhrgas AG and RWE Energie AG as well as the Danish company Energi E2 S/A. MTU acts as consortium leader. The company shares a license and technology exchange agreement with Fuel Cell Energy Inc., Danbury, CT, USA (formerly Energy Research Corp., ERC). The program was started in 1990 and covers a period of about 10 years. The highlights of this program to date are: Considerable improvements regarding component stability have been demonstrated on laboratory scale. Manufacturing technology has been developed to a point which enables the consortium to fabricate the porous components on a 250 cm 2 scale. Several large area stacks with 5000-7660 cm 2 cell area and a power range of 3-10 kW have been tested at the facilities in Munich (Germany) and Kyndby (Denmark). These stacks have been supplied by FCE. As far as the system design is concerned it was soon realized that conventional systems do not hold the promise for competitive power plants. A system analysis led to the conclusion that a new innovative design approach is required. As a result the "Hot Module" system was developed by the consortium. A Hot Module combines all the components of a MCFC system operating at the similar temperatures and pressures into a common thermally insulated vessel. In August 1997 the consortium started its first full size Hot Module MCFC test plant at the facilities of Ruhrgas AG in Dorsten, Germany. The stack was assembled in Munich using 292 cell packages purchased from FCE. The plant is based on the consortium's unique and proprietary "Hot Module" concept. It operates on pipeline natural gas and was grid connected on 16 August 1997. After a total of 1500 h of operation, the plant was intentionally shut down in a controlled manner in April 1998 for post-test analysis. The Hot Module system concept has demonstrated its functionality. The safety concept has been

A noncommutative mean ergodic theorem for partial W*-dynamical semigroups

International Nuclear Information System (INIS)

Ekhaguere, G.O.S.

1992-12-01

A noncommutative mean ergodic theorem for dynamical semigroups of maps on partial W*-algebras of linear operators from a pre-Hilbert space into its completion is proved. This generalizes a similar result of Watanabe for dynamical semigroups of maps on W*-algebras of operators. (author). 14 refs

9 CFR 113.25 - Culture media for detection of bacteria and fungi.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Culture media for detection of bacteria and fungi. 113.25 Section 113.25 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Standard Procedures § 113.25 Culture media for detection of bacteria and fungi. (a...

340 Facility Secondary Containment and Leak Detection Project W-302 Functional Design Criteria

Energy Technology Data Exchange (ETDEWEB)

Stordeur, R.T.

1995-03-01

This functional design criteria for the upgrade to the 340 radioactive liquid waste storage facility (Project W-302) specifically addresses the secondary containment issues at the current vault facility of the 340 Complex. This vault serves as the terminus for the Radioactive Liquid Waste System (RLWS). Project W-302 is necessary in order to bring this portion of the Complex into full regulatory compliance. The project title, ``340 Facility Secondary Containment and Leak Detection``, illustrates preliminary thoughts of taking corrective action directly upon the existing vault (such as removing the tanks, lining the vault, and replacing tanks). However, based on the conclusion of the engineering study, ``Engineering Study of the 300 Area Process Wastewater Handling System``, WHC-SD-WM-ER-277 (as well as numerous follow-up meetings with cognizant staff), this FDC prescribes a complete replacement of the current tank/vault system. This offers a greater array of tanks, and provides greater operating flexibility and ease of maintenance. This approach also minimizes disruption to RLWS services during ``tie-in``, as compared to the alternative of trying to renovate the old vault. The proposed site is within the current Complex area, and maintains the receipt of RLWS solutions through gravity flow.

Beta-delayed proton emitter $^{113}Xe$

CERN Document Server

Hagberg, E; Jonson, B; Jørgensen, B; Kugler, E; Mowinckel, T

1973-01-01

The ISOLDE facility at the CERN synchrocyclotron has been used for extending the series of beta -delayed proton emitters in xenon to masses lighter than those previously observed (/sup 115,117/Xe). Owing to the rapid decrease of the yields, experiments with solid-state counters were inconclusive, and instead a new and much more sensitive method based on nuclear emulsions was developed. The mass range 111-114 showed one new activity, /sup 113/Xe, with a half-life of 2.8+or-0.2 sec. From measurements of the track lengths for a total of 1130 protons from /sup 113/Xe it was possible to determine the energy spectrum. The results extend the systematics of beta -strength functions in the light xenon isotopes. (19 refs).

19 CFR 113.1 - Authority to require security or execution of bond.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Authority to require security or execution of bond. 113.1 Section 113.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS General Provisions § 113.1 Authority to require security or...

Properties of emulsions stabilised by sodium caseinate–chitosan complexes

NARCIS (Netherlands)

Zinoviadou, K.; Scholten, E.; Moschakis, T.; Biliaderis, C.G.

2012-01-01

Oil-in-water emulsions (10%, w/w, oil) were prepared at pH 5.7 by using electrostatically formed complexes of 0.5% (w/w) sodium caseinate (Na-CAS) and 0–0.6% (w/w) chitosan. Emulsions stabilized by complexes with increased levels of chitosan (>0.2% w/w) had a smaller average droplet size and

The operators' non-compliance behavior to conduct emergency operating procedures--comparing with the work experience and the complexity of procedural steps

International Nuclear Information System (INIS)

Park, Jinkyun; Jung, Wondea

2003-01-01

Many kinds of procedures have been used to reduce the operators' workload throughout various industries, such as in the aviation, the chemical and the nuclear industry. It is remarkable that, however, significant portion of accidents or incidents was caused by procedure related human error due to non-compliance of procedures. In this study, to investigate the operators' non-compliance behavior, emergency-training records were collected using a full scope simulator. And three types of the operators' behavior (such as strict adherence, skipping redundant actions and modifying action sequences) observed from collected emergency training records were compared with both their work experience and the complexity of procedural steps. As the results, three remarkable relationships are obtained. They are: (1) the operators who have an intermediate work experience seem to frequently adopt non-compliance behavior to conduct the procedural steps, (2) the operators seem to frequently adopt non-compliance behavior to conduct the procedural steps that have an intermediate procedural complexity, and (3) the senior reactor operators seem to accommodate their non-compliance behavior based on the complexity of procedural steps. Therefore, it is expected that these relationships can be used as meaningful clues not only to scrutinize the reason for non-compliance behavior but also to suggest appropriate remedies for the reduction of non-compliance behavior that can result in procedure related human error

W-Band Sheet Beam Klystron Design

International Nuclear Information System (INIS)

Scheitrum, G.; Caryotakis, G.; Burke, A.; Jensen, A.; Jongewaard, E.; Krasnykh, A.; Neubauer, M.; Phillips, R.; Rauenbuehler, K.

2011-01-01

Sheet beam devices provide important advantages for very high power, narrow bandwidth RF sources like accelerator klystrons (1). Reduced current density and increased surface area result in increased power capabi1ity, reduced magnetic fields for focusing and reduced cathode loading. These advantages are offset by increased complexity, beam formation and transport issues and potential for mode competition in the ovennoded cavities and drift tube. This paper will describe the design issues encountered in developing a 100 kW peak and 2 kW average power sheet beam k1ystron at W-band including beam formation, beam transport, circuit design, circuit fabrication and mode competition.

13 CFR 113.135 - Designation of responsible employee and adoption of grievance procedures.

Science.gov (United States)

2010-01-01

... employee and adoption of grievance procedures. 113.135 Section 113.135 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE PROGRAMS OF SBA-EFFECTUATION OF POLICIES... Programs or Activities Receiving Federal Financial Assistance Introduction § 113.135 Designation of...

Tank 241-TX-113 rotary mode core sampling and analysis plan

International Nuclear Information System (INIS)

McCain, D.J.

1998-01-01

This sampling and analysis plan (SAP) identities characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for push mode core samples from tank 241-TX-113 (TX-113). The Tank Characterization Technical Sampling Basis document identities Retrieval, Pretreatment and Immobilization as an issue that applies to tank TX-113. As a result, a 150 gram composite of solids shall be made and archived for that program. This tank is not on a Watch List

Tests to determine the release of short-lived fission products from UO2 fuel operating at linear powers of 45 and 60 kW/m

International Nuclear Information System (INIS)

Hastings, I.J.; Hunt, C.E.L.; Lipsett, J.J.; MacDonald, R.D.

1985-09-01

Experiments have been carried out using a 'sweep gas' technique to determine the behaviour of short-lived fission products within operating, intact UO 2 fuel elements. The Zircaloy-4-clad elements were 600 mm long and contained fuel of density 10.65 - 10.71 Mg/m 3 . A He-2% H 2 carrier gas swept gaseous or volatile fission products out of the operating fuel element past a gamma spectrometer for measurement. We outline our loop model and give full details of calculational procedures. In tests at linear powers of 45 (FIO-122) and 60 kW/m (FIO-124) to a maximum burnup of 80 MW.h/kg U, the species measured directly at the spectrometer during normal operation were generally the short-lived xenons and kryptons. Iodines were not observed during normal operation. The behaviour of I-133 and I-135 was deduced from the decay of Xe-133 and Xe-135 during reactor shutdowns. Plots of R/B (released/born) against λ (decay constant) or effective λ for all isotopes observed at 45 and 60 kW/m show that a line of slope -0.5, corresponding with diffusion kinetics, is a good fit to the measured xenon and krypton data. The inferred release of iodine fits the same line. From this we can extrapolate to an R/B for I-131 of about 5 x 10 -4 at 45 kW/m, and 3 x 10 -3 at 60 kW/m. Both tests were terminated by defects. Under defect conditions, R/B dependence on λ was about 0.6. I-131 release under defect conditions was 5 Ci and 60 mCi for FIO-122 and FI0-124, respectively. 22 refs

Complexity analysis of the Next Gen Air Traffic Management System: trajectory based operations.

Science.gov (United States)

Lyons, Rhonda

2012-01-01

According to Federal Aviation Administration traffic predictions currently our Air Traffic Management (ATM) system is operating at 150 percent capacity; forecasting that within the next two decades, the traffic with increase to a staggering 250 percent [17]. This will require a major redesign of our system. Today's ATM system is complex. It is designed to safely, economically, and efficiently provide air traffic services through the cost-effective provision of facilities and seamless services in collaboration with multiple agents however, contrary the vision, the system is loosely integrated and is suffering tremendously from antiquated equipment and saturated airways. The new Next Generation (Next Gen) ATM system is designed to transform the current system into an agile, robust and responsive set of operations that are designed to safely manage the growing needs of the projected increasingly complex, diverse set of air transportation system users and massive projected worldwide traffic rates. This new revolutionary technology-centric system is dynamically complex and is much more sophisticated than it's soon to be predecessor. ATM system failures could yield large scale catastrophic consequences as it is a safety critical system. This work will attempt to describe complexity and the complex nature of the NextGen ATM system and Trajectory Based Operational. Complex human factors interactions within Next Gen will be analyzed using a proposed dual experimental approach designed to identify hazards, gaps and elicit emergent hazards that would not be visible if conducted in isolation. Suggestions will be made along with a proposal for future human factors research in the TBO safety critical Next Gen environment.

Young stellar population and star formation history ofW4 HII region/Cluster Complex

Science.gov (United States)

Panwar, Neelam

2018-04-01

The HII region/cluster complex has been a subject of numerous investigations to study the feedback effect of massive stars on their surroundings. Massive stars not only alter the morphology of the parental molecular clouds, but also influence star formation, circumstellar disks and the mass function of low-mass stars in their vicinity. However, most of the studies of low-mass stellar content of the HII regions are limited only to the nearby regions. We study the star formation in the W4 HII region using deep optical observations obtained with the archival data from Canada - France - Hawaii Telescope, Two-Micron All Sky Survey, Spitzer, Herschel and Chandra. We investigate the spatial distribution of young stellar objects in the region, their association with the remnant molecular clouds, and search for the clustering to establish the sites of recent star formation. Our analysis suggests that the influence of massive stars on circumstellar disks is significant only to thei! r immediate neighborhood. The spatial correlation of the young stars with the distribution of gas and dust of the complex indicate that the clusters would have formed in a large filamentary cloud. The observing facilities at the 3.6-m Devasthal Optical Telescope (DOT), providing high-resolution spectral and imaging capabilities, will fulfill the major objectives in the study of HII regions.

Tank farm restoration and safe operation, Project W-314, upgrade scope summary report (USSR)

International Nuclear Information System (INIS)

Gilbert, J.L.

1998-01-01

The revision to the Project W-314 Upgrade Scope Summary Report (USSR), incorporates changes to the project scope from customer guidance. Included are incorporation of the recommendations from HNF-2500, agreements regarding interfaces with Project W-211, and assumption of scope previously assigned to Project W-454

9 CFR 113.215 - Bovine Virus Diarrhea Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bovine Virus Diarrhea Vaccine, Killed Virus. 113.215 Section 113.215 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD...

Lac repressor: Crystallization of intact tetramer and its complexes with inducer and operator DNA

International Nuclear Information System (INIS)

Pace, H.C.; Lu, P.; Lewis, M.

1990-01-01

The intact lac repressor tetramer, which regulates expression of the lac operon in Escherichia coli, has been crystallized in the native form, with an inducer, and in a ternary complex with operator DNA and an anti-inducer. The crystals without DNA diffract to better than 3.5 angstrom. They belong to the monoclinic space group C2 and have cell dimensions a = 164.7 angstrom, b = 75.6 angstrom, and c = 161.2 angstrom, with α = γ = 90 degree and β = 125.5 degree. Cocrystals have been obtained with a number of different lac operator-related DNA fragments. The complex with a blunt-ended 16-base-pair strand yielded tetragonal bipyramids that diffract to 6.5 angstrom. These protein-DNA cocrystals crack upon exposure to the gratuitous inducer isopropyl β-D-thiogalactoside, suggesting a conformational change in the repressor-operator complex

Influence of step complexity and presentation style on step performance of computerized emergency operating procedures

Energy Technology Data Exchange (ETDEWEB)

Xu Song [Department of Industrial Engineering, Tsinghua University, Beijing 100084 (China); Li Zhizhong [Department of Industrial Engineering, Tsinghua University, Beijing 100084 (China)], E-mail: zzli@tsinghua.edu.cn; Song Fei; Luo Wei; Zhao Qianyi; Salvendy, Gavriel [Department of Industrial Engineering, Tsinghua University, Beijing 100084 (China)

2009-02-15

With the development of information technology, computerized emergency operating procedures (EOPs) are taking the place of paper-based ones. However, ergonomics issues of computerized EOPs have not been studied adequately since the industrial practice is quite limited yet. This study examined the influence of step complexity and presentation style of EOPs on step performance. A simulated computerized EOP system was developed in two presentation styles: Style A: one- and two-dimensional flowcharts combination; Style B: two-dimensional flowchart and success logic tree combination. Step complexity was quantified by a complexity measure model based on an entropy concept. Forty subjects participated in the experiment of EOP execution using the simulated system. The results of data analysis on the experiment data indicate that step complexity and presentation style could significantly influence step performance (both step error rate and operation time). Regression models were also developed. The regression analysis results imply that operation time of a step could be well predicted by step complexity while step error rate could only partly predicted by it. The result of a questionnaire investigation implies that step error rate was influenced not only by the operation task itself but also by other human factors. These findings may be useful for the design and assessment of computerized EOPs.

Formation of W(3)A(1) electron-transferring flavoprotein (ETF) hydroquinone in the trimethylamine dehydrogenase x ETF protein complex.

Science.gov (United States)

Jang, M H; Scrutton, N S; Hille, R

2000-04-28

The electron-transferring flavoprotein (ETF) from Methylophilus methylotrophus (sp. W(3)A(1)) exhibits unusual oxidation-reduction properties and can only be reduced to the level of the semiquinone under most circumstances (including turnover with its physiological reductant, trimethylamine dehydrogenase (TMADH), or reaction with strong reducing reagents such as sodium dithionite). In the present study, we demonstrate that ETF can be reduced fully to its hydroquinone form both enzymatically and chemically when it is in complex with TMADH. Quantitative titration of the TMADH x ETF protein complex with sodium dithionite shows that a total of five electrons are taken up by the system, indicating that full reduction of ETF occurs within the complex. The results indicate that the oxidation-reduction properties of ETF are perturbed upon binding to TMADH, a conclusion further supported by the observation of a spectral change upon formation of the TMADH x ETF complex that is due to a change in the environment of the FAD of ETF. The results are discussed in the context of ETF undergoing a conformational change during formation of the TMADH x ETF electron transfer complex, which modulates the spectral and oxidation-reduction properties of ETF such that full reduction of the protein can take place.

Cold H I clouds near the supernova remnant W44

International Nuclear Information System (INIS)

Sato, F.

1986-01-01

The cold H I clouds near the supernova remnant W44 are investigated by the use of the Maryland-Green Bank Survey (Westerhout 1973). Several clouds with a mean diameter of about 20 pc are distributed in the region. They do not seem to make a shell around W44, contrary to the suggestion by Knapp and Kerr (1974) based on the low-resolution data at coarse grids. Some of them form a chain, about 100 pc in length, extending approximately along the galactic equator. It resembles the cold H I cloud near W3 and W4. The major constituent of the clouds is probably the hydrogen molecule, and the total mass of the entire complex amounts to 25,000 81,000 solar masses. The estimated Jeans mass indicates that they will contract to dense molecular clouds. Therefore, it may safely be concluded that the cold H1 cloud complex near W44 is a giant molecular cloud at an early evolutionary stage. 14 references

Visualization of vasculature with 113mIn-trichloride as a means of differential diagnosis of focal processes in the liver

International Nuclear Information System (INIS)

Romanova, A.; Kaneti, Ya.; Ivanov, Kh.

1977-01-01

To raise the specific character of the scintigraphic changes in the liver the authors suggest a two-stage scintigraphy: colloidal, followed by scintigraphy with 113mIn-trichloride, which, administerd intravenously, binds with the blood serum transferrin and vizializes the liver vasculature. A total of 153 patients with focal lesions in the liver were examined. Scintigraphy with 113mIn-trichloride was performed immediately or some time after the colloidal one. Comparison with operative, post mortem and laparoscopic data was attempted in 93 patients; there was lack of coincidence in two patients. The high percentage of coincidence (98%) is an indication of very high effectiveness on the method. (author)

COMPOEX Technology to Assist Leaders in Planning and Executing Campaigns in Complex Operational Environments

National Research Council Canada - National Science Library

Kott, Alexander; Corpac, Peter S

2007-01-01

... in a complex operational environment. Leaders must understand the operational environment, develop campaign plans that include multiple lines of effort such as security, governance, political-economic development, rule of law and employ...

Enzyme-mediated bacterial biodegradation of an azo dye (C.I. Acid blue 113): reuse of treated dye wastewater in post-tanning operations.

Science.gov (United States)

Senthilvelan, T; Kanagaraj, J; Panda, R C

2014-11-01

"Dyeing" is a common practice used to color the hides during the post-tanning operations in leather processing generating plenty of wastewater. The waste stream containing dye as pollutant is severely harmful to living beings. An azo dye (C.I. Acid Blue 113) has been biodegraded effectively by bacterial culture mediated with azoreductase enzyme to reduce the pollution load in the present investigation. The maximum rate of dye degradation was found to be 96 ± 4 and 92 ± 4 % for the initial concentrations of 100 and 200 mg/l, respectively. The enzyme activity was measured using NADH as a substrate. Fourier transform infrared spectroscopy (FT-IR) analysis was confirmed that the transformation of azo linkage could be transformed into N2 or NH3 or incorporated into complete biomass. Breaking down of dye molecules to various metabolites (such as aniline, naphthalene-1,4-diamine, 3-aminobenzenesulfonic acid, naphthalene-1-sulfonic acid, 8-aminonaphthalene-1-sulfonic acid, 5,8-diaminonaphthalene-1-sulfonic acid) was confirmed by gas chromatography and mass spectra (GC-MS) and mass (electrospray ionization (ESI)) spectra analysis. The treated wastewater could be reused for dyeing operation in the leather processing, and the properties of produced leather were evaluated by conventional methods that revealed to have improved dye penetration into the grain layer of experimental leather sample and resulted in high levelness of dyeing, which helps to obtain the desired smoothness and soft leather properties.

Natural bond orbital analysis of molecular interactions: Theoretical study of W(CO)5 complexes with E(PH3)2 and NHEMe ligands (E=C, Si, Ge, Sn, Pb)

International Nuclear Information System (INIS)

Nguyen Thi Ai Nhung; Huynh Thi Phuong Loan; Duong Tuan Quang; Pham Van Tat

2014-01-01

The complexes with ligands carbodiphosphorane-analogues (called tetrylones) [(CO) 5 W-{E(PH 3 ) 2 }] (W5-EP 2 ) and N-heterocyclic carbene-analogues (called tetrylenes) [(CO) 5 W-{NHE Me }] (W5-NHE Me ) when E=C-Pb have been studied using natural bond orbital (NBO) method. The NBO analysis provides a consistent picture of the chemical bonding is two entire families of transition metal complexes of tetrylone and tetrylene ligands in term of donor-acceptor interactions, showing the correlation of these interactions with Wiberg bond indies (WBI), natural partial charges, and the energetically highest lying occupied molecular orbitals for σ and π orbitals of free ligands E(PH 3 ) 2 and NHE Me . Analysis of the bonding situation reveals that in E(PH 3 ) 2 and NHE Me ligands, the energy level of the π orbital rises, whereas that of the σ orbital decreases as atom E becomes heavier. The complexes with head-on-bonded ligands have (CO) 5 W←E donation which comes from the σ-lone-pair orbital of E(PH 3 ) 2 and NHE Me where E=C for tetrylones and E=C, Si, Ge for tetrylenes, whereas the (CO) 5 W←E donation in the side-on bonded complexes when E becomes heavier arises from the π-lone-pair orbital of E(PH 3 ) 2 and NHE Me ligands which is the HOMO of the free ligands. This makes the heavier adducts of tetrylones and tetrylenes become stronger donors than the lighter systems. The NBO analysis suggests that the E(PH 3 ) 2 ligands are strong σ-donors and strong π-acceptors while the NHE Me ligands are strong σ-donors and weak π-acceptors. This is possible for tetrylones that have two lone-pair orbitals available for donation, whereas the tetrylenes have only one lone-pair orbital available for donation. (author)

Employing industrial standards in software engineering for W7X

Energy Technology Data Exchange (ETDEWEB)

Kuehner, Georg [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, Teilinstitut Greifswald, Wendelsteinstrasse 1, D-17491 Greifswald (Germany)], E-mail: kuehner@ipp.mpg.de; Bluhm, Torsten [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, Teilinstitut Greifswald, Wendelsteinstrasse 1, D-17491 Greifswald (Germany); Heimann, Peter [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, Boltzmannstrasse 2, D-85748 Garching (Germany); Hennig, Christine [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, Teilinstitut Greifswald, Wendelsteinstrasse 1, D-17491 Greifswald (Germany); Kroiss, Hugo [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, Boltzmannstrasse 2, D-85748 Garching (Germany); Krueger, Alexander [University of Applied Sciences, Schwedenschanze 135, 18435 Stralsund (Germany); Laqua, Heike; Lewerentz, Marc [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, Teilinstitut Greifswald, Wendelsteinstrasse 1, D-17491 Greifswald (Germany); Maier, Josef [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, Boltzmannstrasse 2, D-85748 Garching (Germany); Riemann, Heike; Schacht, Joerg; Spring, Anett; Werner, Andreas [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, Teilinstitut Greifswald, Wendelsteinstrasse 1, D-17491 Greifswald (Germany); Zilker, Manfred [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, Boltzmannstrasse 2, D-85748 Garching (Germany)

2009-06-15

The stellarator W7X is a large complex experiment designed for continuous operation and planned to be operated for about 20 years. Software support is highly demanded for experiment preparation, operation and data analysis which in turn induces serious non-functional requirements on the software quality like, e.g.: {center_dot}high availability, stability, maintainability vs. {center_dot}high flexibility concerning change of functionality, technology, personnel {center_dot}high versatility concerning the scale of system size and performance These challenges are best met by exploiting industrial experience in quality management and assurance (QM/QA), e.g. focusing on top-down development methods, developing an integral functional system model, using UML as a diagramming standard, building vertical prototypes, support for distributed development, etc., which have been used for W7X, however on an 'as necessary' basis. Proceeding in this manner gave significant results for control, data acquisition, corresponding database-structures and user applications over many years. As soon as production systems started using the software in the labs or on a prototype the development activity demanded to be organized in a more rigorous process mainly to provide stable operation conditions. Thus a process improvement activity was started for stepwise introduction of quality assuring processes with tool support taking standards like CMMI, ISO-15504 (SPICE) as a guideline. Experiences obtained so far will be reported. We conclude software engineering and quality assurance has to be an integral part of systems engineering right from the beginning of projects and be organized according to industrial standards to be prepared for the challenges of nuclear fusion research.

Safety management of a complex R and D ground operating system

Science.gov (United States)

Connors, J. F.; Maurer, R. A.

1975-01-01

A perspective on safety program management was developed for a complex R&D operating system, such as the NASA-Lewis Research Center. Using a systems approach, hazardous operations are subjected to third-party reviews by designated-area safety committees and are maintained under safety permit controls. To insure personnel alertness, emergency containment forces and employees are trained in dry-run emergency simulation exercises. The keys to real safety effectiveness are top management support and visibility of residual risks.

Transmission of broad W/Rh and W/Al (target/filter) x-ray beams operated at 25-49 kVp through common shielding materials.

Science.gov (United States)

Li, Xinhua; Zhang, Da; Liu, Bob

2012-07-01

To provide transmission data for broad 25-39 kVp (kilovolt peak) W/Rh and 25-49 kVp W/Al (target/filter, W-tungsten, Rh-rhodium, and Al-aluminum) x-ray beams through common shielding materials, such as lead, concrete, gypsum wallboard, wood, steel, and plate glass. The unfiltered W-target x-ray spectra measured on a Selenia Dimensions system (Hologic Inc., Bedford, MA) set at 20-49 kVp were, respectively, filtered using 50-μm Rh and 700-μm Al, and were subsequently used for Monte Carlo calculations. The transmission of broad x-ray beams through shielding materials was simulated using Geant4 low energy electromagnetic physics package with photon- and electron-processes above 250 eV, including photoelectric effect, Compton scattering, and Rayleigh scattering. The calculated transmission data were fitted using Archer equation with a robust fitting algorithm. The transmission of broad x-ray beams through the above-mentioned shielding materials was calculated down to about 10(-5) for 25-39 kVp W/Rh and 25-49 kVp W/Al. The fitted results of α, β, and γ in Archer equation were provided. The α values of kVp ≥ 40 were approximately consistent with those of NCRP Report No. 147. These data provide inputs for the shielding designs of x-ray imaging facilities with W-anode x-ray beams, such as from Selenia Dimensions.

Risk Management Plan for Tank Farm Restoration and Safe Operations, Project W-314

International Nuclear Information System (INIS)

MCGREW, D.L.

2000-01-01

The Risk Management Plan for Project W-314 describes the systems, processes and procedures for implementation of applicable risk management practices described in HNF-0842, Volume IV, Section 2.6, ''Risk Management''. This plan is tailored specifically for use by Project W-314

A toolkit for computerized operating procedure of complex industrial systems with IVI-COM technology

International Nuclear Information System (INIS)

Zhou Yangping; Dong Yujie; Huang Xiaojing; Ye Jingliang; Yoshikawa, Hidekazu

2013-01-01

A human interface toolkit is proposed to help the user develop computerized operating procedure of complex industrial system such as Nuclear Power Plants (NPPs). Coupled with a friendly graphical interface, this integrated tool includes a database, a procedure editor and a procedure executor. A three layer hierarchy is adopted to express the complexity of operating procedure, which includes mission, process and node. There are 10 kinds of node: entrance, exit, hint, manual input, detector, actuator, data treatment, branch, judgment and plug-in. The computerized operating procedure will sense and actuate the actual industrial systems with the interface based on IVI-COM (Interchangeable Virtual Instrumentation-Component Object Model) technology. A prototype system of this human interface toolkit has been applied to develop a simple computerized operating procedure for a simulated NPP. (author)

The major results from W7-AS stellarator

Science.gov (United States)

Wagner, Friedrich

2002-11-01

W7-AS has terminated operation this summer. In the last phase, W7-AS was equipped with an island divertor using the natural edge islands of the low-shear, n=5 design. NBI heating has been done with co-injection (3 MW), ECRH was successfully extended to high density with the OXB scheme, and ICRH was applied in all standard modes but also in beach wave heating. The island divertor allowed high β and provided excellent exhaust conditions thanks to the accessibility to high densities (ne rationals; in the plasma core the neo-classical bifurcation between ion and electron roots is observed. A distinct difference to tokamaks is the lack of Te - profile resilience. The H-mode operational range is governed by poloidal flow damping. At high density, a further bifurcation appears into a regime characterised by good energy and low impurity confinement (HDH). Because of its appealing features, this regime will be described in detail. The most visible MHD are beam driven global Alfven modes and ELMs. The operational limits are set by NBI power: The balance of heating and edge radiation determines the density limit; the maximal β is limited to 3.1%. The operation at high densities and high β is quiescent and quasi-steady state. The intrinsic stellarator features - steady state and no disruptions - remain close to operational limits. The results of W7-AS confirm the design criteria of W7-X and contribute to establish the stellarator line as independent route to a reactor.

Functions of Ceramide Synthase Paralogs YPR114w and YJR116w of Saccharomyces cerevisiae.

Directory of Open Access Journals (Sweden)

Shamroop K Mallela

Full Text Available Ceramide is synthesized in yeast by two redundant acyl-CoA dependent synthases, Lag1 and Lac1. In lag1∆ lac1∆ cells, free fatty acids and sphingoid bases are elevated, and ceramides are produced through the redundant alkaline ceramidases Ypc1 and Ydc1, working backwards. Even with all four of these genes deleted, cells are surviving and continue to contain small amounts of complex sphingolipids. Here we show that these residual sphingolipids are not synthesized by YPR114w or YJR116w, proteins of unknown function showing a high degree of homology to Lag1 and Lac1. Indeed, the hextuple lag1∆ lac1∆ ypc1∆ ydc1∆ ypr114w∆ yjr116w∆ mutant still contains ceramides and complex sphingolipids. Yjr116w∆ exhibit an oxygen-dependent hypersensitivity to Cu2+ due to an increased mitochondrial production of reactive oxygen species (ROS and a mitochondrially orchestrated programmed cell death in presence of copper, but also a general copper hypersensitivity that cannot be counteracted by the antioxidant N-acetyl-cysteine (NAC. Myriocin efficiently represses the synthesis of sphingoid bases of ypr114w∆, but not its growth. Both yjr116w∆ and ypr114w∆ have fragmented vacuoles and produce less ROS than wild type, before and after diauxic shift. Ypr114w∆/ypr114w∆ have an increased chronological life span. Thus, Yjr116w and Ypr114w are related, but not functionally redundant.

7 CFR 1221.113 - Financial statements.

Science.gov (United States)

2010-01-01

... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... INFORMATION ORDER Sorghum Promotion, Research, and Information Order Sorghum Promotion, Research, and Information Board § 1221.113 Financial statements. (a) As requested by the Secretary, the Board shall prepare...

Mobile Landing Platform with Core Capability Set (MLP w/CCS): Combined Initial Operational Test and Evaluation and Live Fire Test and Evaluation Report

Science.gov (United States)

2015-07-01

SUBTITLE Mobile Landing Platform with Core Capability Set (MLP w/CCS) Combined Initial Operational Test and Evaluation ( IOT &E) and Live Fire Test and...based on data from a series of integrated test events, a dedicated end-to-end Initial Operational Test and Evaluation ( IOT &E), and two Marine Corps...Internally Transportable Vehicles (ITVs).   ii the LMSR to anchor within a few miles of the shore. Using MLP (CCS), the equipment is transported ashore

Simplified reactive power management strategy for complex power grids under stochastic operation and incomplete information

DEFF Research Database (Denmark)

Vlachogiannis, Ioannis (John)

2009-01-01

grids is a major issue for system operators. Under these circumstances an online reactive power management strategy with minimum risk concerning all uncertain and stochastic parameters is proposed. Therefore, new concepts such as reactive power-weighted node-to-node linking and reactive power control......In the current released energy market, the large-scale complex transmission networks and the distribution ones with dispersed energy sources and "intelligent" components operate under uncertainties, stochastic and prior incomplete information. A safe and reliable operation of such complex power...... capability are introduced. A distributed and interconnected stochastic learning automata system is implemented to manage, in a unified and unique way, the reactive power in complex power grids with stochastic reactive power demand and detect the vulnerable part. The proposed simplified strategy can also...

Metabolic Imaging of Patients with Prostate Cancer Using Hyperpolarized [1-13C]Pyruvate

Science.gov (United States)

Nelson, Sarah J.; Kurhanewicz, John; Vigneron, Daniel B.; Larson, Peder E. Z.; Harzstark, Andrea L.; Ferrone, Marcus; van Criekinge, Mark; Chang, Jose W.; Bok, Robert; Park, Ilwoo; Reed, Galen; Carvajal, Lucas; Small, Eric J.; Munster, Pamela; Weinberg, Vivian K.; Ardenkjaer-Larsen, Jan Henrik; Chen, Albert P.; Hurd, Ralph E.; Odegardstuen, Liv-Ingrid; Robb, Fraser J.; Tropp, James; Murray, Jonathan A.

2014-01-01

This first-in-man imaging study evaluated the safety and feasibility of hyperpolarized [1-13C]pyruvate as an agent for noninvasively characterizing alterations in tumor metabolism for patients with prostate cancer. Imaging living systems with hyperpolarized agents can result in more than 10,000-fold enhancement in signal relative to conventional magnetic resonance (MR) imaging. When combined with the rapid acquisition of in vivo 13C MR data, it is possible to evaluate the distribution of agents such as [1-13C]pyruvate and its metabolic products lactate, alanine, and bicarbonate in a matter of seconds. Preclinical studies in cancer models have detected elevated levels of hyperpolarized [1-13C]lactate in tumor, with the ratio of [1-13C]lactate/[1-13C]pyruvate being increased in high-grade tumors and decreased after successful treatment. Translation of this technology into humans was achieved by modifying the instrument that generates the hyperpolarized agent, constructing specialized radio frequency coils to detect 13C nuclei, and developing new pulse sequences to efficiently capture the signal. The study population comprised patients with biopsy-proven prostate cancer, with 31 subjects being injected with hyperpolarized [1-13C]pyruvate. The median time to deliver the agent was 66 s, and uptake was observed about 20 s after injection. No dose-limiting toxicities were observed, and the highest dose (0.43 ml/kg of 230 mM agent) gave the best signal-to-noise ratio for hyperpolarized [1-13C]pyruvate. The results were extremely promising in not only confirming the safety of the agent but also showing elevated [1-13C]lactate/[1-13C]pyruvate in regions of biopsy-proven cancer. These findings will be valuable for noninvasive cancer diagnosis and treatment monitoring in future clinical trials. PMID:23946197

CRC-113 gene expression signature for predicting prognosis in patients with colorectal cancer.

Science.gov (United States)

Nguyen, Minh Nam; Choi, Tae Gyu; Nguyen, Dinh Truong; Kim, Jin-Hwan; Jo, Yong Hwa; Shahid, Muhammad; Akter, Salima; Aryal, Saurav Nath; Yoo, Ji Youn; Ahn, Yong-Joo; Cho, Kyoung Min; Lee, Ju-Seog; Choe, Wonchae; Kang, Insug; Ha, Joohun; Kim, Sung Soo

2015-10-13

Colorectal cancer (CRC) is the third leading cause of global cancer mortality. Recent studies have proposed several gene signatures to predict CRC prognosis, but none of those have proven reliable for predicting prognosis in clinical practice yet due to poor reproducibility and molecular heterogeneity. Here, we have established a prognostic signature of 113 probe sets (CRC-113) that include potential biomarkers and reflect the biological and clinical characteristics. Robustness and accuracy were significantly validated in external data sets from 19 centers in five countries. In multivariate analysis, CRC-113 gene signature showed a stronger prognostic value for survival and disease recurrence in CRC patients than current clinicopathological risk factors and molecular alterations. We also demonstrated that the CRC-113 gene signature reflected both genetic and epigenetic molecular heterogeneity in CRC patients. Furthermore, incorporation of the CRC-113 gene signature into a clinical context and molecular markers further refined the selection of the CRC patients who might benefit from postoperative chemotherapy. Conclusively, CRC-113 gene signature provides new possibilities for improving prognostic models and personalized therapeutic strategies.

Conformational changes in the bilirubin-human serum albumin complex at extreme alkaline pH

DEFF Research Database (Denmark)

Honoré, B; Frandsen, P C

1986-01-01

Light-absorption, c.d. and fluorescence of the bilirubin-albumin complex were investigated at extreme alkaline pH. Above pH 11.1 albumin binds the bilirubin molecule, twisted oppositely to the configuration at more neutral pH. On the basis of light-absorption it is shown that two alkaline...... transitions occur. The first alkaline transition takes place at pH between 11.3 and 11.8, co-operatively dissociating at least six protons. The second alkaline transition takes place at pH between 11.8 and 12.0. It probably implies a reversible unfolding of the albumin molecule, increasing the distance...

The LHC cryogenic system and operational experience from the first three years run

International Nuclear Information System (INIS)

Delikaris, Dimitri; Tavian, Laurent

2014-01-01

The LHC (Large Hadron Collider) accelerator helium cryogenic system consists of eight cryogenically independent sectors, each 3.3 km long, all cooled and operated at 1.9 K. The overall, entropy equivalent, installed cryogenic capacity totalizes 144 kW (a) 4.5 K including 19.2 kW (a) 1.8 K with an associated helium inventory of 130 ton. The LHC cryogenic system is considered among the most complex and powerful in the world allowing the cooling down to superfluid helium temperature of 1.9 K. of the accelerators' high field superconducting magnets distributed over the 26.7 km underground ring. The present article describes the LHC cryogenic system and its associated cryogen infrastructure. Operational experience, including cryogen management, acquired from the first three years of LHC operation is finally presented. (author)

Design study of wind turbines 50 kW to 3000 kW for electric utility applications. Volume 2: Analysis and design

Science.gov (United States)

1976-01-01

All possible overall system configurations, operating modes, and subsystem concepts for a wind turbine configuration for cost effective generation of electrical power were evaluated for both technical feasibility and compatibility with utility networks, as well as for economic attractiveness. A design optimization computer code was developed to determine the cost sensitivity of the various design features, and thus establish the configuration and design conditions that would minimize the generated energy costs. The preliminary designs of both a 500 kW unit and a 1500 kW unit operating in a 12 mph and 18 mph median wind speed respectively, were developed. The various design features and components evaluated are described, and the rationale employed to select the final design configuration is given. All pertinent technical performance data and component cost data is included. The costs of all major subassemblies are estimated and the resultant energy costs for both the 500 kW and 1500 kW units are calculated.

Operational Complexity of Supplier-Customer Systems Measured by Entropy—Case Studies

Directory of Open Access Journals (Sweden)

Ladislav Lukáš

2016-04-01

Full Text Available This paper discusses a unified entropy-based approach for the quantitative measurement of operational complexity of company supplier-customer relations. Classical Shannon entropy is utilized. Beside this quantification tool, we also explore the relations between Shannon entropy and (c,d-entropy in more details. An analytic description of so called iso-quant curves is given, too. We present five case studies, albeit in an anonymous setting, describing various details of general procedures for measuring the operational complexity of supplier-customer systems. In general, we assume a problem-oriented database exists, which contains detailed records of all product forecasts, orders and deliveries both in quantity and time, scheduled and realized, too. Data processing detects important flow variations both in volumes and times, e.g., order—forecast, delivery—order, and actual production—scheduled one. The unifying quantity used for entropy computation is the time gap between actual delivery time and order issue time, which is nothing else but a lead time in inventory control models. After data consistency checks, histograms and empirical distribution functions are constructed. Finally, the entropy, information-theoretic measure of supplier-customer operational complexity, is calculated. Basic steps of the algorithm are mentioned briefly, too. Results of supplier-customer system analysis from selected Czech small and medium-sized enterprises (SMEs are presented in various computational and managerial decision making details. An enterprise is ranked as SME one, if it has at most 250 employees and its turnover does not exceed 50 million USD per year, or its balance sheet total does not exceed 43 million USD per year, alternatively.

Rheological and droplet size analysis of W/O/W multiple emulsions containing low concentrations of polymeric emulsifiers

Directory of Open Access Journals (Sweden)

DRAGANA D. VASILJEVIĆ

2009-07-01

Full Text Available Multiple emulsions are complex dispersion systems which have many potential applications in pharmaceutics, cosmetics and the food industry. In practice, however, significant problems may arise because of their thermodynamic instability. In this study, W/O/W multiple emulsion systems containing low concentration levels of lipophilic polymeric primary emulsifiers cetyl dimethicone copolyol and PEG–30 dipolyhydroxystearate were evaluated. The concentrations of the primary emulsifiers were set at 1.6 and 2.4 % w/w in the final emulsions. Rheological and droplet size analysis of the investigated samples showed that the type and concentration of the primary lipophilic polymeric emulsifier markedly affected the characteristics of the multiple emulsions. The multiple emulsion prepared with 2.4 % w/w PEG–30 dipolyhydroxystearate as the primary emulsifier exhibited the highest apparent viscosity, yield stress and elastic modulus values, as well as the smallest droplet size. Furthermore, these parameters remained relatively constant over the study period, confirming the high stability of the investigated sample. The results obtained indicate that the changes observed in the investigated samples over time could be attributed to the swelling/breakdown mechanism of the multiple droplets. Such changes could be adequately monitored by rheological and droplet size analysis.

TED Study of Si(113) Surfaces

Science.gov (United States)

Suzuki, T.; Minoda, H.; Tanishiro, Y.; Yagi, K.

A TED study of Si(113) surfaces was carried out. Reflections from the 3 × 2 reconstruction were seen at room temperature, while half-order reflections were very faint. The surface showed the phase transition between the 3 × 1 and the disordered (rough) structures at about 930°C. The (113) surface structure at room temperature was analyzed using TED intensity. Four kinds of structure models proposed previously, including both the 3 × 1 and the 3 × 2 reconstructed structures, were examined. The R-factors calculated using the energy-optimized atomic coordinates are not sufficiently small. After minimization of the R-factors, Dabrowski's 3 × 2 structure model is most agreeable, while Ranke's 3 × 1 and 3 × 2 structure models are not to be excluded. STM observation showed that the surface is composed of small domains of the 3 × 2 structure.

MATHEMATICAL MODELS OF PROCESSES AND SYSTEMS OF TECHNICAL OPERATION FOR ONBOARD COMPLEXES AND FUNCTIONAL SYSTEMS OF AVIONICS

Directory of Open Access Journals (Sweden)

Sergey Viktorovich Kuznetsov

2017-01-01

Full Text Available Modern aircraft are equipped with complicated systems and complexes of avionics. Aircraft and its avionics tech- nical operation process is observed as a process with changing of operation states. Mathematical models of avionics pro- cesses and systems of technical operation are represented as Markov chains, Markov and semi-Markov processes. The pur- pose is to develop the graph-models of avionics technical operation processes, describing their work in flight, as well as during maintenance on the ground in the various systems of technical operation. The graph-models of processes and sys- tems of on-board complexes and functional avionics systems in flight are proposed. They are based on the state tables. The models are specified for the various technical operation systems: the system with control of the reliability level, the system with parameters control and the system with resource control. The events, which cause the avionics complexes and func- tional systems change their technical state, are failures and faults of built-in test equipment. Avionics system of technical operation with reliability level control is applicable for objects with constant or slowly varying in time failure rate. Avion- ics system of technical operation with resource control is mainly used for objects with increasing over time failure rate. Avionics system of technical operation with parameters control is used for objects with increasing over time failure rate and with generalized parameters, which can provide forecasting and assign the borders of before-fail technical states. The pro- posed formal graphical approach avionics complexes and systems models designing is the basis for models and complex systems and facilities construction, both for a single aircraft and for an airline aircraft fleet, or even for the entire aircraft fleet of some specific type. The ultimate graph-models for avionics in various systems of technical operation permit the beginning of

Miejsce muzeów w turystyce kulturowej w Polsce

OpenAIRE

Krakowiak, Beata

2013-01-01

The article presents the museums, their potential and their significance for cultural tourism in Poland. Its aims are achieved through a presentation of registered national museums, ‘monuments of history’, museum buildings and the cultural activities undertaken by these institutions Artykuł dotyczy potencjału muzealnego oraz jego znaczenia dla turystyki kulturowej w Polsce. Zamierzone cele pracy realizowane są poprzez prezentację muzeów rejestrowanych, narodowych, muzeów-pomników histor...

13 CFR 113.110 - Remedial and affirmative action and self-evaluation.

Science.gov (United States)

2010-01-01

... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... and self-evaluation. 113.110 Section 113.110 Business Credit and Assistance SMALL BUSINESS... GOVERNMENT AND SBA ADMINISTRATOR Nondiscrimination on the Basis of Sex in Education Programs or Activities...

Post-test analysis of 20kW molten carbonate fuel cell stack operated on coal gas. Final report, August 1993--February 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-05-01

A 20kW carbonate fuel cell stack was operated with coal gas for the first time in the world. The stack was tested for a total of 4,000 hours, of which 3,900 hours of testing was conducted at the Louisiana Gasification Technology Incorporated, Plaquemine, Louisiana outdoor site. The operation was on either natural gas or coal gas and switched several times without any effects, demonstrating duel fuel capabilities. This test was conducted with 9142 kJ/m{sup 3} (245 Btu/cft) coal gas provided by a slipstream from Destec`s entrained flow, slagging, slurry-fed gasifier equipped with a cold gas cleanup subsystem. The stack generated up to 21 kW with this coal gas. Following completion of this test, the stack was brought to Energy Research Corporation (ERC) and a detailed post-test analysis was conducted to identify any effects of coal gas on cell components. This investigation has shown that the direct fuel cell (DFC) can be operated with properly cleaned and humidified coal-as, providing stable performance. The basic C direct fuel cell component materials are stable and display normal stability in presence of the coal gas. No effects of the coal-borne contaminants are apparent. Further cell testing at ERC 1 17, confirmed these findings.

Operating of mobile machine units system using the model of multicomponent complex movement

OpenAIRE

A. Lebedev; R. Kaidalov; N. Artiomov; M. Shulyak; M. Podrigalo; D. Abramov; D. Klets

2015-01-01

To solve the problems of mobile machine units system operating it is proposed using complex multi-component (composite) movement physical models. Implementation of the proposed method is possible by creating of automatic operating systems of fuel supply to the engines using linear accelerometers. Some examples to illustrate the proposed method are offered.

A summary of the conclusions of generic issue 113: Dynamic qualification and testing of large bore hydraulic snubbers

International Nuclear Information System (INIS)

Ware, A.G.; Nitzel, M.E.

1993-01-01

The Nuclear Regulatory Commission (NRC) developed Generic Issue 113, Dynamic Qualification and Testing of Large Bore Hydraulic Snubbers (LBHSs), with the objective of evaluating the reliability of LBHSs in operating commercial nuclear power plants. For the purposes of this research, LBHSs were defined as those hydraulic snubbers with rated load capacities ≥50 kips. Relatively high LBHS failure rates were common during the early 1980s; however, industry actions taken during the last several years in response to increased inspection and testing requirements have resulted in lower LBHS failure rates. To address the issue of LBHS adequacy, the NRC developed Generic Issue 113 (GI-113). This paper provides a summary of the important findings of the GI-113 research program and a discussion of the recommendations that were made in NUREG/CR-5416. Fifteen potential improvements in LBHS reliability were identified, covering the areas of design, environmental (including dynamic) qualification, functional testing, visual inspection, and personnel training. Probabilistic risk assessment studies were used to perform a cost/benefit analysis for each. There were five potential improvements in functional testing and visual inspections with low cost/benefit ratios for both existing and future nuclear plants, and an additional six potential improvements that were determined to be cost beneficial only for future plants. Further investigations of the single failure of snubbers that could damage critical components or systems were recommended in NUREG/CR-5416

An ergonomics study of computerized emergency operating procedures: Presentation style, task complexity, and training level

International Nuclear Information System (INIS)

Xu Song; Song Fei; Li Zhizhong; Zhao Qianyi; Luo Wei; He Xuhong; Salvendy, Gavriel

2008-01-01

Emergency operating procedures (EOPs) are widely used in nuclear power plants (NPPs). With the development of information technology, computerized EOPs are taking the place of paper-based ones. Unlike paper-based EOPs, the industrial practice of computerized EOPs is still quite limited. Ergonomics issues of computerized EOPs have not been studied adequately. This study focuses on the effects of EOP presentation style, task complexity, and training level on the performance of the operators in the execution of computerized EOPs. One simulated computerized EOP system was developed to present two EOPs, each with different task complexity levels, by two presentation styles (Style A: one- and two-dimensional flowcharts combination; Style B: two-dimensional flowchart and success logic tree combination). Forty subjects participated in the experiment of EOP execution using the simulated system. Statistical analysis of the experimental results indicates that: (1) complexity, presentation style, and training level all can significantly influence the error rate. High-complexity tasks and lack of sufficient training may lead to a higher error rate. Style B caused a significantly higher error rate than style A did in the skilled phase. So the designers of computerized procedures should take the presentation styles of EOPs into account. (2) Task complexity and training level can significantly influence operation time. No significant difference was found in operation time between the two presentation styles. (3) Training level can also significantly influence the subjective workload of EOPs operations. This implies that adequate training is very important for the performance of computerized EOPs even if emergency responses with computerized EOPs are much more simple and easy than that with paper-based EOPs

An ergonomics study of computerized emergency operating procedures: Presentation style, task complexity, and training level

Energy Technology Data Exchange (ETDEWEB)

Xu Song; Song Fei [Department of Industrial Engineering, Tsinghua University, Beijing 100084 (China); Li Zhizhong [Department of Industrial Engineering, Tsinghua University, Beijing 100084 (China)], E-mail: zzli@tsinghua.edu.cn; Zhao Qianyi; Luo Wei [Department of Industrial Engineering, Tsinghua University, Beijing 100084 (China); He Xuhong [Scanpower Risk Management China Inc., Towercrest International Plaza, No. 3 Maizidian West Road, Chaoyang District, Beijing 100016 (China); Salvendy, Gavriel [Department of Industrial Engineering, Tsinghua University, Beijing 100084 (China)

2008-10-15

Emergency operating procedures (EOPs) are widely used in nuclear power plants (NPPs). With the development of information technology, computerized EOPs are taking the place of paper-based ones. Unlike paper-based EOPs, the industrial practice of computerized EOPs is still quite limited. Ergonomics issues of computerized EOPs have not been studied adequately. This study focuses on the effects of EOP presentation style, task complexity, and training level on the performance of the operators in the execution of computerized EOPs. One simulated computerized EOP system was developed to present two EOPs, each with different task complexity levels, by two presentation styles (Style A: one- and two-dimensional flowcharts combination; Style B: two-dimensional flowchart and success logic tree combination). Forty subjects participated in the experiment of EOP execution using the simulated system. Statistical analysis of the experimental results indicates that: (1) complexity, presentation style, and training level all can significantly influence the error rate. High-complexity tasks and lack of sufficient training may lead to a higher error rate. Style B caused a significantly higher error rate than style A did in the skilled phase. So the designers of computerized procedures should take the presentation styles of EOPs into account. (2) Task complexity and training level can significantly influence operation time. No significant difference was found in operation time between the two presentation styles. (3) Training level can also significantly influence the subjective workload of EOPs operations. This implies that adequate training is very important for the performance of computerized EOPs even if emergency responses with computerized EOPs are much more simple and easy than that with paper-based EOPs.

14 CFR 91.113 - Right-of-way rules: Except water operations.

Science.gov (United States)

2010-01-01

... not take advantage of this rule to cut in front of another which is on final approach to land or to... TRANSPORTATION (CONTINUED) AIR TRAFFIC AND GENERAL OPERATING RULES GENERAL OPERATING AND FLIGHT RULES Flight... pass well clear. (g) Landing. Aircraft, while on final approach to land or while landing, have the...

System Coordination of Survivability and Safety of Complex Engineering Objects Operation

Directory of Open Access Journals (Sweden)

Nataliya Pankratova

2014-11-01

Full Text Available A system strategy to estimation the guaranteed survivability and safety of complex engineering objects (CEO operation is proposed. The principles that underlie the strategy of the guaranteed safety of CEO operation provide a flexible approach to timely detection, recognition, forecast, and system diagnostics of risk factors and situations, to formulation and implementation of a rational decision in a practicable time within an unremovable time constraint. Implementation of the proposed strategy is shown on example of diagnostics of electromobile-refrigerator functioning in real mode.

STS-107 M.S. Laurel Clark takes a break during TCDT M113 training

Science.gov (United States)

2002-01-01

KENNEDY SPACE CENTER, FLA. -- STS-107 Mission Specialist Laurel Clark takes a break during training on the operation of an M113 armored personnel carrier during Terminal Countdown Demonstration Test activities, a standard part of launch preparations. STS-107 is a mission devoted to research and will include more than 80 experiments that will study Earth and space science, advanced technology development, and astronaut health and safety. Launch is planned for Jan. 16, 2003, between 10 a.m. and 2 p.m. EST aboard Space Shuttle Columbia.

Performance and emissions of a modified small engine operated on producer gas

International Nuclear Information System (INIS)

Homdoung, N.; Tippayawong, N.; Dussadee, N.

2015-01-01

Highlights: • A small agricultural diesel engine was converted into a spark ignited engine. • The modified engine operated solely on producer gas at various loads and speeds. • It run successfully at high compression ratio, without knocking. • Improvement in efficiency and specific energy consumption at higher CR was evident. - Abstract: Existing agricultural biomass may be upgraded converted to a gaseous fuel via a downdraft gasifier for spark ignition engines. In this work, a 0.6 L, naturally aspirated single cylinder compression ignition engine was converted into a spark ignition engine and coupled to a 5 kW dynamometer. The conventional swirl combustion chamber was replaced by a cavity chamber. The effect of variable compression ratios between 9.7 and 17:1, and engine speeds between 1000 and 2000 rpm and loads between 20% and 100% of engine performance were investigated in terms of engine torque, power output, thermal efficiency, specific fuel consumption and emissions. It was found that the modified engine was able to operate well with producer gas at higher compression ratios than with gasoline. The brake thermal efficiency was lower than the original diesel engine at 11.3%. Maximum brake power was observed to be 3.17 kW, and the best BSFC of 0.74 kg/kWh was achieved. Maximum brake thermal efficiency of 23.9% was obtained. The smoke density of the engine was lower than the diesel engine, however, CO emission was higher with similar HC emission

On the number of eigenvalues of the discrete one-dimensional Dirac operator with a complex potential

Science.gov (United States)

Hulko, Artem

2018-03-01

In this paper we define a one-dimensional discrete Dirac operator on Z . We study the eigenvalues of the Dirac operator with a complex potential. We obtain bounds on the total number of eigenvalues in the case where V decays exponentially at infinity. We also estimate the number of eigenvalues for the discrete Schrödinger operator with complex potential on Z . That is we extend the result obtained by Hulko (Bull Math Sci, to appear) to the whole Z.

9 CFR 113.202 - Canine Hepatitis and Canine Adenovirus Type 2 Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... Type 2 Vaccine, Killed Virus. 113.202 Section 113.202 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.202 Canine Hepatitis and Canine...

9 CFR 3.113 - Primary enclosures used to transport marine mammals.

Science.gov (United States)

2010-01-01

... marine mammals. 3.113 Section 3.113 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... the animals, their handlers, or other persons. (d) Marine mammals transported in the same primary... used. Within the primary enclosures used to transport marine mammals, the animals will be maintained on...

Field dependence of T1 for hyperpolarized [1-13C]pyruvate

DEFF Research Database (Denmark)

Chattergoon, N.; Martnez-Santiesteban, F.; Handler, W. B.

2013-01-01

conformation and properties of the dissolution media such as buffer composition, solution pH, temperature and magnetic field. We have measured the magnetic field dependence of the spin–lattice relaxation time of hyperpolarized [1-13C]pyruvate using field-cycled relaxometry. [1-13C]pyruvate was hyperpolarized...

Validating cognitive support for operators of complex human-machine systems

International Nuclear Information System (INIS)

O'Hara, J.; Wachtel, J.

1995-01-01

Modem nuclear power plants (NPPs) are complex systems whose performance is the result of an intricate interaction of human and system control. A complex system may be defined as one which supports a dynamic process involving a large number of elements that interact in many different ways. Safety is addressed through defense-in-depth design and preplanning; i.e., designers consider the types of failures that are most likely to occur and those of high consequence, and design their solutions in advance. However, complex interactions and their failure modes cannot always be anticipated by the designer and may be unfamiliar to plant personnel. These situations may pose cognitive demands on plant personnel, both individually and as a crew. Other factors may contribute to the cognitive challenges of NPP operation as well, including hierarchal processes, dynamic pace, system redundancy and reliability, and conflicting objectives. These factors are discussed in this paper

Record of Decision Remedial Alternative Selection for the Gunsite 113 Access Road (631-24G) Operable Unit: Final Action

International Nuclear Information System (INIS)

Palmer, E.

1997-01-01

This decision document presents the selected remedial action for the Gunsite 113 Access Road Unit located at the Savannah River Site near Aiken, SC. The selected action was developed in accordance with CERCLA, as amended, and to the extent practicable, the National Oil and Hazardous Substances Pollution Contingency Plan (NCP). The selected remedy satisfies both CERCLA and RCRA 3004(U) requirements. This decision is based ont he Administrative Record File for this specific RCRA/CERCLA Unit

OPERATING OF MOBILE MACHINE UNITS SYSTEM USING THE MODEL OF MULTICOMPONENT COMPLEX MOVEMENT

Directory of Open Access Journals (Sweden)

A. Lebedev

2015-07-01

Full Text Available To solve the problems of mobile machine units system operating it is proposed using complex multi-component (composite movement physical models. Implementation of the proposed method is possible by creating of automatic operating systems of fuel supply to the engines using linear accelerometers. Some examples to illustrate the proposed method are offered.

Dynamic Consolidation and Investigation of Nanostructural W-Cu / W-Y Cylindrical Billets

Science.gov (United States)

Godibadze, B.; Dgebuadze, A.; Chagelishvili, E.; Mamniashvili, G.; Peikrishvili, A.

2018-03-01

higher than 0.5 wt. %. Investigation revealed that the Y rich phases were complex (W-Y) oxides formed during the sintering process. Also very interesting to use doping chromium with yttrium-containing alloys. e.g. (W - 10÷12 Cr -0.5÷2 Y) wt. %. The extent up to which yttrium acts as an active element improving the adherence and stability of the protective Cr 2 O 3 layer formed during oxidation is assessed. The structure and characteristics of the obtained samples depends on the phase content, distribution of phases and processing parameters during explosive synthesis and consolidation. Cu – (10-30%) W powder mixtures were formed into cylindrical rods using a hot shock wave consolidation (HSWC) process. Different type of Cu - W precursor composition containing 10, 20 and 30% of nanoscale W were consolidated near theoretical density under 900°C The loading intensity was under 10 GPa. The investigation showed that the combination of high temperatures (above 800°C) and two stage shock wave compression was beneficial to the consolidation of the W-Cu & W-Y composites, resulting in high densities, good integrity and good electronic properties.

Angiogeneza w reumatoidalnym zapaleniu stawów

Directory of Open Access Journals (Sweden)

Anna Kotulska

2011-02-01

Full Text Available Angiogeneza jest procesem powstawania nowych włosowatychnaczyń krwionośnych z uprzednio istniejących włośniczek. Angiogenezawystępuje w życiu pozapłodowym i jest regulowana przezzespół czynników proangiogennych i antyangiogennych (tab. I.Zwiększona angiogeneza towarzyszy kilku stanom chorobowym. Jestniezbędna dla wzrostu nowotworów złośliwych. Choroby nienowotworowe,w tym reumatoidalne zapalenie stawów, są także związanez nasiloną angiogenezą. Wykazano tworzenie nowych naczyńw zmienionej zapalnie błonie maziowej stawów, co jest najważniejszązmianą patologiczną u chorych na reumatoidalne zapalenie stawów.U chorych stwierdzono zaburzoną regulację czynników proangiogennychi hamujących ten proces. Leki hamujące zapalenie błonymaziowej bezpośrednio lub pośrednio ograniczają angiogenezę.Możliwe jest, że oddziaływanie na proces angiogenezy będzie stanowićjeden z mechanizmów terapeutycznych leków stosowanychu chorych na reumatoidalne zapalenie stawów.

Preparing diagnostics for long pulse operation at W7-X

Energy Technology Data Exchange (ETDEWEB)

Neuner, Ulrich, E-mail: u.neuner@ipp.mpg.de [Max-Planck-Institut fuer Plasmaphysik EURATOM Association, Greifswald (Germany); Brucker, Bertram [Max-Planck-Institut fuer Plasmaphysik EURATOM Association, Greifswald (Germany); Cardella, Antonio [European Commision c/o W7-X, Max-Planck-Institut fuer Plasmaphysik EURATOM Association, Greifswald (Germany); Endler, Michael; Grosser, Klaus; Hathiramani, Dag; Hirsch, Matthias; Koenig, Ralf; Pasch, Ekkehard; Pilopp, Dirk; Schuelke, Matthias; Thiel, Stefan; Thomsen, Henning; Wolf, Robert; Zhang Daihong [Max-Planck-Institut fuer Plasmaphysik EURATOM Association, Greifswald (Germany)

2012-08-15

Highlights: Black-Right-Pointing-Pointer In long pulse fusion devices diagnostics are subject to severe heating. Black-Right-Pointing-Pointer Several concepts to reduce the heat influx were applied. Black-Right-Pointing-Pointer Heat conduction was improved to keep the temperature within acceptable limits. - Abstracts: Long pulse operation considerably increases the thermal load on in-vessel components. Diagnostic front-ends formerly employed at short pulse machines therefore have to be considerably re-designed for installation in the stellarator W7-X that is currently being built at Greifswald, Germany. The strategy applied to cope with the thermal load is threefold: to reduce the influx of heat on the component, to conduct the heat inside the component to suitable heat sinks and to choose suitable materials for sensitive components. The first is achieved by the shielding against microwave stray radiation, plasma radiation, thermal radiation and particle fluxes and by absorbing residual microwave stray radiation in the immediate vicinity of sensitive components. The second task, suitable heat conduction, enforces severe restrictions on the use of any thin parts like foils or meshes. Thirdly, in order for a component to survive the residual loads, materials must be chosen that absorb only a small fraction of the microwave stray radiation flux, conduct heat well enough, and survive high temperatures and large temperature gradients. Examples are provided from bolometry, magnetic diagnostics, soft X-ray diagnostics and Thomson scattering. Measurements of microwave stray radiation effects are presented, in particular the effectiveness of several shielding concepts.

Interaction of actinide ions with [NaP5W30O110]14- and [P2W18O62]6-

International Nuclear Information System (INIS)

Choppin, G.R.; Wall, D.E.

2003-01-01

Stability constants (log β 101 ) of Th 4+ , UO 2 2+ , NpO 2 + and Am 3+ with [NaP 5 W 30 O 110 ] 14- were determined by solvent extraction (μ = 0.1M NaCl) and found to be 6.18 ± 0.07, 3.80 ± 0.06, 2.98 ± 0.04, and 5.85 ± 0.05, respectively. The order of stability constants: Th 4+ > Am 3+ > UO 2 2+ > NpO 2 + is due to electrostatic repulsion between the actinyl oxygens and oxygens on the polyoxometalate surface. The order of stability constants for metal complexes with [P 2 W 18 O 62 ] 6- is Th 4+ > UO 2 2+ > Eu 3+ >NpO 2 + because the steric repulsion between actinyl oxygens and oxygens on polyoxometalate are less important. Enthalpies of complexation were measured by calorimetric titration of Th 4+ , UO 2 2+ , Nd 3+ with [NaP 5 W 30 O 110 ] 14- and [P 2 W 18 O 62 ] 6- . The results indicate that the conformation and charge distribution of the microscopic surface structures are important factors in the formation of pseudocolloids. (author)

Fabrication of a highly selective cadmium (II) sensor based on 1,13-bis(8-quinolyl)-1,4,7,10,13-pentaoxatridecane as a supramolecular ionophore

Energy Technology Data Exchange (ETDEWEB)

Ghaemi, Arezoo, E-mail: arezooghaemi@yahoo.com; Tavakkoli, Haman; Mombeni, Tayebeh

2014-05-01

A new cadmium (II) ion selective sensor based on 1,13-bis(8-quinolyl)-1,4,7,10,13-pentaoxatridecane (kryptofix5) as a supramolecular carrier has been developed. The membrane solutions containing polyvinyl chloride (PVC), plasticizer, sodium tetraphenylborate (NaTPB) as a lipophilic ionic additive and kryptofix5 as an ionophore were directly coated on the surface of graphite rods. The best composition of the coated membrane (w/w%) was found to be: 30.0% PVC, 61.0% dioctyl sebacate (DOS), 6.0% NaTPB and 3.0% kryptofix5. The sensor indicates a good linear response for Cd{sup 2+} cation over a wide concentration range from 1.0 × 10{sup −5} to 1.0 × 10{sup −1} M with a Nernstian slope of 29.8 ± 0.1 mV/decade and the detection limit is 8.4 × 10{sup −6} M. The response time of the sensor is 15 s and it can be used for 7 weeks without significant drift in potential. The sensor operates in the wide pH range of 1.0–6.0. This sensor reveals a very good selectivity toward Cd{sup 2+} ion over a wide range of alkali, transition and heavy metal cations. The sensor was used as an indicator electrode for potentiometric titration of Cd{sup 2+} using sodium fluoride and ethylenediaminetetraacetic acid (EDTA) solutions with a sharp potential change that occurred at the end point. In addition, the proposed sensor was successfully used for determination of Cd{sup 2+} cation in real water samples. - Graphical abstract: Fabrication of a highly selective cadmium (II) sensor based on 1,13-bis(8-quinolyl)-1,4,7,10,13-pentaoxatridecane as a supramolecular ionophore. - Highlights: • Fabrication of a novel Cd{sup 2+} selective sensor with high sensitivity and selectivity • Using fabricated sensor in a wide pH range with fast response time • Replacing expensive techniques with this low cost sensor with low detection limit • Excellent capability of this sensor for measuring Cd{sup 2+} in real samples.

The step complexity measure for emergency operating procedures - comparing with simulation data

International Nuclear Information System (INIS)

Park, Jinkyun; Jung, Wondea; Kim, Jaewhan; Ha, Jaejoo; Shin, Yunghwa

2001-01-01

In complex systems, such as nuclear power plants (NPPs) or airplane control systems, human errors play a major role in many accidents. Therefore, to prevent occurrences of accidents or to ensure system safety, extensive effort has been made to identify significant factors that cause human errors. According to related studies, written manuals or operating procedures are revealed as one of the most important factors, and complexity or understandability of a procedure is pointed out as one of the major reasons that make procedure-related human errors. Many qualitative checklists are suggested to evaluate emergency operating procedures (EOPs) of NPPs. However, since qualitative evaluations using checklists have some drawbacks, a quantitative measure that can quantify the complexity of EOPs is imperative to compensate for them. In order to quantify the complexity of EOPs, Park et al. suggested the step complexity (SC) measure to quantify the complexity of a step included in EOPs. In this paper, to ensure the appropriateness of the SC measure, SC scores are compared with averaged step performance time data obtained from emergency training records. The total number of available records is 36, and training scenarios are the loss of coolant accident and the excess steam dump event. The number of scenario is 18 each. From these emergency training records, step performance time data for 39 steps are retrieved, and they are compared with estimated SC scores of them. In addition, several questions that are needed to clarify the appropriateness of the SC measure are also discussed. As a result, it was observed that estimated SC scores and step performance time data have a statistically meaningful correlation. Thus, it can be concluded that the SC measure can quantify the complexity of steps included in EOPs

Development of actively cooled windows for plasma observation during quasi-continuous operation of the W7-X stellarator

International Nuclear Information System (INIS)

Konig, R.; Grosser, K.; Hildebrandt, D.; Pasch, E.; Werner, T.; Klinger, T.; Ogorodnikova, O.

2005-01-01

With the stellarator W7-X a step to quasi-continuous plasma operation will be made. The cooling system of the machine is designed such that two 30 min discharges can be run per day. Right from the start of operation 10 MW of ECRH heating power will be available for quasi-continuous operation. A working group 'Plasma Facing Optical Components' has been formed which presently concentrates on the development of water cooled windows for UV/VR/IR periscopes which can withstand the expected maximum heat loads of up to 50 kW/m 2 which due to the predominantly short wavelength nature of the radiation emitted by the plasma will be absorbed within the first millimeter of any window. We will report on the detailed Finite Element (ANSYS R ) calculations of the heat and stress distribution across the windows. Calculations have been undertaken for a large number of different window materials which are required for the various spectral regions covered by the miscellaneous diagnostics, so that the most suitable material for each application can easily be identified. Also the dependence of the cooling rate on the window diameter and thickness has been studied. The calculations show that at a power load of 50 kW/m 2 cooled sapphire windows can be used for window sizes up to ∼200 mm diameter but that for many of the other materials like ZnSe, ZnS, CaF 2 , MgF 2 and quartz window sizes need to be limited to considerably smaller sizes. Detailed simulations of the local radiation power load distribution demonstrate that by careful design the load on individual optical components can be considerably reduced. A vacuum test chamber, equipped with a vacuum compatible IR heater has been build. In this chamber a low cost, easily exchangeable window design using Helicoflex gaskets on either side of a 60 mm exposed diameter quartz window have been successfully tested over 70 heat cycles up to a maximum temperature of 450 o C at power loads of 15 kW/m 2 . The design proved to be water and

Scintigraphy of the Placenta With {sup 113m}In

Energy Technology Data Exchange (ETDEWEB)

Lewitus, Z.; Lubin, E.; Rechnic, J.; Laor, J.; Eckerling, E. [Beilinson Medical Centre, University of Tel Aviv School of Medicine (Israel)

1969-05-15

The paper describes the merits of using {sup 113m}In in scintigraphic placental localization. The {sup 113m}In, generated from a commercial {sup 113}Sn cow, eluted with 0.05N HC1, stabilized with gelatin at pH 4.0 and autoclaved in the carrier-free form, becomes bound to the plasma proteins after being injected intravenously and stays in the vascular system long enough to enable scanning of the placental blood pools. The short physical half-life and the decay by isomeric transition reduces the radiation dose compared with other scanning agents. The minimal elimination of the molecule into the bladder during scanning has the advantage over the use of {sup 99m}Tc because it diminishes the possible confusion of activity in this area with a low-lying placenta. The placentography has been found of value in the diagnosis of placenta praevia, twins and hydatidiform mole. (author)

Development of the step complexity measure for emergency operating procedures using entropy concepts

International Nuclear Information System (INIS)

Park, Jinkyun; Jung, Wondea; Ha, Jaejoo

2001-01-01

For a nuclear power plant (NPP), symptom-based emergency operating procedures (EOPs) have been adopted to enhance the safety of NPPs through reduction of operators' workload under emergency conditions. Symptom-based EOPs, however, could place a workload on operators because they have to not only identify related symptoms, but also understand the context of steps that should be carried out. Therefore, many qualitative checklists are suggested to ensure the appropriateness of steps included in EOPs. However, since these qualitative evaluations have some drawbacks, a quantitative measure that can roughly estimate the complexity of EOP steps is imperative to compensate for them. In this paper, a method to evaluate the complexity of an EOP step is developed based on entropy measures that have been used in software engineering. Based on these, step complexity (SC) measure that can evaluate SC from various viewpoints (such as the amount of information/operators' actions included in each EOP step, and the logic structure of each EOP step) was developed. To verify the suitableness of the SC measure, estimated SC values are compared with subjective task load scores obtained from the NASA-TLX (task load index) method and step performance time obtained from a full scope simulator. From these comparisons, it was observed that estimated SC values generally agree with the NASA-TLX scores and step performance time data. Thus, it could be concluded that the developed SC measure would be considered for evaluating SC of an EOP step

Quantum teleportation via a W state

International Nuclear Information System (INIS)

Joo, Jaewoo; Park, Young-Jai; Oh, Sangchul; Kim, Jaewan

2003-01-01

We investigate two schemes of quantum teleportation with a W state, which belongs to a different class from the Greenberger-Horne-Zeilinger class. In the first scheme, the W state is shared by three parties, one of whom, called a sender, performs a Bell measurement. It is shown that the quantum information of an unknown state is split between two parties and recovered with a certain probability. In the second scheme, a sender takes two particles of the W state and performs positive operator valued measurements. For the two schemes, we calculate the success probability and the average fidelity. We show that the average fidelity of the second scheme cannot exceed that of the first one

W,Z0 production at the pp collider

International Nuclear Information System (INIS)

Bunce, G.; Gordon, H.A.; Killian, T.J.

1982-01-01

We have examined some experimental questions relating to the production of W's and Z 0 's at a pp collider. To be specific we have considered a Colliding Beam Accelerator (CBA) with center of energy √s = 800 GeV and luminosity L = 10 33 cm -2 sec -1 (the standard BNL Isabelle (ISA) operating conditions). Most experiments should accumulate 10 sec of beam and therefore will have an integrated luminosity L = 10 40 cm -2 . This corresponds to the production of millions of conventional charged W's per interaction region and gives the potential for high statistics studies of the properties of W's and for experiments searching for higher mass objects. Our focus has been on testing predictions of the standard model. We have concentrated on W production since it is likely the standard Z 0 will be observed in the near future. In most cases the W is detected via its semileptonic decay W → l + nu. The specific topics considered are: W +- production: pp → W +- + X, W +- → e +- + nu, pp → W +- + γ + X, polarization effects in W +- production, and very high luminosity experiments

13 CFR 113.525 - Fringe benefits.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Fringe benefits. 113.525 Section... benefits. (a) “Fringe benefits” defined. For purposes of these Title IX regulations, fringe benefits means: Any medical, hospital, accident, life insurance, or retirement benefit, service, policy or plan, any...

78 FR 63570 - Proposed Collection; Comment Request for Forms W-8BEN, W-8BEN-E, W-8ECI, W-8EXP, and W-8IMY

Science.gov (United States)

2013-10-24

... W-8BEN, W-8BEN-E, W-8ECI, W-8EXP, and W-8IMY AGENCY: Internal Revenue Service (IRS), Treasury..., the IRS is soliciting comments concerning Form W-8BEN, Certificate of Foreign Status of Beneficial Owner for United States Tax Withholding, Form W-8BEN-E, Certificate of Status of Beneficial Owner for...

Residual stress in Ni-W electrodeposits

DEFF Research Database (Denmark)

Mizushima, Io; Tang, Peter Torben; Hansen, Hans Nørgaard

2006-01-01

In the present work, the residual stress in Ni–W layers electrodeposited from electrolytes based on NiSO4 and Na2WO4, is investigated. Citrate, glycine and triethanolamine were used as complexing agents, enabling complex formation between the nickel ion and tungstate. The results show that the type...... of complexing agent and the current efficiency have an influence on the residual stress. In all cases, an increase in tensile stress in the deposit with time after deposition was observed. Pulse plating could improve the stress level for the electrolyte containing equal amounts of citrate...

Compact composition operators on real Banach spaces of complex-valued bounded Lipschitz functions

Directory of Open Access Journals (Sweden)

Davood Alimohammadi

2014-10-01

Full Text Available We characterize compact composition operators on real Banachspaces of complex-valued bounded Lipschitz functions on metricspaces, not necessarily compact, with Lipschitz involutions anddetermine their spectra.

The super-W sub infinity (. lambda. ) algebra

Energy Technology Data Exchange (ETDEWEB)

Bergshoeff, E; Vasiliev, M [European Organization for Nuclear Research, Geneva (Switzerland). Theory Div.; Wit, B de [Rijksuniversiteit Utrecht (Netherlands). Inst. voor Theoretische Fysica

1991-03-07

We present the super-W{sub {infinity}}({lambda}) algebra, an extension of the Virasoro algebra that contains operators of al spins s {ge} 1/2 and depends on an arbitrary parameter {lambda}. It encompasses all previously known versions of W{sub {infinity}}-type algebras as special cases. We discuss various properties and truncations of the algebra and present a realization in terms of the currents of a supersymmetric bc system. (orig.).

Firmy rodzinne w Polsce w dobie globalizacji

OpenAIRE

Zalewska, Agnieszka

2016-01-01

Celem publikacji jest ukazanie dorobku naukowego, głównie polskich i ukraińskich uczonych, w zakresie uwarunkowań procesów i rezultatów internacjonalizacji przedsiębiorstw oraz jej wpływu na funkcjonowanie biznesu w dobie globalizacji. Opracowanie stanowi istotny wkład w zakresie teorii i praktyki w proces restrukturyzacji przedsiębiorstw w kierunku ich internacjonalizacji. Może posłużyć jako inspiracja do stworzenia strategii opartej na poszukiwaniach (prospector strategy), co będzie sprzyja...

36 CFR 11.3 - Power to revoke.

Science.gov (United States)

2010-07-01

... AND PARKSCAPE SYMBOLS § 11.3 Power to revoke. Permission granted under this part by the Director may... injurious to their integrity or inconsistent with the purposes of the National Park Service in the fields of...

Lectures on W algebras and W gravity

International Nuclear Information System (INIS)

Pope, C.N.

1992-01-01

We give a review of the extended conformal algebras, known as W algebras, which contain currents of spins higher than 2 in addition to the energy-momentum tensor. These include the non-linear W N algebras; the linear W ∞ and W 1+∞ algebras; and their super-extensions. We discuss their applications to the construction of W-gravity and W-string theories. (author). 46 refs

Design, performance and economics of the DAF Indal 50 kW and 375 kW vertical axis wind turbine

Science.gov (United States)

Schienbein, L. A.; Malcolm, D. J.

1982-03-01

A review of the development and performance of the DAF Indal 50 kW vertical axis Darrieus wind turbines shows that a high level of technical development and reliability has been achieved. Features of the drive train, braking and control systems are discussed and performance details are presented. A description is given of a wind-diesel hybrid presently being tested. Details are also presented of a 375 kW VAWT planned for production in late 1982. A discussion of the economics of both the 50 kW and 375 kW VAWTs is included, showing the effects of charge rate, installed cost, operating cost, performance and efficiency. The energy outputs are translated into diesel fuel cost savings for remote communities.

Greenberger-Horne-Zeilinger and W entanglement witnesses for the noninteracting Fermi gas

International Nuclear Information System (INIS)

Habibian, Hessam; Clark, John W.; Behbood, Naeimeh; Hingerl, Kurt

2010-01-01

The existence and nature of tripartite entanglement of a noninteracting Fermi gas (NIFG) is investigated. Three classes of parametrized entanglement witnesses (EWs) are introduced with the aim of detecting genuine tripartite entanglement in the three-body reduced density matrix and discriminating between the presence of the two types of genuine tripartite entanglement, W/B and GHZ/W (the convex set of B states is comprised of mixed states of product and biseparable states; that of W states is comprised of mixed states of B states and W-type pure entangled states; and the GHZ (Greenberger-Horne-Zeilinger) set contains generic mixtures of any kind for a tripartite system). By choosing appropriate EW operators, the problem of finding GHZ and W EWs is reduced to linear programming. Specifically, we devise W EWs based on a spin-chain model with periodic boundary conditions, and we construct a class of parametrized GHZ EWs by linearly combining projection operators corresponding to all the different state-vector types arising for a three-fermion system. A third class of EWs is provided by a GHZ stabilizer operator capable of distinguishing W/B from GHZ/B entanglement, which is not possible with W EWs. Implementing these classes of EWs, it is found that all states containing genuine tripartite entanglement are of W type, and hence states containing GHZ/W genuine tripartite entanglement do not arise. Some genuine tripartite entangled states that have a positive partial transpose (PPT) with respect to some bipartition are detected. Finally, it is demonstrated that a NIFG does not exhibit 'pure'W/B genuine tripartite entanglement: three-party entanglement without any separable or biseparable admixture does not occur.

Low concentration ratio solar array for low Earth orbit multi-100 kW application. Volume 1: Design, analysis and development tests

Science.gov (United States)

1983-01-01

A preliminary design effort directed toward a low concentration ratio photovoltaic array system capable of delivering multihundred kilowatts (300 kW to 1000 kW range) in low earth orbit is described. The array system consists of two or more array modules each capable of delivering between 113 kW to 175 kW using silicon solar cells or gallium arsenide solar cells, respectively. The array module deployed area is 1320 square meters and consists of 4356 pyramidal concentrator elements. The module, when stowed in the Space Shuttle's payload bay, has a stowage volume of a cube with 3.24 meters on a side. The concentrator elements are sized for a geometric concentration ratio (GCR) of six with an aperture area of .25 sq. m. The structural analysis and design trades leading to the baseline design are discussed. It describes the configuration, as well as optical, thermal and electrical performance analyses that support the design and overall performance estimates for the array are described.

W7-AS: One step of the Wendelstein stellarator linea)

Science.gov (United States)

Wagner, F.; Bäumel, S.; Baldzuhn, J.; Basse, N.; Brakel, R.; Burhenn, R.; Dinklage, A.; Dorst, D.; Ehmler, H.; Endler, M.; Erckmann, V.; Feng, Y.; Gadelmeier, F.; Geiger, J.; Giannone, L.; Grigull, P.; Hartfuss, H.-J.; Hartmann, D.; Hildebrandt, D.; Hirsch, M.; Holzhauer, E.; Igitkhanov, Y.; Jänicke, R.; Kick, M.; Kislyakov, A.; Kisslinger, J.; Klinger, T.; Klose, S.; Knauer, J. P.; König, R.; Kühner, G.; Laqua, H. P.; Maassberg, H.; McCormick, K.; Niedermeyer, H.; Nührenberg, C.; Pasch, E.; Ramasubramanian, N.; Ruhs, N.; Rust, N.; Sallander, E.; Sardei, F.; Schubert, M.; Speth, E.; Thomsen, H.; Volpe, F.; Weller, A.; Werner, A.; Wobig, H.; Würsching, E.; Zarnstorff, M.; Zoletnik, S.

2005-07-01

This paper is a summary of some of the major results from the Wendelstein 7-AS stellarator (W7-AS). W7-AS [G. Grieger et al., Phys. Fluids B 4, 2081 (1992)] has demonstrated the feasibility of modular coils and has pioneered the island divertor and the modeling of its three-dimensional characteristics with the EMC3/EIRENE code [Y. Feng, F. Sardei et al., Plasma Phys. Controlled Fusion 44, 611 (2002)]. It has extended the operational range to high density (4×1020m-3 at 2.5T) and high ⟨β⟩ (3.4% at 0.9T); it has demonstrated successfully the application of electron cyclotron resonance heating (ECRH) beyond cutoff via electron Bernstein wave heating, and it has utilized the toroidal variation of the magnetic field strength for ion cyclotron resonance frequency beach-wave heating. In preparation of W7-X [J. Nührenberg et al., Trans. Fusion Technol. 27, 71 (1995)], aspects of the optimization concept of the magnetic design have been successfully tested. W7-AS has accessed the H-mode, the first time in a "non-tokamak" and has extended H-mode operation toward high density by the discovery of the high-density H-mode (HDH), characterized by H-mode energy and L-mode-level impurity confinement. In the HDH-mode quasisteady state operation is possible close to operational limits without noticeable degradation in the plasma properties. High-β phases up to tpulse/τE=65 have been achieved, which can already be taken as an indication of the intrinsic stellarator capability of steady-state operation. Confinement issues will be discussed with emphasis on the similarities to tokamak confinement (general transport properties, H-mode transition physics) but also with respect to distinct differences (no confinement degradation toward operational boundaries, positive density scaling, lack of profile resilience, no distinct isotope effect, H-mode operational window). W7-AS turned out to be an important step in the development of the Wendelstein stellarator line towards an

29 CFR Appendix A to Subpart W to... - Figures W-14 through W-28

Science.gov (United States)

2010-07-01

... 29 Labor 8 2010-07-01 2010-07-01 false Figures W-14 through W-28 A Appendix A to Subpart W to part 1926 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION...; Overhead Protection Pt. 1926, Subpt. W, App. A Appendix A to Subpart W to part 1926—Figures W-14 through W...

Simplified reactive power management strategy for complex power grids under stochastic operation and incomplete information

International Nuclear Information System (INIS)

Vlachogiannis, John G.

2009-01-01

In the current released energy market, the large-scale complex transmission networks and the distribution ones with dispersed energy sources and 'intelligent' components operate under uncertainties, stochastic and prior incomplete information. A safe and reliable operation of such complex power grids is a major issue for system operators. Under these circumstances an online reactive power management strategy with minimum risk concerning all uncertain and stochastic parameters is proposed. Therefore, new concepts such as reactive power-weighted node-to-node linking and reactive power control capability are introduced. A distributed and interconnected stochastic learning automata system is implemented to manage, in a unified and unique way, the reactive power in complex power grids with stochastic reactive power demand and detect the vulnerable part. The proposed simplified strategy can also consider more stochastic aspects such as variable grid's topology. Results of the proposed strategy obtained on the networks of IEEE 30-bus and IEEE 118-bus systems demonstrate the effectiveness of the proposed strategy.

Operational performance of the development of a 15 kW parabolic trough mid-temperature solar receiver/reactor for hydrogen production

International Nuclear Information System (INIS)

Hong, Hui; Liu, Qibin; Jin, Hongguang

2012-01-01

Highlights: ► A 15 kW solar chemical receiver/reactor for hydrogen production was developed. ► The solar thermochemical efficiency of the receiver/reactor was in the range of 20–28%. ► Hydrogen production exceeding 80% was achieved. ► The research results extend the application of mid-temperature solar thermal energy. -- Abstract: In this paper, we report the operational performance and energy conversion efficiency of a developed 15 kW solar chemical receiver/reactor for hydrogen production. A concentrated solar heat of around 200–300 °C was utilized to provide process heat to drive methanol steam reforming. A modified 15 kW direct-irradiation solar reactor coupled with a linear receiver positioned along the focal line of a one-axis parabolic trough concentrator was used. The experiments were conducted from 200 to 300 °C under a mean solar flux of 300–800 W/m 2 and a reactant feeding rate of 6 kg/h. Reactants were continuously fed, and the attained conversion rate of methanol was more than 70% at 700 W/m 2 . The typical solar thermochemical efficiency of solar thermal energy converted into chemical energy was in the 20–28% range. The overall energy efficiency of input solar power conversion into chemical energy reached up to 17% and may be further increased by improving solar field efficiency. Hydrogen production exceeding 80% was achieved. In addition, preliminary economic evaluation was performed, and methods for further improvement were proposed. This paper proves that solar hydrogen production is feasible by combining solar thermal energy with alternative fuel at around 200–300 °C, which is much lower than the temperature of other solar thermochemical processes. This may offer an economic approach to solar fuel production and extend the application of mid-temperature solar thermal energy.

Sustained operation of sensor nodes with energy harvesters and supercapacitors

Energy Technology Data Exchange (ETDEWEB)

Renner, Bernd-Christian

2013-06-01

Sensor nodes powered by energy harvesters and supercapacitors open the door to unlimited and uninterrupted operation. This dissertation closes the persistent gap of system integration w.r.t. holistic online energy assessment, develops a new concept for harvest forecasting while assessing the behavior and quality of known approaches, and proposes a novel load adaptation scheme to achieve sustained and uniform sensor node operation with low complexity and computational overhead. For this purpose, a prototype of an energy harvester with a supercapacitor for off-the-shelf sensor nodes is developed and used for practical evaluation.

Editorial Special issue: Operations Management in Service Systems Downloaded from

OpenAIRE

Babai , Mohamed Zied; Jouini , Oualid

2013-01-01

International audience; The service sector is the largest sector of the economy in most industrialized nations, and is fast becoming the largest sector in developing nations as well. Driven by today's new business environment, including advanced telecommunications, accelerated business globalization, increased automation and highly on-demand and competitive innovations, the complexity of the operations management of service systems is continuously increasing. Managers of service systems are w...

14 CFR 61.113 - Private pilot privileges and limitations: Pilot in command.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Private pilot privileges and limitations: Pilot in command. 61.113 Section 61.113 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRMEN CERTIFICATION: PILOTS, FLIGHT INSTRUCTORS, AND GROUND...

47 CFR 74.113 - Supplementary reports with application for renewal of license.

Science.gov (United States)

2010-10-01

... renewal of license. 74.113 Section 74.113 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED... covered. (4) Power employed, field intensity measurements and visual and aural observations and the types... respective types of transmissions. (5) Estimated degree of public participation in reception and the results...

Genome Sequence of the Biocontrol Strain Pseudomonas fluorescens F113

Science.gov (United States)

Redondo-Nieto, Miguel; Barret, Matthieu; Morrisey, John P.; Germaine, Kieran; Martínez-Granero, Francisco; Barahona, Emma; Navazo, Ana; Sánchez-Contreras, María; Moynihan, Jennifer A.; Giddens, Stephen R.; Coppoolse, Eric R.; Muriel, Candela; Stiekema, Willem J.; Rainey, Paul B.; Dowling, David; O'Gara, Fergal; Martín, Marta

2012-01-01

Pseudomonas fluorescens F113 is a plant growth-promoting rhizobacterium (PGPR) that has biocontrol activity against fungal plant pathogens and is a model for rhizosphere colonization. Here, we present its complete genome sequence, which shows that besides a core genome very similar to those of other strains sequenced within this species, F113 possesses a wide array of genes encoding specialized functions for thriving in the rhizosphere and interacting with eukaryotic organisms. PMID:22328765

Quantum statistical vibrational entropy and enthalpy of formation of helium-vacancy complex in BCC W

Energy Technology Data Exchange (ETDEWEB)

Wen, Haohua [Sino-French Institute of Nuclear Engineering and Technology, Sun Yat-Sen University, 519082, Zhuhai (China); Woo, C.H., E-mail: chung.woo@polyu.edu.hk [ME Department, The Hong Kong Polytechnic University, Hong Kong SAR (China)

2016-12-15

High-temperature advance-reactor design and operation require knowledge of in-reactor materials properties far from the thermal ground state. Temperature-dependence due to the effects of lattice vibrations is important to the understanding and formulation of atomic processes involved in irradiation-damage accumulation. In this paper, we concentrate on the formation of He-V complex. The free-energy change in this regard is derived via thermodynamic integration from the phase-space trajectories generated from MD simulations based on the quantum fluctuation-dissipation relation. The change of frequency distribution of vibration modes during the complex formation is properly accounted for, and the corresponding entropy change avoids the classical ln(T) divergence that violates the third law. The vibrational enthalpy and entropy of formation calculated this way have significant effects on the He kinetics during irradiation.

The step complexity measure for emergency operating procedures: measure verification

International Nuclear Information System (INIS)

Park, Jinkyun; Jung, Wondea; Ha, Jaejoo; Park, Changkue

2002-01-01

In complex systems, such as nuclear power plants (NPPs) or airplane control systems, human errors play a major role in many accidents. Therefore, to prevent an occurrence of accidents or to ensure system safety, extensive effort has been made to identify significant factors that can cause human errors. According to related studies, written manuals or operating procedures are revealed as one of the most important factors, and the understandability is pointed out as one of the major reasons for procedure-related human errors. Many qualitative checklists are suggested to evaluate emergency operating procedures (EOPs) of NPPs. However, since qualitative evaluations using checklists have some drawbacks, a quantitative measure that can quantify the complexity of EOPs is very necessary to compensate for them. In order to quantify the complexity of steps included in EOPs, Park et al. suggested the step complexity (SC) measure. In addition, to ascertain the appropriateness of the SC measure, averaged step performance time data obtained from emergency training records for the loss of coolant accident and the excess steam dump event were compared with estimated SC scores. Although averaged step performance time data show good correlation with estimated SC scores, conclusions for some important issues that have to be clarified to ensure the appropriateness of the SC measure were not properly drawn because of lack of backup data. In this paper, to clarify remaining issues, additional activities to verify the appropriateness of the SC measure are performed using averaged step performance time data obtained from emergency training records. The total number of available records is 36, and training scenarios are the steam generator tube rupture and the loss of all feedwater. The number of scenarios is 18 each. From these emergency training records, averaged step performance time data for 30 steps are retrieved. As the results, the SC measure shows statistically meaningful

Step Complexity Measure for Emergency Operating Procedures - Determining Weighting Factors

International Nuclear Information System (INIS)

Park, Jinkyun; Jung, Wondea; Kim, Jaewhan; Ha, Jaejoo

2003-01-01

In complex systems, such as nuclear power plants (NPPs) or airplane control systems, human error has been regarded as the primary cause of many events. Therefore, to ensure system safety, extensive effort has been made to identify the significant factors that can cause human error. According to related studies, written manuals or operating procedures are revealed as one of the important factors, and the understandability is pointed out as one of the major reasons for procedure-related human errors.Many qualitative checklists have been suggested to evaluate emergency operating procedures (EOPs) of NPPs so as to minimize procedure-related human errors. However, since qualitative evaluations using checklists have some drawbacks, a quantitative measure that can quantify the complexity of EOPs is indispensable.From this necessity, Park et al. suggested the step complexity (SC) measure to quantify the complexity of procedural steps included in EOPs. To verify the appropriateness of the SC measure, averaged step performance time data obtained from emergency training records of the loss-of-coolant accident (LOCA) and the excess steam demand event were compared with estimated SC scores. However, although averaged step performance time data and estimated SC scores show meaningful correlation, some important issues such as determining proper weighting factors have to be clarified to ensure the appropriateness of the SC measure. These were not properly dealt with due to a lack of backup data.In this paper, to resolve one of the important issues, emergency training records are additionally collected and analyzed in order to determine proper weighting factors. The total number of collected records is 66, and the training scenarios cover five emergency conditions including the LOCA, the steam generator tube rupture, the loss of all feedwater, the loss of off-site power, and the station blackout. From these records, average step performance time data are retrieved, and new

A Guidebook on Grid Interconnection and Islanded Operation of Mini-Grid Power Systems Up to 200 kW

Energy Technology Data Exchange (ETDEWEB)

Greacen, Chris [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Engel, Richard [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Quetchenbach, Thomas [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

2013-04-01

A Guidebook on Grid Interconnection and Islanded Operation of Mini-Grid Power Systems Up to 200 kW is intended to help meet the widespread need for guidance, standards, and procedures for interconnecting mini-grids with the central electric grid as rural electrification advances in developing countries, bringing these once separate power systems together. The guidebook aims to help owners and operators of renewable energy mini-grids understand the technical options available, safety and reliability issues, and engineering and administrative costs of different choices for grid interconnection. The guidebook is intentionally brief but includes a number of appendices that point the reader to additional resources for indepth information. Not included in the scope of the guidebook are policy concerns about “who pays for what,” how tariffs should be set, or other financial issues that are also paramount when “the little grid connects to the big grid.”

Hafty w sztambuchach Biblioteki Uniwersyteckiej w Poznaniu

Directory of Open Access Journals (Sweden)

Karolina Nowaczyk

2011-01-01

Full Text Available W artykule przedstawiono hafty znajdujące się w sztambuchach z XVIII i XIX wieku pochodzących ze zbiorów Biblioteki Uniwersyteckiej w Poznaniu. Omówione zostały zarówno technika wykonania haftów, jak i ich wartość artystyczna, a także znaczenie wskazanych przykładów dla historii hafciarstwa amatorskiego na ziemiach polskich. Artykuł jest jednocześnie próbą zwrócenia uwagi na istniejącą w tamtym okresie sztukę hafciarską o wyłącznie amatorskim charakterze oraz na kopiowanie i powtarzalność wzorów, co pozwala na określenie ich jako typowych dla danej epoki.

Geochemistry of Gneisses from Dabie Complex and Tongbai Complex in Qinling-Tongbai-Dabie Orogenic Belt: Implications for Location of Yangtze-Sino-Korean Suture

Institute of Scientific and Technical Information of China (English)

无

2000-01-01

The Dabie complex (DC) and the Tongbai complex (TBC) are separately distributed in the middle and eastern parts of the Qinling-Tongbai-Dabie orogenic belt. In this study, the Dabie complex can be divided into two units: one is the complex with no high pressure and ultrahigh pressure metamorphic rocks (DC1), and the other is the complex containing coesite-bearing eclogite lenses or boudins (DC2). Gneisses are predominant in the TBC, DC1 and DC2. Major and trace element data of gneisses in the TBC, DC1 and DC2 show them to be the orthogneisses. The gneisses in the DC1 have higher incompatible element contents and higher ratios of w(K2O)/w(Na2O) and w(La)n/w(Yb)n than those in the DC2. However, no obvious differences arise in other element contents and the ratios of w(La)/w( Nb), w(Nb)/w(Th), w(Nb)/w(Hf), w(Ba)/w(La), w(Sm)/w(Nd) and w(Th)/w(U) between the gneisses in the DC2 and those in the DC1. These observations suggest that the protoliths of the gneisses in the DC2 have affinities to those in the DC1. The difference between the DC1 and DC2 gneisses in incompat- ible element contents could reflect the difference in their partial melting extent. The TBC gneisses are geochemically similar to the DC1 gneisses, suggesting that the TBC and DC1 gneisses are the same lithologic unit in the Qinling-Tongbai-Dabie orogenic belt and that they have experienced similar formations and evolution histories. In the Qinling-Tongbai area, the TBC is part of the northern blocks of the Yangtze craton. Given the similarity of geochemical characteristics, the rock assemblage and the ages between the TBC and DC1 gneisses, we can infer that the Dabie complex also belongs to the northern blocks of the Yangtze craton. In terms of the distribution of eciogites and metamorphic facies, we propose that the collisionai suture in the Dabie area is distributed along the Xiaotian-Mozitan fault, at the contact with the Shang-Dan-Tongbai fault to the west.

Supplement analysis for the proposed upgrades to the tank farm ventilation, instrumentation, and electrical systems under Project W-314 in support of tank farm restoration and safe operations

International Nuclear Information System (INIS)

1997-05-01

The mission of the TWRS program is to store, treat, and immobilize highly radioactive tank waste in an environmentally sound, safe, and cost-effective manner. Within this program, Project W-314, Tank Farm Restoration and Safe Operations, has been established to provide upgrades in the areas of instrumentation and control, tank ventilation, waste transfer, and electrical distribution for existing tank farm facilities. Requirements for tank farm infrastructure upgrades to support safe storage were being developed under Project W-314 at the same time that the TWRS EIS alternative analysis was being performed. Project W-314 provides essential tank farm infrastructure upgrades to support continued safe storage of existing tank wastes until the wastes can be retrieved and disposed of through follow-on TWRS program efforts. Section4.0 provides a description of actions associated with Project W-314. The TWRS EIS analyzes the environmental consequences form the entire TWRS program, including actions similar to those described for Project W-314 as a part of continued tank farm operations. The TWRS EIS preferred alternative was developed to a conceptual level of detail to assess bounding impact areas. For this Supplement Analysis, in each of the potential impact areas for Project W-314, the proposed action was evaluated and compared to the TWRS EIS evaluation of the preferred alternative (Section 5.0). Qualitative and/or quantitative comparisons are then provided in this Supplement Analysis to support a determination on the need for additional National Environmental Policy Act (NEPA) analysis. Based on this Supplement Analysis, the potential impacts for Project W-314 would be small in comparison to and are bounded by the impacts assessed for the TWRS EIS preferred alternative, and therefore no additional NEPA analysis is required (Section 7.0)

48 CFR 1371.113 - Department of Labor occupational safety and health standards for ship repair.

Science.gov (United States)

2010-10-01

... occupational safety and health standards for ship repair. 1371.113 Section 1371.113 Federal Acquisition... CONSTRUCTION AND SHIP REPAIR Provisions and Clauses 1371.113 Department of Labor occupational safety and health standards for ship repair. Insert clause 1352.271-82, Department of Labor Occupational Safety and Health...

Effect of impurities on the growth of {113} interstitial clusters in silicon under electron irradiation

Science.gov (United States)

Nakai, K.; Hamada, K.; Satoh, Y.; Yoshiie, T.

2011-01-01

The growth and shrinkage of interstitial clusters on {113} planes were investigated in electron irradiated Czochralski grown silicon (Cz-Si), floating-zone silicon (Fz-Si), and impurity-doped Fz-Si (HT-Fz-Si) using a high voltage electron microscope. In Fz-Si, {113} interstitial clusters were formed only near the beam incident surface after a long incubation period, and shrank on subsequent irradiation from the backside of the specimen. In Cz-Si and HT-Fz-Si, {113} interstitial clusters nucleated uniformly throughout the specimen without incubation, and began to shrink under prolonged irradiation at higher electron beam intensity. At lower beam intensity, however, the {113} interstitial cluster grew stably. These results demonstrate that the {113} interstitial cluster cannot grow without a continuous supply of impurities during electron irradiation. Detailed kinetics of {113} interstitial cluster growth and shrinkage in silicon, including the effects of impurities, are proposed. Then, experimental results are analyzed using rate equations based on these kinetics.

High Level Expression and Purification of the Clinically Active Antimicrobial Peptide P-113 in Escherichia coli

Directory of Open Access Journals (Sweden)

Kuang-Ting Cheng

2018-03-01

Full Text Available P-113, which was originally derived from the human saliva protein histatin 5, is a histidine-rich antimicrobial peptide with the sequence AKRHHGYKRKFH. P-113 is currently undergoing phase II clinical trial as a pharmaceutical agent to fight against fungal infections in HIV patients with oral candidiasis. Previously, we developed a new procedure for the high-yield expression and purification of hG31P, an analogue and antagonist of human CXCL8. Moreover, we have successfully removed lipopolysaccharide (LPS, endotoxin associated with hG31P in the expression with Escherichia coli. In this paper, we have used hG31P as a novel fusion protein for the expression and purification of P-113. The purity of the expressed P-113 is more than 95% and the yield is 4 mg P-113 per liter of E. coli cell culture in Luria-Bertani (LB medium. The antimicrobial activity of the purified P-113 was tested. Furthermore, we used circular dichroism (CD and nuclear magnetic resonance (NMR spectroscopy to study the structural properties of P-113. Our results indicate that using hG31P as a fusion protein to obtain large quantities of P-113 is feasible and is easy to scale up for commercial production. An effective way of producing enough P-113 for future clinical studies is evident in this study.

9 CFR 113.102 - Leptospira Icterohaemorrhagiae Bacterin.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Icterohaemorrhagiae... REQUIREMENTS Inactivated Bacterial Products § 113.102 Leptospira Icterohaemorrhagiae Bacterin. Leptospira Icterohaemorrhagiae Bacterin shall be produced from a culture of Leptospira icterohaemorrhagiae which has been...

Functions and requirements for tank farm restoration and safe operations, Project W-314. Revision 3

International Nuclear Information System (INIS)

Garrison, R.C.

1995-01-01

This Functions and Requirements document (FRD) establishes the basic performance criteria for Project W-314, in accordance with the guidance outlined in the letter from R.W. Brown, RL, to President, WHC, ''Tank Waste Remediation System (TWRS) Project Documentation Methodology,'' 94-PRJ-018, dated 3/18/94. The FRD replaces the Functional Design Criteria (FDC) as the project technical baseline documentation. Project W-314 will improve the reliability of safety related systems, minimize onsite health and safety hazards, and support waste retrieval and disposal activities by restoring and/or upgrading existing Tank Farm facilities and systems. The scope of Project W-314 encompasses the necessary restoration upgrades of the Tank Farms' instrumentation, ventilation, electrical distribution, and waste transfer systems

Influence of ionic complexation on release rate profiles from multiple water-in-oil-in-water (W/O/W) emulsions.

Science.gov (United States)

Bonnet, Marie; Cansell, Maud; Placin, Frédéric; David-Briand, Elisabeth; Anton, Marc; Leal-Calderon, Fernando

2010-07-14

Water-in-oil-in-water (W/O/W) double emulsions were prepared, and the kinetics of release of magnesium ions from the internal to the external water phase was followed. Different chelating agents (phosvitin and gluconate) were used to bind magnesium within the prospect of improving the ion retention in the internal aqueous droplets. Magnesium release was monitored for 1 month of storage, for each formulation, with and without chelation, at two storage temperatures (4 and 25 degrees C). Leakage occurred without film rupturing (coalescence) and was mainly due to entropically driven diffusion/permeation phenomena. The experimental results revealed a clear correlation between the effectiveness of chelating agents to delay the delivery and their binding capacity characterized by the equilibrium affinity constant. The kinetic data (percent released versus time curves) were interpreted within the framework of a kinetic model based on diffusion and taking into account magnesium chelation.

Performance improvement of 100 kW high frequency transmitter for CW operation

International Nuclear Information System (INIS)

Kwak, J. G.; Yoon, J. S.; Bae, Y. D.; Cho, C. G.; Wang, S. J.; Lee, K. D.

2001-08-01

For the plasma heating of KSTAR(Korea Superconducting Tokamak Advanced Research)by using ICH(Ion Cyclotron Heating), it is designed that the selective ion heating and current drive are performed by the transmitter with the rf power of 8 MW in the frequency range of 25-60 MHz. 100 kW HF transmitter was constructed for the high voltage/current test of ICH antenna and HF transmission components. The output power is about 100 kW around 30 MHz. Thomson 581 tetrode is used for the final amplifier whose cavity type is ground cathode. Overall gain is above 15 dB and the bandwidth is about 100 kHz

B and W model boiler tests: effect of temperature on IGA rate. Initial and post-1878 operating conditions of the model boilers

International Nuclear Information System (INIS)

Anon.

1986-01-01

The Babcock and Wilcox (B and W) model boiler operated with 10 ppm weekly injections of NaOH for 41,900 hours (4.8 years). The model boiler operating conditions are given. Tube No. 24 failed by caustic intergranular attack/stress corrosion cracking (IGA/SCC) at the steam-water zone. IGA defect depths on tube 24 is compared at different locations, which also have different temperature conditions. The specific locations are: steam/water zone, drilled baffle plate, and lower tube sheet crevice. In all locations caustic will concentrate (although to different concentration levels). Nevertheless, an effect of temperature on IGA rate can be estimated. The degree of attack relative to the location and environment is shown. SEM fractographs illustrate the completely intergranular failure of Tube 24. A summary of the estimated results is presented. These results show the estimated IGA rate as a function of primary/secondary temperature and estimated caustic concentration. Details of the failure analysis of the model boiler can be found in the final report Destructive Examination of Babcock and Wilcox's Model Boiler for Intergranular Attack (IGA) on Tubes, EPRI S302-6, J.L.; Barna and L.W. Sarver

Well-Defined Surface Species [(≡Si - O -)W(=O)Me3] Prepared by Direct Methylation of [(≡Si - O -)W(=O)Cl3], a Catalyst for Cycloalkane Metathesis and Transformation of Ethylene to Propylene

KAUST Repository

Hamieh, Ali Imad Ali

2015-04-03

The silica-supported tungsten oxo-trimethyl complex [(≡Si - O -)W(=O)Me3] was synthesized using a novel SOMC synthetic approach. By grafting the inexpensive stable compound WOCl4 on the surface of silica, partially dehydroxylated at 700 °C (SiO2-700), a well-defined monopodal surface complex [(≡Si - O -)W(=O)Cl3] was produced. The supported complex directly methylated with ZnMe2 and transformed into [(≡Si - O -)W(=O)Me3], which we fully characterized by microanalysis, IR, mass balance and SS NMR (1H, 13C, 1H-13C HETCOR, 1H-1H DQ and TQ). [(≡Si - O)W(=O)Me3] has two conformational isomers on the surface at room temperature. The conversion of one to the other was observed at 318 K by variable-temperature 13C CP/MAS and 1H spin echo MAS solid-state NMR; this was also confirmed by NMR and DFT calculations. [(≡Si - O)W(=O)Me3] was found to be active in cyclooctane metathesis and to have a wide distribution range in ring-contracted and ring-expanded products. In addition, [(≡Si - O)W(=O)Me3] proved to be highly active for selective transformation of ethylene to propylene compared to other silica-supported organometallic complexes. (Chemical Equation Presented). © 2015 American Chemical Society.

Well-Defined Surface Species [(≡Si - O -)W(=O)Me3] Prepared by Direct Methylation of [(≡Si - O -)W(=O)Cl3], a Catalyst for Cycloalkane Metathesis and Transformation of Ethylene to Propylene

KAUST Repository

Hamieh, Ali Imad Ali; Chen, Yin; Abdel-Azeim, Safwat; Abou-Hamad, Edy; Goh, Li Min Serena; Samantaray, Manoja; Dey, Raju; Cavallo, Luigi; Basset, Jean-Marie

2015-01-01

The silica-supported tungsten oxo-trimethyl complex [(≡Si - O -)W(=O)Me3] was synthesized using a novel SOMC synthetic approach. By grafting the inexpensive stable compound WOCl4 on the surface of silica, partially dehydroxylated at 700 °C (SiO2-700), a well-defined monopodal surface complex [(≡Si - O -)W(=O)Cl3] was produced. The supported complex directly methylated with ZnMe2 and transformed into [(≡Si - O -)W(=O)Me3], which we fully characterized by microanalysis, IR, mass balance and SS NMR (1H, 13C, 1H-13C HETCOR, 1H-1H DQ and TQ). [(≡Si - O)W(=O)Me3] has two conformational isomers on the surface at room temperature. The conversion of one to the other was observed at 318 K by variable-temperature 13C CP/MAS and 1H spin echo MAS solid-state NMR; this was also confirmed by NMR and DFT calculations. [(≡Si - O)W(=O)Me3] was found to be active in cyclooctane metathesis and to have a wide distribution range in ring-contracted and ring-expanded products. In addition, [(≡Si - O)W(=O)Me3] proved to be highly active for selective transformation of ethylene to propylene compared to other silica-supported organometallic complexes. (Chemical Equation Presented). © 2015 American Chemical Society.

Operation test for 200-kW class internally improved MCFC stacks having achieved 5000 hours; 200kW kyu naibu kaishitsu gata MCFC sutakku unten shiken 5,000 jikan tassei

Energy Technology Data Exchange (ETDEWEB)

Hashino, K. [Kansai Electric Power Co. Inc., Osaka (Japan)

2000-03-10

The operation test for 200-kW class internally improved MCFC stacks being performed at the Amagasaki fuel cell power generation testing plant of Kansai Electric Power Co., Inc. has achieved on January 22, 2000 five thousand hours, the original test time target. Temperature raising has begun on June 18 last year, and the first power generation was carried out on June 30. Since then the operation has continued smoothly at near rated output, and the test was completed nearly as planned without experiencing any trouble caused by Y2K problem. This research is being carried out as the research work shared by the Molten Carbonate Fuel Cell Power Generation System Technology Research Association (MCFC Research Association) based on the research commissioning from NEDO as part of the New Sunshine Project. After the confirmation of the initial performance, verification of the carbon dioxide self-sustaining operation, and the property evaluation test of every 500 hours are going smoothly. The intention hereafter is to achieve 5,000 hours as the power generation time, with the schedule to reduce the stack temperature in the middle of February, and cease the operation. As of January 25, the amount of power generated reached 1,089 MWh. (NEDO)

Use of Cad Systems in Testing the Collision of Underground Transportation Means / Zastosowanie systemów Cad w badaniach kolizyjności środków transportu podziemnego

Science.gov (United States)

Dudek, Marek

2013-06-01

A concept of use of CAD systems in testing collision of underground transportation means is presented. Reasons for undertaking this problem are given with end users identified. The concept of the system for collision analyses of transported loads is described. Examples of collision analysis during transportation of powered roof support are given. Presented system is designed to aid planning, organizational and training activities undertaken in management of transportation safety in mines. It will be also possible to use software resources, developed within the system as the didactic material as regards safe transportation process, which include hazards to the employees working in the area of transportation operations. Developed prototype of a system for testing the collision of underground transportation means was positively assessed by employees of the Coal Company, JSC - industrial partner of KOMAG. This prototype is continuously improved and adapted for commercial implementation in the selected coal mines. W pracy przedstawiono koncepcję zastosowania systemów CAD w badaniach kolizyjności środków transportu podziemnego. Określono przyczyny podjęcia tematu oraz zidentyfikowano końcowych użytkowników. Zaprezentowano koncepcję systemu do analiz kolizyjności transportowanych ładunków. Pokazano przykłady analizy kolizyjności podczas transportu sekcji obudowy zmechanizowanej. Przedstawiony system przeznaczony jest do wspomagania działań planistycznych, organizacyjnych i szkoleniowych podejmowanych w zarządzaniu bezpieczeństwem transportu w zakładach górniczych. Opracowane w ramach systemu zasoby programowe będzie można również wykorzystać jako materiał dydaktyczny z zakresu bezpieczeństwa pracy w transporcie, uwzględniający zagrożenia dla pracowników pracujących w bezpośredniej strefie prac transportowych. Opracowany prototyp systemu do badania kolizyjności środków transportu podziemnego został pozytywnie oceniony przez pracowników

Ekspansja muzeów w Europie Środkowej?

Directory of Open Access Journals (Sweden)

Jagodzińska, Katarzyna

2015-06-01

Full Text Available Przedmiotem artykułu są rozważania na temat specyfiki Europy Środkowej w zakresie kolekcji i muzeów sztuki współczesnej oraz możliwość stworzenia alternatywy regionalnej dla krajów zachodnich. Kontekstem dla tych rozważań jest ekspansjonistyczna polityka współczesnych muzeów, która w związku z licznymi nowymi inwestycjami – w szczególności Luwru, Fundacji Guggenheima, Ermitażu – budzi w świecie muzeologicznym różnorakie dylematy. Autorka omawia światowe "marki muzealne" inwestujące w Europie Środkowej, zastanawia się nad skutkami ekspansji tych "koncernów" dla kultury w regionie, wskazuje też na potencjał regionu, który można wykorzystać bez posiłkowania się nazwiskami światowych kolekcjonerów.

9 CFR 113.452 - Erysipelothrix Rhusiopathiae Antibody.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Erysipelothrix Rhusiopathiae Antibody... REQUIREMENTS Antibody Products § 113.452 Erysipelothrix Rhusiopathiae Antibody. Erysipelothrix Rhusiopathiae Antibody is a specific antibody product containing antibodies directed against one or more somatic antigens...

Silver Cation Coordination Study to AsW9 Ligand – A Trilacunar Arsenotungstate Compound

Directory of Open Access Journals (Sweden)

Berta Lavinia

2017-06-01

Full Text Available Objective: The main objective of this research is to find the coordination ratio between AsW9 and Ag+, as a preliminary study for synthesizing a new silver-arsenotungstate complex. Material and method: The ligand:cation molar ratio in complexes was determined by conductometric and potentiometric titrations of AsW9 with silver salts: CH3COOAg, AgNO3. Results: The ratio was obtained from the inflexion points of the curves when molar ratio was plotted versus conductivity, or from the equivalence point when silver added volume was plotted versus pH value. Each graphic shows one point of inflexion corresponding to 1:1.54 ratio of AsW9:Ag+. In the same manner, the equivalent volumes determined by graphical method gave the ratio 1:1.53. The spectral results confirmed that a AsW9:Ag+ complex was formed since the ligand absorption maxima values have been changed from 190 nm to 197 nm in the case of using AgNO3 and 196 nm for CH3COOAg corresponding to the W=Od bond, and from 246.5 nm to 274 nm (AgNO3 and 270 nm (CH3COO-Ag+ for the W-Ob,c-W bond. Conclusions: Silver cation exhibit a preference for AsW9 in a ratio of 3 to 2. This ratio can be associated to a sandwich type arrangement, with two trilacunary Keggin building blocks incorporating 3 metal cations in a tetrahedral geometry.

Performance test of 100 W linear compressor

Energy Technology Data Exchange (ETDEWEB)

Ko, J; Ko, D. Y.; Park, S. J.; Kim, H. B.; Hong, Y. J.; Yeom, H. K. [Korea Institute of Machinery and Materials, Daejeon(Korea, Republic of)

2013-09-15

In this paper, we present test results of developed 100 W class linear compressor for Stirling-type pulse tube refrigerator. The fabricated linear compressor has dual-opposed configuration, free piston and moving magnet type linear motor. Power transfer, efficiency and required pressure waveform are predicted with designed and measured specifications. In experiments, room temperature test with flow impedance is conducted to evaluate performance of developed linear compressor. Flow impedance is loaded to compressor with metering valve for flow resistance, inertance tube for flow inertance and buffer volumes for flow compliance. Several operating parameters such as input voltage, current, piston displacement and pressure wave are measured for various operating frequency and fixed input current level. Behaviors of dynamics and performance of linear compressor as varying flow impedance are discussed with measured experimental results. The developed linear compressor shows 124 W of input power, 86 % of motor efficiency and 60 % of compressor efficiency at its resonant operating condition.

Design study of wind turbines 50 kW to 3000 kW for electric utility applications. Volume 1: Summary report

Science.gov (United States)

1976-01-01

Wind turbine configurations that would lead to generation of electrical power in a cost effective manner were considered. All possible overall system configurationss, operating modes, and sybsystem concepts were evaluated for both technical feasibility and compatibility with utility networks, as well as for economic attractiveness. A design optimization computer code was developed to determine the cost sensitivity of the various design features, and thus establish the configuration and design conditions that would minimize the generated energy costs. The preliminary designs of both a 500 kW unit and a 1500 kW unit operating in a 12 mph and 18 mph median wind speed respectively, were developed. The rationale employed and the key findings are summarized.

113Cd-NMR investigation of a cadmium-substituted copper, zinc-containing superoxide dismutase from yeast

DEFF Research Database (Denmark)

Kofod, Pauli; Bauer, Rogert; Danielsen, Eva

1991-01-01

113Cd nuclear magnetic resonance spectroscopy has been used to investigate the metal binding sites of cadmium-substituted copper,zinc-containing superoxide dismutase from baker's yeast. NMR signals were obtained for 113Cd(II) at the Cu site as well as for 113Cd(II) at the Zn site. The two subunits...

The effects of overtime work and task complexity on the performance of nuclear plant operators: A proposed methodology

International Nuclear Information System (INIS)

Banks, W.W.; Potash, L.

1985-01-01

This document presents a very general methodology for determining the effect of overtime work and task complexity on operator performance in response to simulated out-of-limit nuclear plant conditions. The independent variables consist of three levels of overtime work and three levels of task complexity. Multiple dependent performance measures are proposed for use and discussion. Overtime work is operationally defined in terms of the number of hours worked by nuclear plant operators beyond the traditional 8 hours per shift. Task complexity is operationalized in terms of the number of operator tasks required to remedy a given plant anomalous condition and bring the plant back to a ''within limits'' or ''normal'' steady-state condition. The proposed methodology would employ a 2 factor repeated measures design along with the analysis of variance (linear) model

Tensor product of left n-invertible operators

Czech Academy of Sciences Publication Activity Database

Duggal, B.P.; Müller, Vladimír

2013-01-01

Roč. 215, č. 2 (2013), s. 113-125 ISSN 0039-3223 R&D Projects: GA ČR GA201/09/0473 Institutional support: RVO:67985840 Keywords : Banach space * essentially left n- invertible operator * left n-invertible operator Subject RIV: BA - General Mathematics Impact factor: 0.630, year: 2013 http://journals.impan.pl/cgi-bin/doi?sm215-2-2

Advances in complex analysis and operator theory festschrift in honor of Daniel Alpay’s 60th birthday

CERN Document Server

Sabadini, Irene; Struppa, Daniele; Vajiac, Mihaela

2017-01-01

This book gathers contributions written by Daniel Alpay’s friends and collaborators. Several of the papers were presented at the International Conference on Complex Analysis and Operator Theory held in honor of Professor Alpay’s 60th birthday at Chapman University in November 2016. The main topics covered are complex analysis, operator theory and other areas of mathematics close to Alpay’s primary research interests. The book is recommended for mathematicians from the graduate level on, working in various areas of mathematical analysis, operator theory, infinite dimensional analysis, linear systems, and stochastic processes.