WorldWideScience

Sample records for online vfa measurement

  1. Monitoring and control of the biogas process based on propionate concentration using online VFA measurement.

    Science.gov (United States)

    Boe, Kanokwan; Steyer, Jean-Philippe; Angelidaki, Irini

    2008-01-01

    Simple logic control algorithms were tested for automatic control of a lab-scale CSTR manure digester. Using an online VFA monitoring system, propionate concentration in the reactor was used as parameter for control of the biogas process. The propionate concentration was kept below a threshold of 10 mM by manipulating the feed flow. Other online parameters such as pH, biogas production, total VFA, and other individual VFA were also measured to examine process performance. The experimental results showed that a simple logic control can successfully prevent the reactor from overload, but with fluctuations of the propionate level due to the nature of control approach. The fluctuation of propionate concentration could be reduced, by adding a lower feed flow limit into the control algorithm to prevent undershooting of propionate response. It was found that use of the biogas production as a main control parameter, rather than propionate can give a more stable process, since propionate was very persistent and only responded very slowly to the decrease of the feed flow which lead to high fluctuation of biogas production. Propionate, however, was still an excellent parameter to indicate process stress under gradual overload and thus recommended as an alarm in the control algorithm. Copyright IWA Publishing 2008.

  2. Monitoring and control of the biogas process based on propionate concentration using online VFA measurement

    DEFF Research Database (Denmark)

    Boe, Kanokwan; Steyer, J.P.; Angelidaki, Irini

    2008-01-01

    Simple logic control algorithms were tested for automatic control of a lab-scale CSTR manure digester. Using an online VFA monitoring system, propionate concentration in the reactor was used as parameter for control of the biogas process. The propionate concentration was kept below a threshold...

  3. Pilot-scale application of an online VFA sensor for monitoring and control of a manure digester

    DEFF Research Database (Denmark)

    Boe, Kanokwan; Angelidaki, Irini

    2012-01-01

    A volatile fatty acids (VFA) sensor based on headspace chromatography was tested for online monitoring and control of a pilot-scale manure digester. The sensor showed satisfying results in terms of sensitivity and reliability for monitoring of the digester. The online VFA and biogas production data...... parameter for optimization, it could not distinguish between the decreases of biogas production from inhibition and from lower organic content in the substrate, which resulted in undesired decreasing of the control gas setpoint when the substrate was diluted. It was necessary to adjust the yield parameter...

  4. A new VFA sensor technique for anaerobic reactor systems

    DEFF Research Database (Denmark)

    Pind, Peter Frode; Angelidaki, Irini; Ahring, Birgitte Kiær

    2003-01-01

    , propionate, iso-/n-butyrate and iso-/n-valerate ranging from 0.1 to 50 mM (6-3000 mg). The measuring range could readily be expanded to more components and both lower and higher concentrations if desired. In addition to the new VFA sensor system, test results from development and testing of the in situ...

  5. Comparison of VFA titration procedures used for monitoring the biogas process.

    Science.gov (United States)

    Lützhøft, Hans-Christian Holten; Boe, Kanokwan; Fang, Cheng; Angelidaki, Irini

    2014-05-01

    Titrimetric determination of volatile fatty acids (VFAs) contents is a common way to monitor a biogas process. However, digested manure from co-digestion biogas plants has a complex matrix with high concentrations of interfering components, resulting in varying results when using different titration procedures. Currently, no standardized procedure is used and it is therefore difficult to compare the performance among plants. The aim of this study was to evaluate four titration procedures (for determination of VFA-levels of digested manure samples) and compare results with gas chromatographic (GC) analysis. Two of the procedures are commonly used in biogas plants and two are discussed in literature. The results showed that the optimal titration results were obtained when 40 mL of four times diluted digested manure was gently stirred (200 rpm). Results from samples with different VFA concentrations (1-11 g/L) showed linear correlation between titration results and GC measurements. However, determination of VFA by titration generally overestimated the VFA contents compared with GC measurements when samples had low VFA concentrations, i.e. around 1 g/L. The accuracy of titration increased when samples had high VFA concentrations, i.e. around 5 g/L. It was further found that the studied ionisable interfering components had lowest effect on titration when the sample had high VFA concentration. In contrast, bicarbonate, phosphate and lactate had significant effect on titration accuracy at low VFA concentration. An extended 5-point titration procedure with pH correction was best to handle interferences from bicarbonate, phosphate and lactate at low VFA concentrations. Contrary, the simplest titration procedure with only two pH end-points showed the highest accuracy among all titration procedures at high VFA concentrations. All in all, if the composition of the digested manure sample is not known, the procedure with only two pH end-points should be the procedure of

  6. Measuring online social bubbles

    Directory of Open Access Journals (Sweden)

    Dimitar Nikolov

    2015-12-01

    Full Text Available Social media have become a prevalent channel to access information, spread ideas, and influence opinions. However, it has been suggested that social and algorithmic filtering may cause exposure to less diverse points of view. Here we quantitatively measure this kind of social bias at the collective level by mining a massive datasets of web clicks. Our analysis shows that collectively, people access information from a significantly narrower spectrum of sources through social media and email, compared to a search baseline. The significance of this finding for individual exposure is revealed by investigating the relationship between the diversity of information sources experienced by users at both the collective and individual levels in two datasets where individual users can be analyzed—Twitter posts and search logs. There is a strong correlation between collective and individual diversity, supporting the notion that when we use social media we find ourselves inside “social bubbles.” Our results could lead to a deeper understanding of how technology biases our exposure to new information.

  7. Measurement of Online Social Networks

    Science.gov (United States)

    Gjoka, Mina

    2010-01-01

    In recent years, the popularity of online social networks (OSN) has risen to unprecedented levels, with the most popular ones having hundreds of millions of users. This success has generated interest within the networking community and has given rise to a number of measurement and characterization studies, which provide a first step towards their…

  8. A nine-point pH titration method to determine low-concentration VFA in municipal wastewater.

    Science.gov (United States)

    Ai, Hainan; Zhang, Daijun; Lu, Peili; He, Qiang

    2011-01-01

    Characterization of volatile fatty acid (VFA) in wastewater is significant for understanding the wastewater nature and the wastewater treatment process optimization based on the usage of Activated Sludge Models (ASMs). In this study, a nine-point pH titration method was developed for the determination of low-concentration VFA in municipal wastewater. The method was evaluated using synthetic wastewater containing VFA with the concentration of 10-50 mg/l and the possible interfering buffer systems of carbonate, phosphate and ammonium similar to those in real municipal wastewater. In addition, the further evaluation was conducted through the assay of real wastewater using chromatography as reference. The results showed that the recovery of VFA in the synthetic wastewater was 92%-102 and the coefficient of variance (CV) of reduplicate measurements 1.68%-4.72%. The changing content of the buffering substances had little effect on the accuracy of the method. Moreover, the titration method was agreed with chromatography in the determination of VFA in real municipal wastewater with R(2)= 0.9987 and CV =1.3-1.7. The nine-point pH titration method is capable of satisfied determination of low-concentration VFA in municipal wastewater.

  9. Measuring consumer perceptions of online shopping convenience

    OpenAIRE

    Ferreira, Margarida Bernardo

    2016-01-01

    The aim of this master thesis is to identify which dimensions of convenience affect consumers’ intention of using online shopping. Also it explores a conceptual model to measuring consumer perceptions of online shopping convenience. This paper contains prospects about online consumer behavior, and the results have important implications for retailers, managers and marketers, related to online shopping strategies. An empirical investigation was carried out to test the hypotheses. In order t...

  10. Online luminosity measurement at BES III

    International Nuclear Information System (INIS)

    Song Wenbo; Fu Chengdong; Mo Xiaohu; He Kanglin; Zhu Kejun; Li Fei; Zhao Shujun

    2010-01-01

    As a crucial parameter of both accelerator and detector, the realization of online luminosity measurement is of great importance. Several methods of luminosity measurement are recapitulated and the emphasis is laid on the algorithm of using e + e - and γγ final states. Taking into account the status at the beginning of the joint commissioning of detector and accelerator, the information from end cap electromagnetic calorimeter is used to select the good event. With the help of online Event filter, the luminosity is calculated and the monitoring of online cross section of hadron is realized. The preliminary results indicate that the online luminosity measurement is stable and its role for machine tuning and monitoring of the overall running status is indispensable. (authors)

  11. A novel in-situ sampling and VFA sensor technique for anaerobic systems

    DEFF Research Database (Denmark)

    Pind, Peter Frode; Angelidaki, Irini; Ahring, Birgitte Kiær

    2002-01-01

    A key information for understanding and controlling the anaerobic biogas process is the concentration of Volatile Fatty Acids (VFA). However, access to this information has so far been limited to off-line measurements by manual time and labour consuming methods. We have developed a new technique ...... than 1000 samples on both a fullscale biogas plant and lab-scale reactors. The measuring range covers specific measurements of acetate, propionate, iso-/n-butyrate and iso-/n-valerate from 0.1 to 50 mM (6–3,000 mg)....

  12. "Prime" Advertising Space: Measuring Implict Memory Online

    OpenAIRE

    Barratt, Madeleine

    2012-01-01

    In marketing literature, click-through-rates are generally employed to measure the success of banner advertisements online. This measure has led to the banner blindness hypothesis, which posits that internet users ignore banner advertisements. However, this measurement does not take into account the consumer action which may result from memory for advertised brands. This study illustrates that although there may not be explicit memory for these advertisements, consumers can be primed for adve...

  13. Toasting of cereal grains: effects on in vitro rumen gas production and VFA yield

    Directory of Open Access Journals (Sweden)

    Seerp Tamminga

    2010-01-01

    Full Text Available The fermentation properties of the following feeds: pelleted barley (PB, toasted and pelleted barley (TPB, pelleted maize (PM and toasted and pelleted maize (TPM were studied using an in vitro gas production (GP technique. Each feed sample (0.5g was incubated (3 replications, with rumen fluid collected from 3 grazing lactating dairy cows. The kinetics of GP were automatically recorded for 72h. The amounts of DM disappeared (DMd and the volatile fatty acid yields (VFA were measured. On barley, compared to simple pelleting, toasting significantly (P<0.05 reduced DMd (87.5 vs. 86.2%, the asymptotic GP (A, 388 vs. 367ml/g DMd and slightly increased the time of maximum GP rate (TRmax, 2.89 vs. 3.15h. On maize toasting did not affect DMd and A, but significantly reduced T1/2 (9.71 vs. 8.57; P<0.05 and TRmax (5.04 vs. 4.49, P<0.05. Toasting significantly reduced the VFA yields both of barley and maize. These results, in agreement with previous in sacco and in vivo observations, suggest that toasting might reduce the amount of potential fermentable substrate of barley, whereas it might increase the rate of fermentation of maize.

  14. Online Game Addiction among Chinese College Students Measurement and Attribution.

    Science.gov (United States)

    Zhou, Yuqiong; Li, Zhitian

    2009-01-01

    This study made an initial attempt to measure and attribute online game addiction among Chinese college students. We generated three factors of online game addiction: Control Disorder, Conflict, and Injury, as well as proposed a comprehensive model that attributed online game addiction to three groups of driving forces: environmental influences (most significant), characteristics of online games, and personal reasons.

  15. Students Matter: Quality Measurements in Online Courses

    Science.gov (United States)

    Unal, Zafer; Unal, Aslihan

    2016-01-01

    Quality Matters (QM) is a peer review process designed to certify the quality of online courses and online components. It has generated widespread interest and received national recognition for its peer-based approach to quality assurance and continuous improvement in online education. While the entire QM online course design process is…

  16. Online monitoring and control of the biogas process

    Energy Technology Data Exchange (ETDEWEB)

    Boe, K.

    2006-07-01

    The demand for online monitoring and control of biogas process is increasing, since better monitoring and control system can improve process stability and enhance process performance for better economy of the biogas plants. A number of parameters in both the liquid and the gas phase have been suggested as process indicators. These include gas production, pH, alkalinity, volatile fatty acids (VFA) and hydrogen. Of these, VFA is the most widely recognised as a direct, relevant measure of stability. The individual, rather than collective VFA concentrations are recognised as providing significantly more information for diagnosis. However, classic on-line measurement is based on filtration, which suffers from fouling, especially in particulate or slurry wastes. In this project, a new online VFA monitoring system has been developed using gas-phase VFA extraction to avoid sample filtration. The liquid sample is pumped into a sampling chamber, acidified, added with salt and heated to extract VFA into the gas phase before analysis by GC-FID. This allows easy application to manure. Sample and analysis time of the system varies from 25-40 min. depending on the washing duration. The sampling frequency is fast enough for the dynamic of a manure digester, which is in the range of several hours. This system has been validated over more than 6 months and had shown good agreement with offline VFA measurement. Response from this sensor was compared with other process parameters such as biogas production, pH and dissolved hydrogen during overload situations in a laboratory-scale digester, to investigate the suitability of each measure as a process indicator. VFA was most reliable for indicating process imbalance, and propionate was most persistent. However, when coupling the online VFA monitoring with a simple control for automatic controlling propionate level in a digester, it was found that propionate decreased so slow that the biogas production fluctuated. Therefore, it is more

  17. Online wave estimation using vessel motion measurements

    DEFF Research Database (Denmark)

    H. Brodtkorb, Astrid; Nielsen, Ulrik D.; J. Sørensen, Asgeir

    2018-01-01

    parameters and motion transfer functions are required as input. Apart from this the method is signal-based, with no assumptions on the wave spectrum shape, and as a result it is computationally efficient. The algorithm is implemented in a dynamic positioning (DP)control system, and tested through simulations......In this paper, a computationally efficient online sea state estimation algorithm isproposed for estimation of the on site sea state. The algorithm finds the wave spectrum estimate from motion measurements in heave, roll and pitch by iteratively solving a set of linear equations. The main vessel...

  18. Effect of pH and VFA on hydrolysis of organic solid waste

    NARCIS (Netherlands)

    Veeken, A.H.M.; Kalyuzhnyi, S.; Scharff, H.; Hamelers, H.V.M.

    2000-01-01

    The anaerobic hydrolysis rate of organic solid waste was studied at fixed volatile fatty acid (VFA) concentrations ranging from 3 to 30 g COD/L and fixed pH values between 5 and 7. For separate control of both VFA and pH, a special completely mixed reactor was designed. In this way, it was possible

  19. CONTROL PARAMETERS FOR UNDERSTANDING AND PREVENTING PROCESS IMBALANCES IN BIOGAS PLANTS. EMPHAS IS ON VFA DYNAMICS

    DEFF Research Database (Denmark)

    Bangsø Nielsen, Henrik

    environmental changes differ widely between the different groups. As a consequence of this, an unrestrained reactor operation can lead to disturbances in the balance between the different microbial groups, which might lead to reactor failure. Therefore, reliable parameters and tools for efficient process...... control and understanding are necessary. The work of present study was directed towards this challenge. Initially, the response of the anaerobic digestion process to various types of process imbalances was investigated with special focus on volatile fatty acid dynamics (VFA), methane production and pH...... of process imbalances in biogas plants. At Danish full-scale biogas plants the biogas production is normally the only continuously measured parameter. In order to examine the usability of propionate as control parameter a reactor experiment was constructed in which the reactor operation either was carried...

  20. Online Labour Index: Measuring the Online Gig Economy for Policy and Research

    OpenAIRE

    Kässi, Otto; Lehdonvirta, Vili

    2016-01-01

    Labour markets are thought to be in the midst of a dramatic transformation, where standard employment is increasingly supplemented or substituted by temporary gig work mediated by online platforms. Yet the scale and scope of these changes is hard to assess, because conventional labour market statistics and economic indicators are ill-suited to measuring online gig work. We present the Online Labour Index (OLI), a new economic indicator that provides the online gig economy equivalent of conven...

  1. Dietary marker effects on fecal microbial ecology, fecal VFA, nutrient digestibility coefficients, and growth performance in finishing pigs.

    Science.gov (United States)

    Kerr, B J; Weber, T E; Ziemer, C J

    2015-05-01

    Use of indigestible markers such as Cr2O3, Fe2O3, and TiO2 are commonly used in animal studies to evaluate digesta rate of passage and nutrient digestibility. Yet, the potential impact of indigestible markers on fecal microbial ecology and subsequent VFA generation is not known. Two experiments utilizing a total of 72 individually fed finishing pigs were conducted to describe the impact of dietary markers on fecal microbial ecology, fecal ammonia and VFA concentrations, nutrient digestibility, and pig performance. All pigs were fed a common diet with no marker or with 0.5% Cr2O3, Fe2O3, or TiO2. In Exp. 1, after 33 d of feeding, fresh fecal samples were collected for evaluation of microbial ecology, fecal ammonia and VFA concentrations, and nutrient digestibility, along with measures of animal performance. No differences were noted in total microbes or bacterial counts in pig feces obtained from pigs fed the different dietary markers while Archaea counts were decreased (P = 0.07) in feces obtained from pigs fed the diet containing Fe2O 3compared to pigs fed the control diet. Feeding Cr2O3, Fe2O3, or TiO2 increased fecal bacterial richness (P = 0.03, 0.01, and 0.10; respectively) when compared to pigs fed diets containing no marker, but no dietary marker effects were noted on fecal microbial evenness or the Shannon-Wiener index. Analysis of denaturing gradient gel electrophoresis gels did not reveal band pattern alterations due to inclusion of dietary markers in pig diets. There was no effect of dietary marker on fecal DM, ammonia, or VFA concentrations. Pigs fed diets containing Cr2O3 had greater Ca, Cu, Fe, and P (P ≤ 0.02), but lower Ti ( P= 0.08) digestibility compared to pigs fed the control diet. Pigs fed diets containing Fe2O3 had greater Ca (P = 0.08) but lower Ti (P = 0.01) digestibility compared to pigs fed the control diet. Pigs fed diets containing TiO2 had greater Fe and Zn (P ≤ 0.09), but lower Ti ( P= 0.01) digestibility compared to pigs fed the

  2. Measuring structural similarity in large online networks.

    Science.gov (United States)

    Shi, Yongren; Macy, Michael

    2016-09-01

    Structural similarity based on bipartite graphs can be used to detect meaningful communities, but the networks have been tiny compared to massive online networks. Scalability is important in applications involving tens of millions of individuals with highly skewed degree distributions. Simulation analysis holding underlying similarity constant shows that two widely used measures - Jaccard index and cosine similarity - are biased by the distribution of out-degree in web-scale networks. However, an alternative measure, the Standardized Co-incident Ratio (SCR), is unbiased. We apply SCR to members of Congress, musical artists, and professional sports teams to show how massive co-following on Twitter can be used to map meaningful affiliations among cultural entities, even in the absence of direct connections to one another. Our results show how structural similarity can be used to map cultural alignments and demonstrate the potential usefulness of social media data in the study of culture, politics, and organizations across the social and behavioral sciences. Copyright © 2016 Elsevier Inc. All rights reserved.

  3. Measuring Quality in Online Education: A Meta-Synthesis

    Science.gov (United States)

    Esfijani, Azam

    2018-01-01

    This article presents a meta-synthesis review of quality of online education (QOE) measurement approaches. In order to survey the existing body of knowledge, a qualitative method was employed to investigate what quality of online education is comprised of and how the concept has been measured through the literature. To achieve this, a total of 112…

  4. Measuring Student Engagement in the Online Course: The Online Student Engagement Scale (OSE)

    Science.gov (United States)

    Dixson, Marcia D.

    2015-01-01

    Student engagement is critical to student learning, especially in the online environment, where students can often feel isolated and disconnected. Therefore, teachers and researchers need to be able to measure student engagement. This study provides validation of the Online Student Engagement scale (OSE) by correlating student self-reports of…

  5. On-Line Voltage Stability Assessment based on PMU Measurements

    DEFF Research Database (Denmark)

    Garcia-Valle, Rodrigo; P. Da Silva, Luiz C.; Nielsen, Arne Hejde

    2009-01-01

    This paper presents a method for on-line monitoring of risk voltage collapse based on synchronised phasor measurement. As there is no room for intensive computation and analysis in real-time, the method is based on the combination of off-line computation and on-line monitoring, which are correlat...

  6. Measurements and analysis of online social networks

    OpenAIRE

    González Sánchez, Roberto

    2014-01-01

    Mención Internacional Online Social Networks (OSNs) have become the most used Internet applications attracting hundreds of millions active users every day. The large amount of valuable information in OSNs (not even before available) has attracted the research community to design sophisticated techniques to collect, process, interpret and apply these data into a large range of disciplines including Sociology, Marketing, Computer Science, etc. This thesis presents a series of ...

  7. The Online Social Support Scale: Measure development and validation.

    Science.gov (United States)

    Nick, Elizabeth A; Cole, David A; Cho, Sun-Joo; Smith, Darcy K; Carter, T Grace; Zelkowitz, Rachel L

    2018-05-21

    A new measure, the Online Social Support Scale, was developed based on previous theory, research, and measurement of in-person social support. It includes four subscales: Esteem/Emotional Support, Social Companionship, Informational Support, and Instrumental Support. In college and community samples, factor analytic and item response theory results suggest that subtypes of in-person social support also pertain in the online world. Evidence of reliability, convergent validity, and discriminant validity provide excellent psychometric support for the measure. Construct validity accrues to the measure vis-à-vis support for three hypotheses: (a) Various broad types of Internet platforms for social interactions are differentially associated with online social support and online victimization; (b) similar to in-person social support, online social support offsets the adverse effect of negative life events on self-esteem and depression-related outcome; and (c) online social support counteracts the effects of online victimization in much the same way that in-person friends in one social niche counterbalance rejection in other social niches. (PsycINFO Database Record (c) 2018 APA, all rights reserved).

  8. USING EYE TRACKING TO MEASURE ONLINE INTERACTIVITY: A THEORETICAL FRAMEWORK

    Directory of Open Access Journals (Sweden)

    Adriana-Emilia ROBU

    2013-06-01

    Full Text Available Notwithstanding that each and every company, even the sweetshop around the corner has found its way to the Internet, some customers still hesitate to shop online or to shop from one site and ignore the other. In order to build an online effective communication between the participants, one of the most important factors is interactivity. In the last decade it received extensive attention in the marketing literature, but few are the studies which have seen new methods to measure it. Eye tracking technology has been broadly used in the cognitive sciences. The purpose of this study is to investigate the existing literature in order to give insights into the eye tracking methodology when measuring the online interactivity. It also describes the eye tracking technology in general, extracts various examples from the eye tracking research field, with different applications, highlights its importance when analyzing the online consumer behavior, giving examples from various studies and finds the key points of the methodological difficulties. Finally, this work has an important merit for the future studies when taking into consideration the eye tracking technology in the online interactivity research and further, it is relevant for marketers, regarding the enhancement of online interactive interfaces and web or mobile applications.

  9. The Visiting Forces Agreement (VFA in the Philippines: Insights on Issues of Sovereignty, Security and Foreign Policy

    Directory of Open Access Journals (Sweden)

    Mark Anthony M. Velasco

    2015-11-01

    Full Text Available The study intends to compare the Visiting Forces Agreement (VFA between the Philippines and the United States of America and the VFA between the Philippines and Australia. The research piece is arranged in the following flow of ideas. The first and the second part provides the foundations by highlighting issues on definition, historical background, provisions of the agreement and concerns faced by the agreement of the Visiting Forces Agreement (VFA between the Republic of the Philippines and the United States of America and the Status of the Visiting Forces Agreement (SOVFA between the Republic of the Philippines and Australia. The third part is an analysis of the VFA and the SOVFA under the tutelage of the framework on the non-intervention principle. As a result, the provisions of SOVFA were in consonance with the legal arrangement in the Philippines than the VFA with the United States of America.

  10. Measuring Online Dialogic Conversations: A Scale Development

    DEFF Research Database (Denmark)

    Romenti, Stefania; Valentini, Chiara; Murtarelli, Grazia

    2016-01-01

    Purpose: The scope of this paper is to develop and test a measurement scale for assessing the quality of dialogic conversations among companies and digital publics in social media. It is argued that dialogic conversations are the drivers of dialogic engagement and the result of dialogic...... interactivity. Dialogic conversations are defined as sequences of communicative actions and counteractions taken by social actors for different purposes based on specific linguistic choices and characterised by diverse communicative approaches and the role played by the involved parties. Design....../methodology/approach: A multidimensional scale for measuring dialogic conversations is developed from relevant literature concerning dialogue and public engagement in the fields of corporate communication, public relations, management studies and conversation analysis. The scale was pre-tested to redefine and purify it from irrelevant...

  11. Dynamic-speckle profilometer for online measurements of coating thickness

    Energy Technology Data Exchange (ETDEWEB)

    Kamshilin, A A [Laboratory of Optical Sensor Technology, Department of Physics, University of Kuopio, PO Box 1627, FIN-70211 Kuopio (Finland); Semenov, D V [Laboratory of Optical Sensor Technology, Department of Physics, University of Kuopio, PO Box 1627, FIN-70211 Kuopio (Finland); Nippolainen, E [Laboratory of Optical Sensor Technology, Department of Physics, University of Kuopio, PO Box 1627, FIN-70211 Kuopio (Finland); Miridonov, S [Optics Department, CICESE, Carr. Tijuana-Ensenada km 107, C.P. 22860, A.P. 360, Ensenada, B.C. (Mexico)

    2007-10-15

    Online control of thickness of as-deposited coatings is of great importance because it directly affects the quality of protective coatings. We present a novel approach that enables online, real-time and non-contact measurements thickness of thermally sprayed coatings. The proposed technique uses dynamic speckles generated by rapidly deflecting laser beam. Within 10 ms the system can scan 500 times a small area of the deposited layer thus resulting in measurement accuracy of 5 microns irrespectively of the layer roughness. In comparison with traditional optical triangulation technique of distance measurements, our system has following advantages: (i) much simpler optical scheme that includes conventional photodiode to measure the scattered light, (ii) much simpler electronics for real-time data processing, (iii) much higher speed of measurements.

  12. Dynamic-speckle profilometer for online measurements of coating thickness

    International Nuclear Information System (INIS)

    Kamshilin, A A; Semenov, D V; Nippolainen, E; Miridonov, S

    2007-01-01

    Online control of thickness of as-deposited coatings is of great importance because it directly affects the quality of protective coatings. We present a novel approach that enables online, real-time and non-contact measurements thickness of thermally sprayed coatings. The proposed technique uses dynamic speckles generated by rapidly deflecting laser beam. Within 10 ms the system can scan 500 times a small area of the deposited layer thus resulting in measurement accuracy of 5 microns irrespectively of the layer roughness. In comparison with traditional optical triangulation technique of distance measurements, our system has following advantages: (i) much simpler optical scheme that includes conventional photodiode to measure the scattered light, (ii) much simpler electronics for real-time data processing, (iii) much higher speed of measurements

  13. Empowerment with VFA as an alternative to improve a seed of raw activated sludge for the starting of UASB reactors

    International Nuclear Information System (INIS)

    Wills, Beatriz; Cuellar Winston

    2002-01-01

    In this research the technique for the improvement of a seed coming from the aerobic digestion process of domestic wastewaters, was determined. It was done in UASB (up flow anaerobic sludge blanket) reactor, by adding volatile fatty acids (VFA), during fifty days. The seed was anaerobically acclimated for ninety days, prior to the improving process. Results show that the VFA addition improves the behavior regarding control variables and yielding, and increase in the bacterial population involved in the anaerobic digestion process. It was observed that, for upward speeds greater than 0.30 m/h, there are mass losses in the reactor with VFA

  14. Essays on Incentives and Measurement of Online Marketing Efforts

    OpenAIRE

    Berman, Ron

    2014-01-01

    This dissertation contains three essays that examine different aspects of online marketing activities, the ability of marketers to measure the effectiveness of such activities, and the design of experiments to aid in this measurement.Chapter 2 examines the impact of search engine optimization (SEO) on the competition between advertisers for organic and sponsored search results. The results show that a positive level of search engine optimization may improve the search engine's ranking quality...

  15. Implementation of online volatile fatty acids sensor for control and optimization of anaerobic process for low cost biogas production from manure. Project report

    Energy Technology Data Exchange (ETDEWEB)

    Boe, K.; Angelidaki, I.

    2010-10-15

    Proper monitoring and control can improve process stability and enhance process performance for better economy of the biogas plants. Volatile fatty acid (VFA) is the most widely recognized as a direct, relevant measure of stability. Classic on-line measurement of individual VFA is based on filtration, which suffers from fouling when applied with manure slurries. A VFA sensor developed at DTU Environment, based on headspace chromatography technique could avoid the problems from particulate matters. In this work, the sensor had been implemented for online monitoring of the lab-scale and the pilot-scale manure digester. The industrial prototype of the VFA sensor and sample acquisition system has been constructed and implemented at a pilot scale biogas plant, located at Lundtofte, DTU. The VFA sensor has shown very satisfying results in terms of sensitivity and reliability for monitoring the biogas process. Moreover, the online VFA and biogas registration data were used as process indicators for automatic control of the biogas reactor. The results from control experiments confirmed that the combination of biogas production, total VFA concentration and propionate concentration could effectively reflect the dynamic state of the process which was very crucial for automatic control. Due to the standardized analyzing condition (pH<2, temperature>70 deg. C), the sensor responses were not affected by the manure composition (TS, VS or the addition of extra organics), which made these results representative for implementing in the full-scale biogas plant where some industrial organic wastes were added to increase the biogas production. During the project period, the sensor design and construction had been modified and tested several times to improve the robustness. However, the implementation of the sensor in full-scale biogas plant would need some further development such as improvement of mechanical design and further up-scaling depending on the dry solid content in the

  16. Comparison of VFA titration procedures used for monitoring the biogas process

    DEFF Research Database (Denmark)

    Lützhøft, Hans-Christian Holten; Boe, Kanokwan; Fang, Cheng

    2014-01-01

    (GC) analysis. Two of the procedures are commonly used in biogas plants and two are discussed in literature. The results showed that the optimal titration results were obtained when 40mL of four times diluted digested manure was gently stirred (200rpm). Results from samples with different VFA......Titrimetric determination of volatile fatty acids (VFAs) contents is a common way to monitor a biogas process. However, digested manure from co-digestion biogas plants has a complex matrix with high concentrations of interfering components, resulting in varying results when using different...

  17. Online terahertz thickness measurement in films and coatings

    Science.gov (United States)

    Duling, Irl N.; White, Jeffrey S.

    2017-02-01

    Pulsed terahertz systems are currently being deployed for online process control and quality control of multi-layered products for use in the building products and aerospace industries. While many laboratory applications of terahertz can allow waveforms to be acquired at rates of 1 - 40 Hz, online applications require measurement rates of in excess of 100Hz. The existing technologies of thickness measurement (nuclear, x-ray, or laser gauges) have rates between 100 and 1000 Hz. At these rates, the single waveform bandwidth must still remain at 2THz or above to allow thinner layers to be measured. In the applications where terahertz can provide unique capability (e.g. multi-layer thickness, delamination, density) long-term stability must be guaranteed within the tolerance required by the measurement. This can mean multi-day stability of less than a micron. The software that runs on these systems must be flexible enough to allow multiple product configurations, while maintaining the simplicity required by plant operators. The final requirement is to have systems that can withstand the environmental conditions of the measurement. This might mean qualification in explosive environments, or operation in hot, wet or dusty environments. All of these requirements can put restrictions on not only the voltage of electronic circuitry used, but also the wavelength and optical power used for the transmitter and receiver. The application of terahertz systems to online process control presents unique challenges that not only effect the physical design of the system, but can also effect the choices made on the terahertz technology itself.

  18. A Review of Online Partial Discharge Measurement of Large Generators

    Directory of Open Access Journals (Sweden)

    Yuanlin Luo

    2017-10-01

    Full Text Available Online partial discharge (PD measurements have long been used as an effective means to assess the condition of the stator windings of large generators. An increase in the use of PD online measurement systems during the last decade is evident. Improvements in the detection capabilities are partly the reason for the increased popularity. Another reason has been the development of digital signal processing techniques. In addition, rapid progress is being made in automated single PD source classification. However, there are still some factors hindering wider application of the system, such as the complex PD mechanism and PD pulse propagation in stator windings, the presence of detrimental noise and disturbances on-site, and multiple PD sources occurring simultaneously. To avoid repetition of past work and to provide an overview for fresh researchers in this area, this paper presents a comprehensive survey of the state-of-the-art knowledge on PD mechanism, PD pulse propagation in stator windings, PD signal detection methods and signal processing techniques. Areas for further research are also presented.

  19. Rasch Measurement of Collaborative Problem Solving in an Online Environment.

    Science.gov (United States)

    Harding, Susan-Marie E; Griffin, Patrick E

    2016-01-01

    This paper describes an approach to the assessment of human to human collaborative problem solving using a set of online interactive tasks completed by student dyads. Within the dyad, roles were nominated as either A or B and students selected their own roles. The question as to whether role selection affected individual student performance measures is addressed. Process stream data was captured from 3402 students in six countries who explored the problem space by clicking, dragging the mouse, moving the cursor and collaborating with their partner through a chat box window. Process stream data were explored to identify behavioural indicators that represented elements of a conceptual framework. These indicative behaviours were coded into a series of dichotomous items. These items represented actions and chats performed by students. The frequency of occurrence was used as a proxy measure of item difficulty. Then given a measure of item difficulty, student ability could be estimated using the difficulty estimates of the range of items demonstrated by the student. The Rasch simple logistic model was used to review the indicators to identify those that were consistent with the assumptions of the model and were invariant across national samples, language, curriculum and age of the student. The data were analysed using a one and two dimension, one parameter model. Rasch separation reliability, fit to the model, distribution of students and items on the underpinning construct, estimates for each country and the effect of role differences are reported. This study provides evidence that collaborative problem solving can be assessed in an online environment involving human to human interaction using behavioural indicators shown to have a consistent relationship between the estimate of student ability, and the probability of demonstrating the behaviour.

  20. Online radiation dose measurement system for ATLAS experiment

    Energy Technology Data Exchange (ETDEWEB)

    Mandic, I.; Cindro, V.; Dolenc, I.; Gorisek, A.; Kramberger, G. [Jozef Stefan Institute, Jamova 39, Ljubljana (Slovenia); Mikuz, M. [Jozef Stefan Institute, Jamova 39, Ljubljana (Slovenia); Faculty of Mathematics and Physics, University of Ljubljana (Slovenia); Bronner, J.; Hartet, J. [Physikalisches Institut, Universitat Freiburg, Hermann-Herder-Str. 3, Freiburg (Germany); Franz, S. [CERN, Geneva (Switzerland)

    2009-07-01

    In experiments at Large Hadron Collider, detectors and electronics will be exposed to high fluxes of photons, charged particles and neutrons. Damage caused by the radiation will influence performance of detectors. It will therefore be important to continuously monitor the radiation dose in order to follow the level of degradation of detectors and electronics and to correctly predict future radiation damage. A system for online radiation monitoring using semiconductor radiation sensors at large number of locations has been installed in the ATLAS experiment. Ionizing dose in SiO{sub 2} will be measured with RadFETs, displacement damage in silicon in units of 1-MeV(Si) equivalent neutron fluence with p-i-n diodes. At 14 monitoring locations where highest radiation levels are expected the fluence of thermal neutrons will be measured from current gain degradation in dedicated bipolar transistors. The design of the system and tests of its performance in mixed radiation field is described in this paper. First results from this test campaign confirm that doses can be measured with sufficient sensitivity (mGy for total ionizing dose measurements, 10{sup 9} n/cm{sup 2} for NIEL (non-ionizing energy loss) measurements, 10{sup 12} n/cm{sup 2} for thermal neutrons) and accuracy (about 20%) for usage in the ATLAS detector

  1. Online radiation dose measurement system for ATLAS experiment

    International Nuclear Information System (INIS)

    Mandic, I.; Cindro, V.; Dolenc, I.; Gorisek, A.; Kramberger, G.; Mikuz, M.; Bronner, J.; Hartet, J.; Franz, S.

    2009-01-01

    In experiments at Large Hadron Collider, detectors and electronics will be exposed to high fluxes of photons, charged particles and neutrons. Damage caused by the radiation will influence performance of detectors. It will therefore be important to continuously monitor the radiation dose in order to follow the level of degradation of detectors and electronics and to correctly predict future radiation damage. A system for online radiation monitoring using semiconductor radiation sensors at large number of locations has been installed in the ATLAS experiment. Ionizing dose in SiO 2 will be measured with RadFETs, displacement damage in silicon in units of 1-MeV(Si) equivalent neutron fluence with p-i-n diodes. At 14 monitoring locations where highest radiation levels are expected the fluence of thermal neutrons will be measured from current gain degradation in dedicated bipolar transistors. The design of the system and tests of its performance in mixed radiation field is described in this paper. First results from this test campaign confirm that doses can be measured with sufficient sensitivity (mGy for total ionizing dose measurements, 10 9 n/cm 2 for NIEL (non-ionizing energy loss) measurements, 10 12 n/cm 2 for thermal neutrons) and accuracy (about 20%) for usage in the ATLAS detector

  2. Online and offline video game use in adolescents: measurement invariance and problem severity

    OpenAIRE

    Smohai, M; Urbán, R; Griffiths, MD; Király, O; Mirnics, Z; Vargha, A; Demetrovics, Z

    2017-01-01

    Background:\\ud \\ud Despite the increasing popularity of videogame playing, little is known about the similarities and differences between online and offline videogame players. However, the characteristics of online and offline gaming might predispose different pattern of problematic use.\\ud \\ud Objectives:\\ud \\ud The aims of this study were to (i) test applicability and the measurement invariance of the previously developed Problematic Online Gaming Questionnaire (POGQ) in both online and off...

  3. I always feel like somebody's watching me measuring online behavioural advertising

    OpenAIRE

    Carrascosa, Juan Miguel; Mikians, Jakub; Cuevas, Ruben; Erramilli, Vijay; Laoutaris, Nikolaos

    2015-01-01

    Online Behavioural targeted Advertising (OBA) has risen in prominence as a method to increase the effectiveness of online advertising. OBA operates by associating tags or labels to users based on their online activity and then using these labels to target them. This rise has been accompanied by privacy concerns from researchers, regulators and the press. In this paper, we present a novel methodology for measuring and understanding OBA in the online advertising market. We rely on training arti...

  4. Relationships between sulphate reduction and COD/VFA utilisation using grass cellulose as carbon and energy sources

    CSIR Research Space (South Africa)

    Mulopo, J

    2010-07-01

    Full Text Available /fermentation products of grass cellulose, volatile fatty acids (VFA), function as the electron donors and SO2/4 as the electron acceptor. The aim of the study presented here was to elucidate the interactions between the cellulose degradation rate, the chemical oxygen...

  5. Relationship between rumen protozoal growth, intake of DM, TDN, N, DOM and VFA production rate in buffalo calves

    International Nuclear Information System (INIS)

    Verma, D.N.; Singh, U.B.

    1981-01-01

    Relationships between in vivo rumen protozoal growth and intakes of dry matter (DM), nitrogen, digestible organic matter (DOM), total digestible nutrients (TDN) and volatile fatty acid (VFA) production have been studied. Isotope dilution technique and 14 C-labelled rumen protozoa were used in the studies. (author)

  6. Technology-driven online marketing performance measurement: lessons from affiliate marketing

    OpenAIRE

    Bowie, David; Paraskevas, Alexandros; Mariussen, Anastasia

    2014-01-01

    Although the measurement of offline and online marketing is extensively researched, the literature on online performance measurement still has a number of limitations such as slow theory advancement and predominance of technology- and practitioner-driven measurement approaches. By focusing on the widely employed but under-researched affiliate marketing channel, this study addresses these limitations and evaluates the effectiveness of practitioner-led online performance assessment. The paper o...

  7. Evaluating 5 and 8 pH-point titrations for measuring VFA in full-scale ...

    African Journals Online (AJOL)

    2012-02-24

    Feb 24, 2012 ... An evaluation of 5 and 8 pH-point titrimetric methods for determining volatile ... energy source, is of interest, and has been implemented at ... distribution of the carbon produced. ... key indicator in evaluating the operation of anaerobic systems, ... cally distributed around the dissociation points (pKa) of the.

  8. An assesment of measurement invariance between online and mail surveys

    NARCIS (Netherlands)

    Deutskens, E.C.; Ruyter, de J.C.; Wetzels, M.G.M.

    2005-01-01

    One of the latest trends in marketing research is the increasing use of online surveys, which offer lower costs and faster responses. Yet, critics question whether data collected via online surveys are equivalent to data collected via traditional mail surveys. Since existing evidence from the

  9. Measurement of Online Student Engagement: Utilization of Continuous Online Student Behavior Indicators as Items in a Partial Credit Rasch Model

    Science.gov (United States)

    Anderson, Elizabeth

    2017-01-01

    Student engagement has been shown to be essential to the development of research-based best practices for K-12 education. It has been defined and measured in numerous ways. The purpose of this research study was to develop a measure of online student engagement for grades 3 through 8 using a partial credit Rasch model and validate the measure…

  10. Vfa1 Binds to the N-terminal Microtubule-interacting and Trafficking (MIT) Domain of Vps4 and Stimulates Its ATPase Activity*

    Science.gov (United States)

    Vild, Cody J.; Xu, Zhaohui

    2014-01-01

    The endosomal sorting complexes required for transport (ESCRT) are responsible for multivesicular body biogenesis, membrane abscission during cytokinesis, and retroviral budding. They function as transiently assembled molecular complexes on the membrane, and their disassembly requires the action of the AAA-ATPase Vps4. Vps4 is regulated by a multitude of ESCRT and ESCRT-related proteins. Binding of these proteins to Vps4 is often mediated via the microtubule-interacting and trafficking (MIT) domain of Vps4. Recently, a new Vps4-binding protein Vfa1 was identified in a yeast genetic screen, where overexpression of Vfa1 caused defects in vacuolar morphology. However, the function of Vfa1 and its role in vacuolar biology were largely unknown. Here, we provide the first detailed biochemical and biophysical study of Vps4-Vfa1 interaction. The MIT domain of Vps4 binds to the C-terminal 17 residues of Vfa1. This interaction is of high affinity and greatly stimulates the ATPase activity of Vps4. The crystal structure of the Vps4-Vfa1 complex shows that Vfa1 adopts a canonical MIT-interacting motif 2 structure that has been observed previously in other Vps4-ESCRT interactions. These findings suggest that Vfa1 is a novel positive regulator of Vps4 function. PMID:24567329

  11. Vfa1 binds to the N-terminal microtubule-interacting and trafficking (MIT) domain of Vps4 and stimulates its ATPase activity.

    Science.gov (United States)

    Vild, Cody J; Xu, Zhaohui

    2014-04-11

    The endosomal sorting complexes required for transport (ESCRT) are responsible for multivesicular body biogenesis, membrane abscission during cytokinesis, and retroviral budding. They function as transiently assembled molecular complexes on the membrane, and their disassembly requires the action of the AAA-ATPase Vps4. Vps4 is regulated by a multitude of ESCRT and ESCRT-related proteins. Binding of these proteins to Vps4 is often mediated via the microtubule-interacting and trafficking (MIT) domain of Vps4. Recently, a new Vps4-binding protein Vfa1 was identified in a yeast genetic screen, where overexpression of Vfa1 caused defects in vacuolar morphology. However, the function of Vfa1 and its role in vacuolar biology were largely unknown. Here, we provide the first detailed biochemical and biophysical study of Vps4-Vfa1 interaction. The MIT domain of Vps4 binds to the C-terminal 17 residues of Vfa1. This interaction is of high affinity and greatly stimulates the ATPase activity of Vps4. The crystal structure of the Vps4-Vfa1 complex shows that Vfa1 adopts a canonical MIT-interacting motif 2 structure that has been observed previously in other Vps4-ESCRT interactions. These findings suggest that Vfa1 is a novel positive regulator of Vps4 function.

  12. Mineralization of LCFA associated with anaerobic sludge: Kinetics, enhancement of methanogenic activity, and effect of VFA.

    Science.gov (United States)

    Pereira, M A; Sousa, D Z; Mota, M; Alves, M M

    2004-11-20

    Long-chain fatty acids (LCFA) associated with anaerobic sludge by mechanisms of precipitation, adsorption, or entrapment can be biodegraded to methane. The mineralization kinetics of biomass-associated LCFA were established according to an inhibition model based on Haldane's enzymatic inhibition kinetics. A value around 1,000 mg COD-LCFA..g VSS(-1) was obtained for the optimal specific LCFA content that allowed the maximal mineralization rate. For sludge with specific LCFA contents of 2,838 +/- 63 and 4,571 +/- 257 mg COD-LCFA..g VSS(-1), the specific methanogenic activities in the presence of acetate, butyrate, and H(2)/CO(2) were significantly enhanced after the mineralization of the biomass-associated LCFA. For sludge with a specific LCFA content near the optimal value defined by the kinetic model, the effect of adding VFA to the medium was studied during the mineralization of the biomass-associated LCFA. Different patterns were obtained for each individual substrate. Acetate and butyrate were preferentially consumed by the consortium, but in the case of propionate no evidence of a sequential consumption pattern could be withdrawn. It was concluded that LCFA do not exert a bactericidal neither a permanent toxic effect toward the anaerobic consortia. A discussion is addressed to the relative roles of a reversible inhibitory effect and a transport limitation effect imposed by the LCFA surrounding the cells. (c) 2004 Wiley Periodicals, Inc

  13. Online monitoring of Mezcal fermentation based on redox potential measurements.

    Science.gov (United States)

    Escalante-Minakata, P; Ibarra-Junquera, V; Rosu, H C; De León-Rodríguez, A; González-García, R

    2009-01-01

    We describe an algorithm for the continuous monitoring of the biomass and ethanol concentrations as well as the growth rate in the Mezcal fermentation process. The algorithm performs its task having available only the online measurements of the redox potential. The procedure combines an artificial neural network (ANN) that relates the redox potential to the ethanol and biomass concentrations with a nonlinear observer-based algorithm that uses the ANN biomass estimations to infer the growth rate of this fermentation process. The results show that the redox potential is a valuable indicator of the metabolic activity of the microorganisms during Mezcal fermentation. In addition, the estimated growth rate can be considered as a direct evidence of the presence of mixed culture growth in the process. Usually, mixtures of microorganisms could be intuitively clear in this kind of processes; however, the total biomass data do not provide definite evidence by themselves. In this paper, the detailed design of the software sensor as well as its experimental application is presented at the laboratory level.

  14. Upgraded Fast Beam Conditions Monitor for CMS online luminosity measurement

    CERN Document Server

    Leonard, Jessica Lynn; Hempel, Maria; Henschel, Hans; Karacheban, Olena; Lange, Wolfgang; Lohmann, Wolfgang; Novgorodova, Olga; Penno, Marek; Walsh, Roberval; Dabrowski, Anne; Guthoff, Moritz; Loos, R; Ryjov, Vladimir; Burtowy, Piotr; Lokhovitskiy, Arkady; Odell, Nathaniel; Przyborowski, Dominik; Stickland, David P; Zagozdzinska, Agnieszka

    2014-01-01

    The CMS beam condition monitoring subsystem BCM1F during LHC Run I consisted of 8 individual diamond sensors situated around the beam pipe within the tracker detector volume, for the purpose of fast monitoring of beam background and collision products. Effort is ongoing to develop the use of BCM1F as an online bunch-by-bunch luminosity monitor. BCM1F will be running whenever there is beam in LHC, and its data acquisition is independent from the data acquisition of the CMS detector, hence it delivers luminosity even when CMS is not taking data. To prepare for the expected increase in the LHC luminosity and the change from 50 ns to 25 ns bunch separation, several changes to the system are required, including a higher number of sensors and upgraded electronics. In particular, a new real-time digitizer with large memory was developed and is being integrated into a multi-subsystem framework for luminosity measurement. Current results from Run II preparation will be discussed, including results from the January 201...

  15. Upgraded Fast Beam Conditions Monitor for CMS online luminosity measurement

    CERN Document Server

    Leonard, Jessica Lynn

    2014-01-01

    The CMS beam and radiation monitoring subsystem BCM1F during LHC Run I consisted of 8 individual diamond sensors situated around the beam pipe within the tracker detector volume, for the purpose of fast monitoring of beam background and collision products. Effort is ongoing to develop the use of BCM1F as an online bunch-by-bunch luminosity monitor. BCM1F will be running whenever there is beam in LHC, and its data acquisition is independent from the data acquisition of the CMS detector, hence it delivers luminosity even when CMS is not taking data. To prepare for the expected increase in the LHC luminosity and the change from 50 ns to 25 ns bunch separation, several changes to the system are required, including a higher number of sensors and upgraded electronics. In particular, a new real-time digitizer with large memory was developed and is being integrated into a multi-subsystem framework for luminosity measurement. Current results from Run II preparation will be shown, including results from the January 201...

  16. Online and offline video game use in adolescents: measurement invariance and problem severity.

    Science.gov (United States)

    Smohai, Máté; Urbán, Róbert; Griffiths, Mark D; Király, Orsolya; Mirnics, Zsuzsanna; Vargha, András; Demetrovics, Zsolt

    2017-01-01

    Despite the increasing popularity of video game playing, little is known about the similarities and differences between online and offline video game players. The aims of this study were (i) to test the applicability and the measurement invariance of the previously developed Problematic Online Gaming Questionnaire (POGQ) in both online and offline gamers and to (ii) examine the differences in these groups. Video game use habits and POGQ were assessed in a sample of 1,964 (71% male) adolescent videogame players. Those gamers who played at least sometimes in an online context were considered "online gamers," while those who played videogames exclusively offline were considered "offline gamers." Confirmatory factor analysis supported the measurement invariance across online and offline videogame players. According to the multiple indicators multiple causes (MIMIC) model, online gamers were more likely to score higher on overuse, interpersonal conflict, and social isolation subscales of the POGQ. The results of the present study suggest that online and offline gaming can be assessed using the same psychometric instrument. These findings open the possibility for future research studies concerning problematic video gaming to include participants who exclusively play online or offline games, or both. However, the study also identified important structural features about how online and offline gaming might contribute differently to problematic use. These results provide important information that could be utilized in parental education and the prevention program about the possible detrimental consequences of online vs. offline video gaming.

  17. Online and official price indexes: Measuring Argentina's inflation

    OpenAIRE

    Cavallo, Alberto F.

    2013-01-01

    Prices collected from online retailers can be used to construct daily price indexes that complement official statistics. This paper studies their ability to match official inflation estimates in five Latin American countries, with a focus on Argentina, where official statistics have been heavily criticized in recent years. The data were collected between October 2007 and March 2011 from the largest supermarket in each country. In Brazil, Chile, Colombia, and Venezuela, online price indexes ap...

  18. Introducing a Relationship Marketing perspective in the measurement of Online Community success

    OpenAIRE

    Nadia Jouini; Ilaria Dalla Pozza

    2014-01-01

    A relationship marketing perspective is missed in measuring the success of online communities. Scope of this paper is to introduce a relationship marketing perspective in the definition of Key Performance Indicators (KPIs) for measuring the success of onl

  19. Current practice and perspectives in CRO oversight based on a survey performed among members of the German Association of Research-Based Pharmaceutical Companies (vfa).

    Science.gov (United States)

    Hennig, Michael; Hundt, Ferdinand; Busta, Susanne; Mikus, Stefan; Sanden, Per-Holger; Sörgel, Andrea; Ruppert, Thorsten

    2017-01-01

    In recent years, the number and scope of outsourced activities in the pharmaceutical industry have increased heavily. In addition, also the type of outsourcing has changed significantly in that time. This raises the question of whether and how sponsors retain the capability to select and to control the contract research organizations (CROs) involved and what expertise still has to be present in the development department as well as other relevant departments to ensure adequate oversight, also in line with the expectations of regulators and health authorities. In order to answer these questions, a survey was conducted among the German vfa member companies. The survey describes the latest developments and experiences in outsourcing by 18 German vfa member companies. It concentrates on measures how to implement Quality Assurance (QA) when performing outsourced clinical studies. This study shows that the majority of companies apply a full-outsourcing, preferred-provider model of clinical trial services, with the clinical research department playing the major role in this process. A large amount of guiding documents, processes and tools are used to ensure an adequate oversight of the services performed by the CRO(s). Finally the guiding principles for all oversight processes should be transparent communication, a clearly established expectation for quality, a precise definition of accountability and responsibility while avoiding silo mentality, and a comprehensive documentation of the oversight's evidence. For globally acting and outsourcing sponsors, oversight processes need to be aligned with regards to local and global perspectives. This survey shows that the current implementation of oversight processes in the participating companies covers all relevant areas to ensure highest quality and integrity of the data produced by the outsourced clinical trial.

  20. Current practice and perspectives in CRO oversight based on a survey performed among members of the German Association of Research-Based Pharmaceutical Companies (vfa

    Directory of Open Access Journals (Sweden)

    Hennig, Michael

    2017-01-01

    Full Text Available In recent years, the number and scope of outsourced activities in the pharmaceutical industry have increased heavily. In addition, also the type of outsourcing has changed significantly in that time. This raises the question of whether and how sponsors retain the capability to select and to control the contract research organizations (CROs involved and what expertise still has to be present in the development department as well as other relevant departments to ensure adequate oversight, also in line with the expectations of regulators and health authorities. In order to answer these questions, a survey was conducted among the German vfa member companies. The survey describes the latest developments and experiences in outsourcing by 18 German vfa member companies. It concentrates on measures how to implement Quality Assurance (QA when performing outsourced clinical studies.This study shows that the majority of companies apply a full-outsourcing, preferred-provider model of clinical trial services, with the clinical research department playing the major role in this process. A large amount of guiding documents, processes and tools are used to ensure an adequate oversight of the services performed by the CRO(s.Finally the guiding principles for all oversight processes should be transparent communication, a clearly established expectation for quality, a precise definition of accountability and responsibility while avoiding silo mentality, and a comprehensive documentation of the oversight’s evidence. For globally acting and outsourcing sponsors, oversight processes need to be aligned with regards to local and global perspectives. This survey shows that the current implementation of oversight processes in the participating companies covers all relevant areas to ensure highest quality and integrity of the data produced by the outsourced clinical trial.

  1. Anaerobic digestion of swine manure under natural zeolite addition: VFA evolution, cation variation, and related microbial diversity.

    Science.gov (United States)

    Lin, Lin; Wan, Chunli; Liu, Xiang; Lei, Zhongfang; Lee, Duu-Jong; Zhang, Yi; Tay, Joo Hwa; Zhang, Zhenya

    2013-12-01

    Batch experiments were carried out on anaerobic digestion of swine manure under 10 % of total solids and 60 g/L of zeolite addition at 35 °C. Four distinctive volatile fatty acid (VFAs) evolution stages were observed during the anaerobic process, i.e., VFA accumulation, acetic acid (HAc) and butyric acid (HBu) utilization, propionic acid (HPr) and valeric acid (HVa) degradation, and VFA depletion. Large decreases in HAc/HBu and HPr/HVa occurred respectively at the first and second biogas peaks. Biogas yield increased by 20 % after zeolite addition, about 356 mL/g VSadded with accelerated soluble chemical oxygen demand degradation and VFA (especially HPr and HBu) consumption in addition to a shortened lag phase between the two biogas peaks. Compared with Ca(2+) and Mg(2+) (100-300 mg/L) released from zeolite, simultaneous K(+) and NH4 (+) (580-600 mg/L) adsorptions onto zeolite particles contributed more to the enhanced biogasification, resulting in alleviated inhibition effects of ammonium on acidogenesis and methanogenesis, respectively. All the identified anaerobes could be grouped into Bacteroidetes and Firmicutes, and zeolite addition had no significant influence on the microbial biodiversity in this study.

  2. On-line fresh-cut lettuce quality measurement system using hyperspectral imaging

    Science.gov (United States)

    Lettuce, which is a main type of fresh-cut vegetable, has been used in various fresh-cut products. In this study, an online quality measurement system for detecting foreign substances on the fresh-cut lettuce was developed using hyperspectral reflectance imaging. The online detection system with a s...

  3. Improvement of Hand Hygiene Quality and Compliance Using Bioburden Measurement and Online Feedback in Germany.

    Science.gov (United States)

    Günther, Frank; Rudolph, Kai; Frank, Uwe; Mutters, Nico T

    2017-01-01

    To improve compliance with hand hygiene, a novel method with inclusion of an online reporting system was developed, comprising measurement of total hand bioburden, anonymous online feedback, and onsite training. The intervention significantly improved both compliance and quality of hand hygiene and reduced Staphylococcus aureus incidence. Infect Control Hosp Epidemiol 2016;1-4.

  4. Online measurement of mental representations of complex spatial decision problems : comparison of CNET and hard laddering

    NARCIS (Netherlands)

    Horeni, O.; Arentze, T.A.; Dellaert, B.G.C.; Timmermans, H.J.P.

    2014-01-01

    This paper introduces the online Causal Network Elicitation Technique (CNET), as a technique for measuring components of mental representations of choice tasks and compares it with the more common technique of online 'hard' laddering (HL). While CNET works in basically two phases, one in open

  5. Online measurement of mental representations of complex spatial decision problems : Comparison of CNET and hard laddering

    NARCIS (Netherlands)

    O. Horeni (Oliver); T.A. Arentze (Theo); B.G.C. Dellaert (Benedict); H.J.P. Timmermans (Harry)

    2013-01-01

    textabstractThis paper introduces the online Causal Network Elicitation Technique (CNET), as a technique for measuring components of mental representations of choice tasks and compares it with the more common technique of online ‘hard’ laddering (HL). While CNET works in basically two phases, one in

  6. On-line data processing apparatus for spectroscopic measurements of atomic uranium

    International Nuclear Information System (INIS)

    Miron, E.; Levin, L.A.; Erez, G; Baumatz, D; Goren, I.; Shpancer, I.

    1977-01-01

    A computer-based apparatus for on-line spectroscopic measurements of atomic uranium is described. The system is capable of enhancing the signal-to-noise ratio by averaging, and performing calculations. Computation flow charts and programs are included

  7. Development of measures of online privacy concern and protection for use on the Internet

    OpenAIRE

    Buchanan, T; Paine, C; Joinson, A; Reips, U D

    2007-01-01

    As the Internet grows in importance, concerns about online privacy have arisen. We describe the development and validation of three short Internet-administered scales measuring privacy related attitudes ('Privacy Concern') and behaviors ('General Caution' and 'Technical Protection').

  8. Measuring CO2 emissions induced by online and brick-and-mortar retailing

    OpenAIRE

    Carling, Kenneth; Han, Mengjie; Håkansson, Johan; Meng, Xiangli; Rudholm, Niklas

    2014-01-01

    We develop a method for empirically measuring the difference in carbon footprint between traditional and online retailing (“e-tailing”) from entry point to a geographical area to consumer residence. The method only requires data on the locations of brick-and-mortar stores, online delivery points, and residences of the region’s population, and on the goods transportation networks in the studied region. Such data are readily available in most countries, so the method is not country or region sp...

  9. On-line pressure measurement using scanning systems

    International Nuclear Information System (INIS)

    Morss, A.G.; Watson, A.P.

    1978-08-01

    Data collection methods can be improved significantly by using pressure scanning systems in conjunction with transducers for the measurement of pressure distribution in fluid flow rigs. However, the response of pressure transducers to the slight random pressure fluctuations that occur in practice can cause some measurement problems, especially for accurate work. The nature of these pressure fluctuations is examined and suitable analysis techniques are recommended. Results obtained using these techniques are presented. It is concluded that by using the correct techniques pressure transducer systems can be used to measure pressure distributions accurately and are sufficiently sensitive to measure very small systematic effects with great precision. (author)

  10. An apparatus for on-line measuring of the coating weight on art paper

    International Nuclear Information System (INIS)

    Huang Meifen; Mao Shunjuan

    1986-01-01

    The method and apparatus for on-line measuring of the coating weight on art paper are described. The design of the coating gauge was based on the technique of charcateristic X-ray fluorescence preferential absorption. The gauge was equipped with a TP-801 micro-computer which makes the gauge capable of showing and typing the data in different forms. The measurement is quick, continuous, accurate and non-destructive. Analysis period is 10 seconds. In on-line measuring, the reproducibility is +- 1 g/m 2 and the relative error of this method amounts to +- 5% with the weighing method as a standard

  11. Online beam energy measurement of Beijing electron positron collider II linear accelerator

    Science.gov (United States)

    Wang, S.; Iqbal, M.; Liu, R.; Chi, Y.

    2016-02-01

    This paper describes online beam energy measurement of Beijing Electron Positron Collider upgraded version II linear accelerator (linac) adequately. It presents the calculation formula, gives the error analysis in detail, discusses the realization in practice, and makes some verification. The method mentioned here measures the beam energy by acquiring the horizontal beam position with three beam position monitors (BPMs), which eliminates the effect of orbit fluctuation, and is much better than the one using the single BPM. The error analysis indicates that this online measurement has further potential usage such as a part of beam energy feedback system. The reliability of this method is also discussed and demonstrated in this paper.

  12. Revealed or hidden?: insights into ways of measuring mental representations online: A comparative study of APT and CNET applied to an online agent

    NARCIS (Netherlands)

    Horeni, O.; Arentze, T.A.; Dellaert, B.G.C.; Timmermans, H.J.P.

    2010-01-01

    This paper presents and compares newly developed interview techniques (APT and CNET) which were implemented and tested by an online agent in order to measure mental representations underlying activity-choices. The comparison is supported and completed by the results from a first online survey with

  13. Online junction temperature measurement using peak gate current

    DEFF Research Database (Denmark)

    Baker, Nick; Munk-Nielsen, Stig; Iannuzzo, Francesco

    2015-01-01

    A new method for junction temperature measurement of MOS-gated power semiconductor switches is presented. The measurement method involves detecting the peak voltage over the external gate resistor of an IGBT or MOSFET during turn-on. This voltage is directly proportional to the peak gate current...

  14. Can use of online measurements in EVOP designs reduce the time to locate production optimum?

    DEFF Research Database (Denmark)

    Andersen, Heidi Mai-Lis; Jørgensen, Erik; Pedersen, Lene Juul

    2015-01-01

    The purpose of this project is to investigate if application of online sensor measurements can improve the use of Evolutionary operation (EVOP) tools in livestock farms by reducing manual recording and by observing intermediate problem measures at an early stage. An example with reduction of tail...

  15. Online high sensitivity measurement system for transuranic aerosols

    International Nuclear Information System (INIS)

    Kordas, J.F.; Phelps, P.L.

    1976-01-01

    A measurement system for transuranic aerosols has been designed that will be able to withstand the corrosive nature of stack effluents and yet have extremely high sensitivity. It will be capable of measuring 1 maximum permissible concentration (MPC) of plutonium or americium in 30 minutes with a fractional standard deviation of less than 0.33. Background resulting from 218 Po is eliminated by alpha energy discrimination and a decay scheme analysis. A microprocessor controls all data acquisition, data reduction, and instrument calibration

  16. A comparison of performance measures for online algorithms

    DEFF Research Database (Denmark)

    Boyar, Joan; Irani, Sandy; Larsen, Kim Skak

    2009-01-01

    is to balance greediness and adaptability. We examine how these measures evaluate the Greedy Algorithm and Lazy Double Coverage, commonly studied algorithms in the context of server problems. We examine Competitive Analysis, the Max/Max Ratio, the Random Order Ratio, Bijective Analysis and Relative Worst Order...... Analysis and determine how they compare the two algorithms. We find that by the Max/Max Ratio and Bijective Analysis, Greedy is the better algorithm. Under the other measures Lazy Double Coverage is better, though Relative Worst Order Analysis indicates that Greedy is sometimes better. Our results also...... provide the first proof of optimality of an algorithm under Relative Worst Order Analysis....

  17. GUM approach to uncertainty estimations for online 220Rn concentration measurements using Lucas scintillation cell

    International Nuclear Information System (INIS)

    Sathyabama, N.

    2014-01-01

    It is now widely recognized that, when all of the known or suspected components of errors have been evaluated and corrected, there still remains an uncertainty, that is, a doubt about how well the result of the measurement represents the value of the quantity being measured. Evaluation of measurement data - Guide to the expression of Uncertainty in Measurement (GUM) is a guidance document, the purpose of which is to promote full information on how uncertainty statements are arrived at and to provide a basis for the international comparison of measurement results. In this paper, uncertainty estimations following GUM guidelines have been made for the measured values of online thoron concentrations using Lucas scintillation cell to prove that the correction for disequilibrium between 220 Rn and 216 Po is significant in online 220 Rn measurements

  18. Online Measurement of Oxygen-Dependent Enzyme Reaction Kinetics

    DEFF Research Database (Denmark)

    Meissner, Murray Peter; Nordblad, Mathias; Woodley, John M

    2018-01-01

    accurate measurement of the oxygen mass balance in the gas-phase of a reactor. The method was successfully validated and demonstrated using two model reactions: firstly the oxidation of glucose by glucose oxidase and secondly the Baeyer-Villiger oxidation of macrocyclic ketones to lactones. Initial...

  19. On-Line Flatness Measurement in the Steelmaking Industry

    Directory of Open Access Journals (Sweden)

    Rubén Usamentiaga

    2013-08-01

    Full Text Available Shape is a key characteristic to determine the quality of outgoing flat-rolled products in the steel industry. It is greatly influenced by flatness, a feature to describe how the surface of a rolled product approaches a plane. Flatness is of the utmost importance in steelmaking, since it is used by most downstream processes and customers for the acceptance or rejection of rolled products. Flatness sensors compute flatness measurements based on comparing the length of several longitudinal fibers of the surface of the product under inspection. Two main different approaches are commonly used. On the one hand, most mechanical sensors measure the tensile stress across the width of the rolled product, while manufacturing and estimating the fiber lengths from this stress. On the other hand, optical sensors measure the length of the fibers by means of light patterns projected onto the product surface. In this paper, we review the techniques and the main sensors used in the steelmaking industry to measure and quantify flatness defects in steel plates, sheets and strips. Most of these techniques and sensors can be used in other industries involving rolling mills or continuous production lines, such as aluminum, copper and paper, to name a few. Encompassed in the special issue, State-of-the-Art Sensors Technology in Spain 2013, this paper also reviews the most important flatness sensors designed and developed for the steelmaking industry in Spain.

  20. On-Line Flatness Measurement in the Steelmaking Industry

    Science.gov (United States)

    Molleda, Julio; Usamentiaga, Rubén; Garcίa, Daniel F.

    2013-01-01

    Shape is a key characteristic to determine the quality of outgoing flat-rolled products in the steel industry. It is greatly influenced by flatness, a feature to describe how the surface of a rolled product approaches a plane. Flatness is of the utmost importance in steelmaking, since it is used by most downstream processes and customers for the acceptance or rejection of rolled products. Flatness sensors compute flatness measurements based on comparing the length of several longitudinal fibers of the surface of the product under inspection. Two main different approaches are commonly used. On the one hand, most mechanical sensors measure the tensile stress across the width of the rolled product, while manufacturing and estimating the fiber lengths from this stress. On the other hand, optical sensors measure the length of the fibers by means of light patterns projected onto the product surface. In this paper, we review the techniques and the main sensors used in the steelmaking industry to measure and quantify flatness defects in steel plates, sheets and strips. Most of these techniques and sensors can be used in other industries involving rolling mills or continuous production lines, such as aluminum, copper and paper, to name a few. Encompassed in the special issue, State-of-the-Art Sensors Technology in Spain 2013, this paper also reviews the most important flatness sensors designed and developed for the steelmaking industry in Spain. PMID:23939583

  1. On-line stable isotope measurements during plant and soil gas exchange

    International Nuclear Information System (INIS)

    Yakir, D.

    2001-01-01

    Recent techniques for on-line stable isotope measurements during plant and soil exchange of CO 2 and/or water vapor are briefly reviewed. For CO 2 , these techniques provide means for on-line measurements of isotopic discrimination during CO 2 exchange by leaves in the laboratory and in the field, of isotopic discrimination during soil respiration and during soil-atmosphere CO 2 exchange, and of isotopic discrimination in O 2 during plant respiration. For water vapor, these techniques provide means to measure oxygen isotopic composition of water vapor during leaf transpiration and for the analysis of sub microliter condensed water vapor samples. Most of these techniques involve on-line sampling of CO 2 and water vapor from a dynamic, intact soil or plant system. In the laboratory, these systems also allow on-line isotopic analysis by continuous-flow isotope ratio mass spectrometry. The information obtained with these on-line techniques is becoming increasingly valuable, and often critical, for ecophysiologial research and in the study of biosphere-atmosphere interactions. (author)

  2. Online Dialogue Measurement Index – A Measurement of the Dialogic Orientation of Organizations in the Online Environment

    DEFF Research Database (Denmark)

    Romenti, Stefania; Valentini, Chiara; Murtarelli, Grazia

    Dialogue has been recognized as an important component of organization-stakeholder relations and a communicative sign of openness and responsibility towards others. Still, developing dialogic communications with stakeholders is not an easy task and can also result to be counterproductive when...... dialogic communications create conflicts or bad reputations. Organizations require public relations professionals to measure the results of their communication activities including their dialogic efforts. Yet, dialogic communication measurements are scarce and often incomplete. The purpose of this study...

  3. On-line fibration measurements in lifting magnets

    International Nuclear Information System (INIS)

    Joas, H.D.

    1993-01-01

    After a solenoid pilot valve had failed to open during a functional test, all of the 17 lifting magnets of the pilot valves were removed, inspected and overhauled during the refuelling of a BWR. Some lifting magnets were found to have deposits between rod (austenitic) and guide sleeve (brass). A relative movement (hammering) between both components was the suspected cause. Measurements confirmed the assumption of a laterally hammering movement of the rods, and also a correlation between acceleration intensity and deposit thickness. Local changes of design or modification of material pairing were suggested as remedial actions. The simulation of measured operation loads was effected on a test rig by means of vibration exciter and the acceleration-time factors known from operation. This resulted in a simple design modification which reduces the impact load between rod and bearing during operation, or else in a suitable material pairing which is optimized for impact load rather than sliding load. Building-up the wear area of the rod was found to interfere least with the existing design. (orig./DG) [de

  4. A comparative study on the production rates of VFA and bacteria in the rumen of buffalo and goat estimated by isotope dilution technique

    International Nuclear Information System (INIS)

    Verma, D.N.; Mehra, U.R.; Singh, U.B.; Ranjhan, S.K.

    1977-01-01

    Digestibility trials were conducted on Murrah buffaloes and Barbari goats with rumen cannulae in the rumen to determine the digestibility of the feed constituents and the production rates of bacteria and total VFA were estimated in the rumen by isotope dilution technique. The bacterial cells growth in the rumen was more in goats than buffaloes when fed ad libitum and calculated on equal feed intake, where as, in buffaloes fed on restricted diet equal to the goats the production of bacteria and VFA were higher. Goats converted 54.04 percent of their dietary nitrogen into microbial nitrogen which was more than twice of buffaloes. (author)

  5. Online measurement of fluence and position for protontherapy beams

    International Nuclear Information System (INIS)

    Benati, C.; Boriano, A.

    2004-01-01

    Tumour therapy with proton beams has been used for several decades in many centers with very good results in terms of local control and overall survival. Typical pathologies treated with this technique are located in head and neck, eye, prostate and in general at big depths or close to critical organs. The Experimental Physics Department of the University of Turin and the local Section of INFN, in collaboration with INFN Laboratori Nazionali del Sud Catania and Centre de Protontherapie de Orsay Paris, have developed detector systems that allow the measurement of beam position and fluence, obtained in real time during beam delivery. The Centre in Catania (CATANA: Centro di AdroTerapia ed Applicazioni Nucleari Avanzate) has been treating patients with eye pathologies since spring 2002 using a superconducting cyclotron accelerating protons up to 62 MeV

  6. Online measurement of fluence and position for protontherapy beams

    Energy Technology Data Exchange (ETDEWEB)

    Benati, C.; Boriano, A. [Torino Univ., Torino (Italy). Dipartimento di Fisica Sperimentale; Bourhaleb, F. [TERA Foundation, Novara (Italy)] [and others

    2004-10-01

    Tumour therapy with proton beams has been used for several decades in many centers with very good results in terms of local control and overall survival. Typical pathologies treated with this technique are located in head and neck, eye, prostate and in general at big depths or close to critical organs. The Experimental Physics Department of the University of Turin and the local Section of INFN, in collaboration with INFN Laboratori Nazionali del Sud Catania and Centre de Protontherapie de Orsay Paris, have developed detector systems that allow the measurement of beam position and fluence, obtained in real time during beam delivery. The Centre in Catania (CATANA: Centro di AdroTerapia ed Applicazioni Nucleari Avanzate) has been treating patients with eye pathologies since spring 2002 using a superconducting cyclotron accelerating protons up to 62 MeV.

  7. Online Radiation Dose Measurement System for ATLAS experiment

    CERN Document Server

    Mandić, I; The ATLAS collaboration

    2012-01-01

    Particle detectors and readout electronics in the high energy physics experiment ATLAS at the Large Hadron Collider at CERN operate in radiation field containing photons, charged particles and neutrons. The particles in the radiation field originate from proton-proton interactions as well as from interactions of these particles with material in the experimental apparatus. In the innermost parts of ATLAS detector components will be exposed to ionizing doses exceeding 100 kGy. Energetic hadrons will also cause displacement damage in silicon equivalent to fluences of several times 10e14 1 MeV-neutrons per cm2. Such radiation doses can have severe influence on the performance of detectors. It is therefore very important to continuously monitor the accumulated doses to understand the detector performance and to correctly predict the lifetime of radiation sensitive components. Measurements of doses are important also to verify the simulations and represent a crucial input into the models used for predicting future ...

  8. Online measurement of fluence and position for protontherapy beams

    Science.gov (United States)

    Benati, C.; Boriano, A.; Bourhaleb, F.; Cirio, R.; Cirrone, G. A. P.; Cornelius, I.; Cuttone, G.; Donetti, M.; Garelli, E.; Giordanengo, S.; Guérin, L.; La Rosa, A.; Luparia, A.; Marchetto, F.; Martin, F.; Meyroneinc, S.; Peroni, C.; Pittà, G.; Raffaele, L.; Sabini, M. G.; Valastro, L.

    2004-09-01

    Tumour therapy with proton beams has been used for several decades in many centres with very good results in terms of local control and overall survival. Typical pathologies treated with this technique are located in head and neck, eye, prostate and in general at big depths or close to critical organs. The Experimental Physics Department of the University of Turin and the local Section of INFN, in collaboration with INFN Laboratori Nazionali del Sud Catania and Centre de Protontherapie de Orsay Paris, have developed detector systems that allow the measurement of beam position and fluence, obtained in real time during beam delivery. The centre in Catania (CATANA: Centro di AdroTerapia ed Applicazioni Nucleari Avanzate) has been treating patients with eye pathologies since spring 2002 using a superconducting cyclotron accelerating protons up to 62 MeV.This kind of treatments need high-resolution monitor systems and for this reason we have developed a 256-strip segmented ionisation chamber, each strip being 400 μm wide, with a total sensitive area 13×13 cm2. The Centre de Protontherapie de Orsay (CPO) has been operational since 1991 and features a synchrocyclotron used for eye and head and neck tumours with proton beams up to 200 MeV. The monitor system has to work on a large surface and for this purpose we have designed a pixel-segmented ionisation chamber, each pixel being 5×5 mm2, for a total active area of 16×16 cm2. The results obtained with two prototypes of the pixel and strip chambers demonstrate that the detectors allow the measurement of fluence and centre of gravity as requested by clinical specifications.

  9. Actively stabilized optical fiber interferometry technique for online/in-process surface measurement

    International Nuclear Information System (INIS)

    Wang Kaiwei; Martin, Haydn; Jiang Xiangqian

    2008-01-01

    In this paper, we report the recent progress in optical-beam scanning fiber interferometry for potential online nanoscale surface measurement based on the previous research. It attempts to generate a robust and miniature measurement device for future development into a multiprobe array measurement system. In this research, both fiber-optic-interferometry and the wavelength-division-multiplexing techniques have been used, so that the optical probe and the optical interferometer are well spaced and fast surface scanning can be carried out, allowing flexibility for online measurement. In addition, this system provides a self-reference signal to stabilize the optical detection with high common-mode noise suppression by adopting an active phase tracking and stabilization technique. Low-frequency noise was significantly reduced compared with unstabilized result. The measurement of a sample surface shows an attained repeatability of 3.3 nm

  10. The Effects of Survey Timing on Student Evaluation of Teaching Measures Obtained Using Online Surveys

    Science.gov (United States)

    Estelami, Hooman

    2015-01-01

    Teaching evaluations are an important measurement tool used by business schools in gauging the level of student satisfaction with the educational services delivered by faculty. The growing use of online teaching evaluations has enabled educational administrators to expand the time period during which student evaluation of teaching (SET) surveys…

  11. The web-buffet--development and validation of an online tool to measure food choice.

    Science.gov (United States)

    Bucher, Tamara; Keller, Carmen

    2015-08-01

    To date, no data exist on the agreement of food choice measured using an online tool with subsequent actual consumption. This needs to be shown before food choice, measured by means of an online tool, is used as a dependent variable to examine intake in the general population. A 'web-buffet' was developed to assess food choice. Choice was measured as planned meal composition from photographic material; respondents chose preferred foods and proportions for a main meal (out of a possible 144 combinations) online and the validity was assessed by comparison of a meal composed from a web-buffet with actual food intake 24-48 h later. Furthermore, correlations of food preferences, energy needs and health interest with meals chosen from the web-buffet were analysed. Students: n 106 (Study I), n 32 (Study II). Meals chosen from the web-buffet (mean = 2998 kJ, SD = 471 kJ) agreed with actual consumption (rs = 0.63, P choice in the web-buffet agrees sufficiently well with actual intake to measure food choice as a dependent variable in online surveys. However, we found an average underestimation of subsequent consumption. High correlations of preferences with chosen amounts and an inverse association of health interest with total energy further indicate the validity of the tool. Applications in behavioural nutrition research are discussed.

  12. Using online public services: a measurement of citizens’ operational, formal, information and strategic skills

    NARCIS (Netherlands)

    van Deursen, Alexander Johannes Aloysius Maria; van Dijk, Johannes A.G.M.; Wimmer, Maria A.; Scholl, Hans J.; Ferro, Enrico

    2008-01-01

    It is important to take digital inequality research in consideration when focusing on electronic public service delivery. From this point of view, this paper considers four digital skills that citizens need when using online public services. Measurements of these skills in the Netherlands indicate

  13. Online soft sensor for hybrid systems with mixed continuous and discrete measurements

    Czech Academy of Sciences Publication Activity Database

    Suzdaleva, Evgenia; Nagy, Ivan

    2012-01-01

    Roč. 36, č. 10 (2012), s. 294-300 ISSN 0098-1354 R&D Projects: GA MŠk 1M0572; GA TA ČR TA01030123 Grant - others:Skoda Auto, a.s.(CZ) ENS/2009/UTIA Institutional research plan: CEZ:AV0Z10750506 Keywords : online state prediction * hybrid filter * state-space model * mixed data Subject RIV: BC - Control Systems Theory Impact factor: 2.091, year: 2012 http://library.utia.cas.cz/separaty/2011/AS/suzdaleva-online soft sensor for hybrid systems with mixed continuous and discrete measurements.pdf

  14. ELABORATING A MEASUREMENT INSTRUMENT FOR THE FLOW EXPERIENCE DURING ONLINE INFORMATION SEARCH

    Directory of Open Access Journals (Sweden)

    Caraivan Luiza

    2012-12-01

    Full Text Available Flow is a construct imported in marketing research from social sciences in order to examine consumer behavior in the online medium. The construct describes a state of deep involvement in a challenging activity, most frequently characterized by high levels of enjoyment, control and concentration. Researchers found that the degree to which online experience is challenging can be defined, measured, and related well to important marketing variables. As shown by our extensive literature review, flow measurements include antecedents, dimensions and consequences of flow. The present paper represents a detailed description of the construct`s operationalization in the context of online information search. In this respect, our main goal is to produce a basic instrument to evaluate the flow experience of online search, in order to capitalize on the premises of an interactive, complex informational medium – the World Wide Web – and on the consequence of an exploratory informational behavior of users. The instrument is conceived to offer a primal possibility to collect data. The composition, source and significance of the 11 scales used to measure the multiple factors of the flow experience during online search are detailed in this study with the aim to ensure the compliance with scientific rigors and to facilitate correct reports of data related to the reliability and validity of measurements. For further research, we propose factor analysis to test the resulted instrument and to ensure that the measures employed are psychometrically sound. Factor analysis refers to a wide range of statistic techniques used to represent a set of variables in concordance with a reduced number of hypothetical variables called factors. Factorial analysis is used to solve two types of problems: reducing the number of variables to increase data processing speed and identifying hidden patterns in the existent data relations. However, we expect our scales to perform

  15. Investigating the construct validity of quality measures influencing online shopping in a South African context

    Directory of Open Access Journals (Sweden)

    Hung-Joubert Yu-ting

    2017-09-01

    Full Text Available Online shopping has become popular over the years and is a widely used way to purchase goods and services. For online retailers to succeed, it is important that they have a quality website to attract and retain customers. The aim of this study was to investigate the construct validity of three respective measurement instruments related to website quality factors, namely; system, information and service quality factors, which may influence consumers within the online shopping environment in a South African context. Primary data was collected through self-administered questionnaires. The demographic and online shopping profile of the sample are presented and followed by confirmatory and exploratory factors analyses on the three instruments. The confirmatory factor analysis found poor fit for the original hypothesised models for each of the scales; further exploratory factor analyses revealed slightly different dimensionalities underlying the scales, yet these were still somewhat aligned with the theoretical framework from which the original scales were derived. Despite this, the study provides a platform for future revision of the scales and future research into website quality factors within the online shopping environment in a South African context.

  16. Improving integrity of on-line grammage measurement with traceable basic calibration.

    Science.gov (United States)

    Kangasrääsiö, Juha

    2010-07-01

    The automatic control of grammage (basis weight) in paper and board production is based upon on-line grammage measurement. Furthermore, the automatic control of other quality variables such as moisture, ash content and coat weight, may rely on the grammage measurement. The integrity of Kr-85 based on-line grammage measurement systems was studied, by performing basic calibrations with traceably calibrated plastic reference standards. The calibrations were performed according to the EN ISO/IEC 17025 standard, which is a requirement for calibration laboratories. The observed relative measurement errors were 3.3% in the first time calibrations at the 95% confidence level. With the traceable basic calibration method, however, these errors can be reduced to under 0.5%, thus improving the integrity of on-line grammage measurements. Also a standardised algorithm, based on the experience from the performed calibrations, is proposed to ease the adjustment of the different grammage measurement systems. The calibration technique can basically be applied to all beta-radiation based grammage measurements. 2010 ISA. Published by Elsevier Ltd. All rights reserved.

  17. Online evolution reconstruction from a single measurement record with random time intervals for quantum communication

    Science.gov (United States)

    Zhou, Hua; Su, Yang; Wang, Rong; Zhu, Yong; Shen, Huiping; Pu, Tao; Wu, Chuanxin; Zhao, Jiyong; Zhang, Baofu; Xu, Zhiyong

    2017-10-01

    Online reconstruction of a time-variant quantum state from the encoding/decoding results of quantum communication is addressed by developing a method of evolution reconstruction from a single measurement record with random time intervals. A time-variant two-dimensional state is reconstructed on the basis of recovering its expectation value functions of three nonorthogonal projectors from a random single measurement record, which is composed from the discarded qubits of the six-state protocol. The simulated results prove that our method is robust to typical metro quantum channels. Our work extends the Fourier-based method of evolution reconstruction from the version for a regular single measurement record with equal time intervals to a unified one, which can be applied to arbitrary single measurement records. The proposed protocol of evolution reconstruction runs concurrently with the one of quantum communication, which can facilitate the online quantum tomography.

  18. A Comparison of Multiscale Permutation Entropy Measures in On-Line Depth of Anesthesia Monitoring.

    Science.gov (United States)

    Su, Cui; Liang, Zhenhu; Li, Xiaoli; Li, Duan; Li, Yongwang; Ursino, Mauro

    2016-01-01

    Multiscale permutation entropy (MSPE) is becoming an interesting tool to explore neurophysiological mechanisms in recent years. In this study, six MSPE measures were proposed for on-line depth of anesthesia (DoA) monitoring to quantify the anesthetic effect on the real-time EEG recordings. The performance of these measures in describing the transient characters of simulated neural populations and clinical anesthesia EEG were evaluated and compared. Six MSPE algorithms-derived from Shannon permutation entropy (SPE), Renyi permutation entropy (RPE) and Tsallis permutation entropy (TPE) combined with the decomposition procedures of coarse-graining (CG) method and moving average (MA) analysis-were studied. A thalamo-cortical neural mass model (TCNMM) was used to generate noise-free EEG under anesthesia to quantitatively assess the robustness of each MSPE measure against noise. Then, the clinical anesthesia EEG recordings from 20 patients were analyzed with these measures. To validate their effectiveness, the ability of six measures were compared in terms of tracking the dynamical changes in EEG data and the performance in state discrimination. The Pearson correlation coefficient (R) was used to assess the relationship among MSPE measures. CG-based MSPEs failed in on-line DoA monitoring at multiscale analysis. In on-line EEG analysis, the MA-based MSPE measures at 5 decomposed scales could track the transient changes of EEG recordings and statistically distinguish the awake state, unconsciousness and recovery of consciousness (RoC) state significantly. Compared to single-scale SPE and RPE, MSPEs had better anti-noise ability and MA-RPE at scale 5 performed best in this aspect. MA-TPE outperformed other measures with faster tracking speed of the loss of unconsciousness. MA-based multiscale permutation entropies have the potential for on-line anesthesia EEG analysis with its simple computation and sensitivity to drug effect changes. CG-based multiscale permutation

  19. Online measurement of LHC beam parameters with the ATLAS High Level Trigger

    International Nuclear Information System (INIS)

    Strauss, E

    2012-01-01

    We present an online measurement of the LHC beamspot parameters in ATLAS using the High Level Trigger (HLT). When a significant change is detected in the measured beamspot, it is distributed to the HLT. There, trigger algorithms like b-tagging which calculate impact parameters or decay lengths benefit from a precise, up-to-date set of beamspot parameters. Additionally, online feedback is sent to the LHC operators in real time. The measurement is performed by an algorithm running on the Level 2 trigger farm, leveraging the high rate of usable events. Dedicated algorithms perform a full scan of the silicon detector to reconstruct event vertices from registered tracks. The distribution of these vertices is aggregated across the farm and their shape is extracted through fits every 60 seconds to determine the beamspot position, size, and tilt. The reconstructed beamspot values are corrected for detector resolution effects, measured in situ using the separation of vertices whose tracks have been split into two collections. Furthermore, measurements for individual bunch crossings have allowed for studies of single-bunch distributions as well as the behavior of bunch trains. This talk will cover the constraints imposed by the online environment and describe how these measurements are accomplished with the given resources. The algorithm tasks must be completed within the time constraints of the Level 2 trigger, with limited CPU and bandwidth allocations. This places an emphasis on efficient algorithm design and the minimization of data requests.

  20. PENGARUH TEPUNG DAUN GAMAL DAN DAUN KELOR DALAM UREA CASSAVA BLOK (UCB TERHADAP KECERNAAN, KADAR VFA, DAN NH3 IN-VITRO

    Directory of Open Access Journals (Sweden)

    N M. WITARIADI

    2012-09-01

    Full Text Available ABSTRAK Penelitian telah dilakukan dengan tujuan untuk mendapatkan informasi tentang pengaruh tepung daun gamal dan daun kelor sebagai sumber protein dalam urea cassava blok (UCB terhadap kecernaan bahan kering, bahan organik, kadar VFA, dan NH3 cairan rumen pakan jerami padi secara invitro. Penelitian dilaksanakan dengan mempergunakan rancangan acak lengkap (RAL dengan 3 perlakuan dan 5 ulangan. Sehingga secara keseluruhan terdapat 15 unit penelitian. Adapun ketiga perlakuan tersebut adalah: Perlakuan A (jerami padi + UCB yang ditambah tepung daun kelor; B (jerami padi + UCB yang ditambah tepung daun gamal, dan C (jerami padi + UCB yang ditambah tepung daun kelor dan daun gamal. Varibel yang diamati adalah kecernaan bahan kering (KCBK , kecernaan bahan organik (KCBO in-vitro, produksi vollatile fatty acid (VFA, produksi NH3, dan pH supernatan. Hasil penelitian mendapatkan bahwa KCBK, KCBO invitro, VFA, NH3, dan pH supernatan pada ketiga perlakuan berbeda nyata (P<0,05. Penggunaan daun gamal sebagai sumber protein pada UCB menghasilkan KCBK, KCBO, VFA, NH3, tertinggi dibandingkan dengan daun kelor maupun kombinasi antara daun gamal dan daun kelor. EFFECT OF USING GLIRICIDIA (Gliricidia sepium AND MORINGA (Moringa oleifera LEAVES MEALS IN UREA CASSAVA BLOCK (UCB ON DIGESTIBILITY, VOLLATILE FATTY ACID, AND NH3 IN-VITRO. ABSTRACT The experiment has been conducted in order to now the effect of Gliricidia sepium and Moringa oleifera leaves meal a source of protein in urea cassava block (UCB to the digestibility dray matter and organic matter , VFA and ammonia concentration with rice straw diet. The experiment set in completely randomized design using three treatment. The treatment are: A (rise straw + UCB with Moringa; B (rise straw + UCB with Gliricidia sepium, and C (rise straw + UCB with Moringa and Gliricidia sepium. The observed variable are: dry matter, organic matter digestibility, volatile fatty acid, ammonia concentration, and pH rumen juice

  1. Online Assessment, Measurement and Evaluation Case Studies from Higher Education, K-12 and Corporate

    Directory of Open Access Journals (Sweden)

    Reviewed by Dr. Adnan BOYACI

    2006-01-01

    Full Text Available With the revolution occurred in communication technologies at the beginning of 1990’s, network technologies have emerged as the challenging parameters accelerating improvements of instructional technologies. Online classrooms and management of them appeared as a new domain which necessitates a new paradigm different from the classical ones. User and instructor friendly learning context and management systems (LCMS have brought new approaches, techniques and tools for the assessment and measurement processes. These approaches, techniques and tools embedded in LCMS have redefined not only the way teachers teach but also students learn. WebCT, Blackboard and eCollege and many others as the online instructional environments have provided new opportunities to construct a coherent instructional system which has never been used as a unique environment any before. Assessment and measurement have been redefined within this framework. The successes of assessment and measurement methodologies or system inevitably depend on conceptualization and then implementation to different educational settings.

  2. A Laser-Based Measuring System for Online Quality Control of Car Engine Block

    Directory of Open Access Journals (Sweden)

    Xing-Qiang Li

    2016-11-01

    Full Text Available For online quality control of car engine production, pneumatic measurement instrument plays an unshakeable role in measuring diameters inside engine block because of its portability and high-accuracy. To the limitation of its measuring principle, however, the working space between the pneumatic device and measured surface is too small to require manual operation. This lowers the measuring efficiency and becomes an obstacle to perform automatic measurement. In this article, a high-speed, automatic measuring system is proposed to take the place of pneumatic devices by using a laser-based measuring unit. The measuring unit is considered as a set of several measuring modules, where each of them acts like a single bore gauge and is made of four laser triangulation sensors (LTSs, which are installed on different positions and in opposite directions. The spatial relationship among these LTSs was calibrated before measurements. Sampling points from measured shaft holes can be collected by the measuring unit. A unified mathematical model was established for both calibration and measurement. Based on the established model, the relative pose between the measuring unit and measured workpiece does not impact the measuring accuracy. This frees the measuring unit from accurate positioning or adjustment, and makes it possible to realize fast and automatic measurement. The proposed system and method were finally validated by experiments.

  3. Online measurement of bead geometry in GMAW-based additive manufacturing using passive vision

    International Nuclear Information System (INIS)

    Xiong, Jun; Zhang, Guangjun

    2013-01-01

    Additive manufacturing based on gas metal arc welding is an advanced technique for depositing fully dense components with low cost. Despite this fact, techniques to achieve accurate control and automation of the process have not yet been perfectly developed. The online measurement of the deposited bead geometry is a key problem for reliable control. In this work a passive vision-sensing system, comprising two cameras and composite filtering techniques, was proposed for real-time detection of the bead height and width through deposition of thin walls. The nozzle to the top surface distance was monitored for eliminating accumulated height errors during the multi-layer deposition process. Various image processing algorithms were applied and discussed for extracting feature parameters. A calibration procedure was presented for the monitoring system. Validation experiments confirmed the effectiveness of the online measurement system for bead geometry in layered additive manufacturing. (paper)

  4. Online phase measuring profilometry for rectilinear moving object by image correction

    Science.gov (United States)

    Yuan, Han; Cao, Yi-Ping; Chen, Chen; Wang, Ya-Pin

    2015-11-01

    In phase measuring profilometry (PMP), the object must be static for point-to-point reconstruction with the captured deformed patterns. While the object is rectilinearly moving online, the size and pixel position differences of the object in different captured deformed patterns do not meet the point-to-point requirement. We propose an online PMP based on image correction to measure the three-dimensional shape of the rectilinear moving object. In the proposed method, the deformed patterns captured by a charge-coupled diode camera are reprojected from the oblique view to an aerial view first and then translated based on the feature points of the object. This method makes the object appear stationary in the deformed patterns. Experimental results show the feasibility and efficiency of the proposed method.

  5. Online Vce measurement method for wear-out monitoring of high power IGBT modules

    DEFF Research Database (Denmark)

    Beczkowski, Szymon; Ghimire, Pramod; de Vega, Angel Ruiz

    2013-01-01

    A simple Vce online monitoring circuit is presented in this paper. It allows an accurate wear out prediction of IGBT modules, in high-power applications, during normal converter operation. Bipolar measurement allows monitoring of both IGBT and antiparallel diode. The circuit uses two serial...... offset due to diodes' forward voltage temperature dependency. Using four diodes one can monitor voltages on all power devices in a converter leg....

  6. On-line measurement and control in sustainable mineral processing and energy production

    International Nuclear Information System (INIS)

    Sowerby, B.D.

    2002-01-01

    Sustainable development can be defined as development that 'meets the needs of the present without compromising the ability of future generations to meet their own needs' (WCED, 1987). A sustainable minerals and energy industry will need to achieve a number of related objectives including greater energy efficiency, improved utilisation of ore deposits, improved utilisation of existing plant, improved product quality, reduction of waste material, reduction of pollution levels and improved safety margins. These objectives all relate in varying degrees to the triple bottom line of economic, social and environmental benefits. One critical component in achieving these objectives is to develop and apply improved control systems across the full range of industry applications from mining to processing and utilisation. However process control relies heavily on the availability of suitable on-line process instrumentation to provide the data and feedback necessary for its implementation. There is a lot of truth in the saying 'if you can't measure it you can't control it'. In the past measurement was achieved by manual sampling followed by sample preparation (such as drying, mixing, crushing and dividing) and off-line laboratory analysis. However this procedure is often subject to significant sampling errors and, most importantly, the measurements are too slow for control purposes. By contrast, on-line analysis can provide rapid and accurate measurement in real time thus opening up new possibilities for improved process control. As a result, there has been a rapid increase in the industrial application of on-line analysis instrumentation over the past few decades. The main purpose of this paper is to briefly review some past Australian developments of on-line analysis systems in the mineral and coal industries and to discuss present developments and future trends

  7. Measuring online learning systems success: applying the updated DeLone and McLean model.

    Science.gov (United States)

    Lin, Hsiu-Fen

    2007-12-01

    Based on a survey of 232 undergraduate students, this study used the updated DeLone and McLean information systems success model to examine the determinants for successful use of online learning systems (OLS). The results provided an expanded understanding of the factors that measure OLS success. The results also showed that system quality, information quality, and service quality had a significant effect on actual OLS use through user satisfaction and behavioral intention to use OLS.

  8. Modified thermogravimetric apparatus to measure magnetic susceptibility on-line during annealing of metastable ferromagnetic materials

    International Nuclear Information System (INIS)

    Luciani, G.; Constantini, A.; Branda, F.; Ausanio, G.; Hison, C.; Iannotti, V.; Luponio, C.; Lanotte, L.

    2004-01-01

    The insertion of proper coils to generate a magnetic field, with controlled gradient, in a standard thermogravimetric apparatus is shown to be a valid solution to measure on-line, upon heat treatment, the magnetic susceptibility in ribbon shaped samples of a metastable ferromagnetic material. The method is very useful to individuate the annealing conditions that optimise soft or hard magnetic properties without using separate apparatuses for heat treatment, control of the structural phase transition and characterization of magnetic susceptibility

  9. Online physician ratings fail to predict actual performance on measures of quality, value, and peer review.

    Science.gov (United States)

    Daskivich, Timothy J; Houman, Justin; Fuller, Garth; Black, Jeanne T; Kim, Hyung L; Spiegel, Brennan

    2018-04-01

    Patients use online consumer ratings to identify high-performing physicians, but it is unclear if ratings are valid measures of clinical performance. We sought to determine whether online ratings of specialist physicians from 5 platforms predict quality of care, value of care, and peer-assessed physician performance. We conducted an observational study of 78 physicians representing 8 medical and surgical specialties. We assessed the association of consumer ratings with specialty-specific performance scores (metrics including adherence to Choosing Wisely measures, 30-day readmissions, length of stay, and adjusted cost of care), primary care physician peer-review scores, and administrator peer-review scores. Across ratings platforms, multivariable models showed no significant association between mean consumer ratings and specialty-specific performance scores (β-coefficient range, -0.04, 0.04), primary care physician scores (β-coefficient range, -0.01, 0.3), and administrator scores (β-coefficient range, -0.2, 0.1). There was no association between ratings and score subdomains addressing quality or value-based care. Among physicians in the lowest quartile of specialty-specific performance scores, only 5%-32% had consumer ratings in the lowest quartile across platforms. Ratings were consistent across platforms; a physician's score on one platform significantly predicted his/her score on another in 5 of 10 comparisons. Online ratings of specialist physicians do not predict objective measures of quality of care or peer assessment of clinical performance. Scores are consistent across platforms, suggesting that they jointly measure a latent construct that is unrelated to performance. Online consumer ratings should not be used in isolation to select physicians, given their poor association with clinical performance.

  10. The online tourist fraud: the new measures of technological investigation in Spain

    Directory of Open Access Journals (Sweden)

    M.ª Belén AIGE

    2017-07-01

    Full Text Available The present article is about an examination of the new technological measures for the investigation, created by the Organic Act (Ley Orgánica 13/2015, of 5th of October. These measures will serve us to improve de criminal investigation, especially on those crimes that are done by technological means, but also for the traditional crimes. Specifically, we are going to make an especial reference to the tourist fraud, which affects both consumers and entrepreneurs. This fraud is especially notable in the online contracts, as we will see above, because those contracts have increased the number of online frauds in the last years; in the tourism I am referring to the stealing of personal data and the creation of ghost companies or non-existent offers. In first place, we are going to talk about the advantages and disadvantages of the online contracts, and also about the real necessity of new investigation means that finally have been satisfied with the introduction of the new technological measures of investigation, which we are going to analyse: the computerized undercover agent, the interception of the telematics and telephone communications, the recording of oral communications by electronic devices, the tracking, localization and recording images devices, the registry of mass storage devices and the remote registry of computer equipment. 

  11. Towards the development of a hybrid-integrated chip interferometer for online surface profile measurements

    International Nuclear Information System (INIS)

    Kumar, P.; Martin, H.; Jiang, X.

    2016-01-01

    Non-destructive testing and online measurement of surface features are pressing demands in manufacturing. Thus optical techniques are gaining importance for characterization of complex engineering surfaces. Harnessing integrated optics for miniaturization of interferometry systems onto a silicon wafer and incorporating a compact optical probe would enable the development of a handheld sensor for embedded metrology applications. In this work, we present the progress in the development of a hybrid photonics based metrology sensor device for online surface profile measurements. The measurement principle along with test and measurement results of individual components has been presented. For non-contact measurement, a spectrally encoded lateral scanning probe based on the laser scanning microscopy has been developed to provide fast measurement with lateral resolution limited to the diffraction limit. The probe demonstrates a lateral resolution of ∼3.6 μm while high axial resolution (sub-nanometre) is inherently achieved by interferometry. Further the performance of the hybrid tuneable laser and the scanning probe was evaluated by measuring a standard step height sample of 100 nm.

  12. FPGA-Based Smart Sensor for Online Displacement Measurements Using a Heterodyne Interferometer

    Science.gov (United States)

    Vera-Salas, Luis Alberto; Moreno-Tapia, Sandra Veronica; Garcia-Perez, Arturo; de Jesus Romero-Troncoso, Rene; Osornio-Rios, Roque Alfredo; Serroukh, Ibrahim; Cabal-Yepez, Eduardo

    2011-01-01

    The measurement of small displacements on the nanometric scale demands metrological systems of high accuracy and precision. In this context, interferometer-based displacement measurements have become the main tools used for traceable dimensional metrology. The different industrial applications in which small displacement measurements are employed requires the use of online measurements, high speed processes, open architecture control systems, as well as good adaptability to specific process conditions. The main contribution of this work is the development of a smart sensor for large displacement measurement based on phase measurement which achieves high accuracy and resolution, designed to be used with a commercial heterodyne interferometer. The system is based on a low-cost Field Programmable Gate Array (FPGA) allowing the integration of several functions in a single portable device. This system is optimal for high speed applications where online measurement is needed and the reconfigurability feature allows the addition of different modules for error compensation, as might be required by a specific application. PMID:22164040

  13. Towards the development of a hybrid-integrated chip interferometer for online surface profile measurements

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, P.; Martin, H.; Jiang, X. [EPSRC Centre for Innovative Manufacturing in Advanced Metrology, University of Huddersfield, Huddersfield HD1 3DH (United Kingdom)

    2016-06-15

    Non-destructive testing and online measurement of surface features are pressing demands in manufacturing. Thus optical techniques are gaining importance for characterization of complex engineering surfaces. Harnessing integrated optics for miniaturization of interferometry systems onto a silicon wafer and incorporating a compact optical probe would enable the development of a handheld sensor for embedded metrology applications. In this work, we present the progress in the development of a hybrid photonics based metrology sensor device for online surface profile measurements. The measurement principle along with test and measurement results of individual components has been presented. For non-contact measurement, a spectrally encoded lateral scanning probe based on the laser scanning microscopy has been developed to provide fast measurement with lateral resolution limited to the diffraction limit. The probe demonstrates a lateral resolution of ∼3.6 μm while high axial resolution (sub-nanometre) is inherently achieved by interferometry. Further the performance of the hybrid tuneable laser and the scanning probe was evaluated by measuring a standard step height sample of 100 nm.

  14. On-line tritium production and heat deposition rate measurements at the Lotus facility

    International Nuclear Information System (INIS)

    Joneja, O.P.; Scherrer, P.; Anand, R.P.

    1994-01-01

    Integral tritium production and heat deposition measurement in a prototype fusion blanket would enable verification of the computational codes and the data based employed for the calculations. A large number of tritium production rate measurements have been reported for different type of blankets, whereas the direct heat deposition due to the mixed radiation field in the fusion environment, is still in its infancy. In order to ascertain the kerma factors and the photon production libraries, suitable techniques must be developed to directly measure the nuclear heat deposition rates in the materials required for the fusion systems. In this context, at the Lotus facility, we have developed an extremely efficient double ionizing chamber, for the on-line tritium production measurements and employed a pure graphite calorimeter to measure the nuclear heat deposition due to the mixed radiation field of the 14 MeV, Haefely neutron generator. This paper presents both systems and some of the recent measurements. (authors). 8 refs., 13 figs

  15. Effectiveness of online simulation training: Measuring faculty knowledge, perceptions, and intention to adopt.

    Science.gov (United States)

    Kim, Sujeong; Park, Chang; O'Rourke, Jennifer

    2017-04-01

    Best practice standards of simulation recommend standardized simulation training for nursing faculty. Online training may offer an effective and more widely available alternative to in-person training. Using the Theory of Planned Behavior, this study evaluated the effectiveness of an online simulation training program, examining faculty's foundational knowledge of simulation as well as perceptions and intention to adopt. One-group pretest-posttest design. A large school of nursing with a main campus and five regional campuses in the Midwestern United States. Convenience sample of 52 faculty participants. Knowledge of foundational simulation principles was measured by pre/post-training module quizzes. Perceptions and the intention to adopt simulation were measured using the Faculty Attitudes and Intent to Use Related to the Human Patient Simulator questionnaire. There was a significant improvement in faculty knowledge after training and observable improvements in attitudes. Attitudes significantly influenced the intention to adopt simulation (B=2.54, p<0.001). Online simulation training provides an effective alternative for training large numbers of nursing faculty who seek to implement best practice of standards within their institutions. Copyright © 2016 Elsevier Ltd. All rights reserved.

  16. On-line adaptive line frequency noise cancellation from a nuclear power measuring channel

    Directory of Open Access Journals (Sweden)

    Qadir Javed

    2011-01-01

    Full Text Available On-line software for adaptively canceling 50 Hz line frequency noise has been designed and tested at Pakistan Research Reactor 1. Line frequency noise causes much problem in weak signals acquisition. Sometimes this noise is so dominant that original signal is totally corrupted. Although notch filter can be used for eliminating this noise, but if signal of interest is in close vicinity of 50 Hz, then original signal is also attenuated and hence overall performance is degraded. Adaptive noise removal is a technique which could be employed for removing line frequency without degrading the desired signal. In this paper line frequency noise has been eliminated on-line from a nuclear power measuring channel. The adaptive LMS algorithm has been used to cancel 50 Hz noise. The algorithm has been implemented in labVIEW with NI 6024 data acquisition card. The quality of the acquired signal has been improved much as can be seen in experimental results.

  17. On-line measurement of microwave power in ECR ion source

    International Nuclear Information System (INIS)

    Zhou Changgeng; Kang Wu; Hu Yonghong; Li Yan; Lou Benchao; Zu Xiulan; Xiong Riheng; Chen Junguang; Li Xiaoyun

    2005-01-01

    It is a new technology to apply an ECR ion source to the neutron generator. Because of the structure limitation, working state of the ECR ion source could not be judged by the color of gas discharging in discharge chamber. Therefore, it was hard to estimate if the ECR ion source was working properly in the neutron generator. The method to resolve the problem was described in this paper. The microwave power was measured on-line by a directional coupler and a small microwave power meter. The ion beam current could be educed from the measured incidence microwave power, and discharge state in discharge chamber could be determined. (authors)

  18. Performance of a fiber optic sensor for online measurement of coating thickness

    Science.gov (United States)

    D'Emilia, Giulio

    1999-01-01

    Some aspects concerning a methodology for the measurement of thickness of dry and wet coatings which is based on a fiber optic probe are discussed in order to verify the feasibility of this approach and the capability of such a probe of on- line measuring. In this preliminary step of the research some problems discussed mainly concerning the methodology which has been proposed and which is based on the measuring of the reflectance of the coating plated on thin steel sheets for use in the food industry. Furthermore the effect of the main interfering and modifying quantities is discussed both theoretically and experimentally when the measurement has to be carried out in order to allow on-line coating thickness measurements with satisfactory accuracy.

  19. Online measurements of non-organic components in flue gas; Online-maetning av oorganiska komponenter i roekgas

    Energy Technology Data Exchange (ETDEWEB)

    Niklasson, Fredrik; Claesson, Frida; Haraldsson, Conny

    2010-03-15

    an ICP-MS instrument can be used for on-line measurements of the concentrations of alkali metals in a flue gas, although further work should be addressed the design of the gas sampling line to avoid clogging by tar and fly ash particles

  20. Telecommunications Network Measurements of Online Gambling Behavior in Switzerland: A Feasibility Study.

    Science.gov (United States)

    Bitar, Raoul; Nordt, Carlos; Grosshans, Martin; Herdener, Marcus; Seifritz, Erich; Mutschler, Jochen

    2017-01-01

    Methodological shortcomings of gambling studies relying on self-report or on data sets derived from gambling operators tend to result in biased conclusions. The aim of this study was to analyze online gambling behavior using a novel network database approach. From October 13 to October 26, 2014, telecommunications network data from a major telecommunications provider in Switzerland were analyzed. Netflows between mobile devices and a poker operator were quantified to measure the gambling duration and session number. Time spent gambling during night and working hours was compared between devices with longest (red group), intermediate (orange group), and shortest gambling time (green group). Online gambling behavior differed depending on overall gambling time, F (2, 3,143). Night and working hours gambling was the highest in the red group (53%), compared to the orange (50.1%) and the green groups (41.5%). Post hoc analyses indicated significant differences between the orange and green groups (p social media use, and online pornography. © 2017 S. Karger AG, Basel.

  1. Study on on-Line Measurement and Controlling System of the Foundation Trench-Leveling Machine

    International Nuclear Information System (INIS)

    Yi, J G; Jiang, H Y; Xing, Y Z; Chen, J; Liu, J T

    2006-01-01

    Research the system software and hardware composing, the control mode, the online measurement and control principle based on the laser receiver and the inclination sensor as the signal source. After the laser receiver accepts the laser signal, the laser signal is carried through the light filter treatment so as to reduce the sunlight interference, and then amplified and modulated, last transmitted to the control unit. The inclination sensor adapts XWQJ02-01S, measure the slope angle the x and y verticality direction. The error adjusting range is ±0.05 0 . The separate time treatment avoids simultaneously adjusting the laser and inclination signal to each other interfere. The on-line measurement and control system realizes the parts to work on the plane that parallels with the datum plane of the laser beam scan. The trench-leveling machine must retain ±0.05 0 with the datum plane. Adapting the least square method to fit the linear curve, the movement trend of the work parts on the work plane is judged through the slope number. The test result shows that thought the combination measurement and control of the laser and slope angle the leveling precision are ±5mm/100. Its can satisfy with the construction criterion request

  2. Virtual sensors for on-line wheel wear and part roughness measurement in the grinding process.

    Science.gov (United States)

    Arriandiaga, Ander; Portillo, Eva; Sánchez, Jose A; Cabanes, Itziar; Pombo, Iñigo

    2014-05-19

    Grinding is an advanced machining process for the manufacturing of valuable complex and accurate parts for high added value sectors such as aerospace, wind generation, etc. Due to the extremely severe conditions inside grinding machines, critical process variables such as part surface finish or grinding wheel wear cannot be easily and cheaply measured on-line. In this paper a virtual sensor for on-line monitoring of those variables is presented. The sensor is based on the modelling ability of Artificial Neural Networks (ANNs) for stochastic and non-linear processes such as grinding; the selected architecture is the Layer-Recurrent neural network. The sensor makes use of the relation between the variables to be measured and power consumption in the wheel spindle, which can be easily measured. A sensor calibration methodology is presented, and the levels of error that can be expected are discussed. Validation of the new sensor is carried out by comparing the sensor's results with actual measurements carried out in an industrial grinding machine. Results show excellent estimation performance for both wheel wear and surface roughness. In the case of wheel wear, the absolute error is within the range of microns (average value 32 μm). In the case of surface finish, the absolute error is well below Ra 1 μm (average value 0.32 μm). The present approach can be easily generalized to other grinding operations.

  3. Online Measurement of LHC Beam Parameters with the ATLAS High Level Trigger

    CERN Document Server

    Strauss, E; The ATLAS collaboration

    2011-01-01

    We present an online measurement of the LHC beam parameters in ATLAS using the High Level Trigger (HLT). When a significant change is detected in the measured beamspot, it is distributed to the HLT. There, trigger algorithms like b-tagging which calculate impact parameters or decay lengths benefit from a precise, up-to-date set of beamspot parameters. Additionally, online feedback is sent to the LHC operators in real time. The measurement is performed by an algorithm running on the Level 2 trigger farm, leveraging the high rate of usable events. Dedicated algorithms perform a full scan of the silicon detector to reconstruct event vertices from registered tracks. The distribution of these vertices is aggregated across the farm and their shape is extracted through fits every 60 seconds to determine the beamspot position, size, and tilt. The reconstructed beam values are corrected for detector resolution effects, measured in situ using the separation of vertices whose tracks have been split into two collections....

  4. Online measurement of LHC beam parameters with the ATLAS High Level Trigger

    CERN Document Server

    Strauss, E; The ATLAS collaboration

    2011-01-01

    We present an online measurement of the LHC beam parameters in ATLAS using the High Level Trigger (HLT). When a significant change is detected in the measured beamspot, it is distributed to the HLT. There, trigger algorithms like b-tagging which calculate impact parameters or decay lengths benefit from a precise,up-to-date set of beamspot parameters. Additionally, online feedback is sent to the LHC operators in real time. The measurement is performed by an algorithm running on the Level 2 trigger farm, leveraging the high rate of usable events. Dedicated algorithms perform a full scan of the silicon detector to reconstruct event vertices from registered tracks. The distribution of these vertices is aggregated across the farm and their shape is extracted through fits every 60 seconds to determine the beamspot position, size, and tilt. The reconstructed beam values are corrected for detector resolution effects, measured in situ using the separation of vertices whose tracks have been split into two collections. ...

  5. Online participation in climate change adaptation: A case study of agricultural adaptation measures in Northern Italy.

    Science.gov (United States)

    Bojovic, Dragana; Bonzanigo, Laura; Giupponi, Carlo; Maziotis, Alexandros

    2015-07-01

    The new EU strategy on adaptation to climate change suggests flexible and participatory approaches. Face-to-face contact, although it involves time-consuming procedures with a limited audience, has often been considered the most effective participatory approach. In recent years, however, there has been an increase in the visibility of different citizens' initiatives in the online world, which strengthens the possibility of greater citizen agency. This paper investigates whether the Internet can ensure efficient public participation with meaningful engagement in climate change adaptation. In elucidating issues regarding climate change adaptation, we developed an eParticipation framework to explore adaptation capacity of agriculture to climate change in Northern Italy. Farmers were mobilised using a pre-existing online network. First they took part in an online questionnaire for revealing their perceptions of and reactions to the impacts of ongoing changes in agriculture. We used these results to suggest a portfolio of policy measures and to set evaluation criteria. Farmers then evaluated these policy options, using a multi criteria analysis tool with a simple user-friendly interface. Our results showed that eParticipation is efficient: it supports a rapid data collection, while involving high number of participants. Moreover, we demonstrated that the digital divide is decreasingly an obstacle for using online spaces for public engagement. This research does not present eParticipation as a panacea. Rather, eParticipation was implemented with well-established participatory approaches to both validate the results and, consequently, communicate meaningful messages on local agricultural adaptation practices to regional decision-makers. Feedbacks from the regional decision-makers showed their interest in using eParticipation to improve communication with farmers in the future. We expect that, with further Internet proliferation, eParticipation may allow the inclusion of

  6. Research and application of online measurement system of tire tread profile in automobile tire production

    Science.gov (United States)

    Wang, Pengyao; Chen, Xiangguang; Yang, Kai; Liu, Xuejiao

    2017-01-01

    To improve the measuring efficiency of width and thickness of tire tread in the process of automobile tire production, the actual condition for the tire production process is analyzed, and a fast online measurement system based on moving tire tread of tire specifications is established in this paper. The coordinate data of tire tread profile is acquired by 3D laser sensor, and we use C# language for programming which is an object-oriented programming language to complete the development of client program. The system with laser sensor can provide real-time display of tire tread profile and the data to require in the process of tire production. Experimental results demonstrate that the measuring precision of the system is <= 1mm, it can meet the measurement requirements of the production process, and the system has the characteristics of convenient installation and testing, system stable operation.

  7. Online In-Core Thermal Neutron Flux Measurement for the Validation of Computational Methods

    International Nuclear Information System (INIS)

    Mohamad Hairie Rabir; Muhammad Rawi Mohamed Zin; Yahya Ismail

    2016-01-01

    In order to verify and validate the computational methods for neutron flux calculation in RTP calculations, a series of thermal neutron flux measurement has been performed. The Self Powered Neutron Detector (SPND) was used to measure thermal neutron flux to verify the calculated neutron flux distribution in the TRIGA reactor. Measurements results obtained online for different power level of the reactor. The experimental results were compared to the calculations performed with Monte Carlo code MCNP using detailed geometrical model of the reactor. The calculated and measured thermal neutron flux in the core are in very good agreement indicating that the material and geometrical properties of the reactor core are modelled well. In conclusion one can state that our computational model describes very well the neutron flux distribution in the reactor core. Since the computational model properly describes the reactor core it can be used for calculations of reactor core parameters and for optimization of RTP utilization. (author)

  8. A CaS : Ce, Sm-based dosimeter for online dosimetry measurement

    International Nuclear Information System (INIS)

    Sun Yurun; Chen Zhaoyang; Fan Yanwei; Yan Shiyou; He Chengfa

    2011-01-01

    A film dosimeter based on optically stimulated luminescence (OSL) material of CaS : Ce, Sm was developed for online irradiation dosimetry measurement. The stimulation is provided by a laser with a wavelength of 980 nm, and the OSL luminescence is collected by a photodiode. Using 60 Co γ-rays, we investigated the dosimetry characteristic of the dosimeter at different dose rates and total doses. The real-time detection results showed that the OSL signals versus total ionizing dose exhibited a good linearity in a dose range of 0.1-185 Gy. (authors)

  9. Remote online process measurements by a fiber optic diode array spectrometer

    International Nuclear Information System (INIS)

    Van Hare, D.R.; Prather, W.S.; O'Rourke, P.E.

    1986-01-01

    The development of remote online monitors for radioactive process streams is an active research area at the Savannah River Laboratory (SRL). A remote offline spectrophotometric measurement system has been developed and used at the Savannah River Plant (SRP) for the past year to determine the plutonium concentration of process solution samples. The system consists of a commercial diode array spectrophotometer modified with fiber optic cables that allow the instrument to be located remotely from the measurement cell. Recently, a fiber optic multiplexer has been developed for this instrument, which allows online monitoring of five locations sequentially. The multiplexer uses a motorized micrometer to drive one of five sets of optical fibers into the optical path of the instrument. A sixth optical fiber is used as an external reference and eliminates the need to flush out process lines to re-reference the spectrophotometer. The fiber optic multiplexer has been installed in a process prototype facility to monitor uranium loading and breakthrough of ion exchange columns. The design of the fiber optic multiplexer is discussed and data from the prototype facility are presented to demonstrate the capabilities of the measurement system

  10. Mobile on-line working radioaerosol-measuring systems in Baden-Wuerttemberg

    International Nuclear Information System (INIS)

    Aures, R.; Wenzel, H.

    1998-01-01

    In Baden-Wuerttemberg eight on-line measuring radioaerosol monitoring stations are successfully working since a lot of years. These monitoring stations spread over the whole country give only a rough overview of the radiological situation in the environment after an event like the Chernobyl accident. But it is expensive to increase the number of the monitoring stations in this network. This is why the 'Landesanstalt fuer Umweltschutz Baden-Wuerttemberg' (LfU) got the order from the 'Ministerium fuer Umwelt und Verkehr Baden-Wuerttemberg' to conceive a mobile on-line working radioaerosol-measuring system for environmental measurements (MORAM). The LfU had made the plans and a company built up the first prototype. In action the MORAM should send every time automatically data of radioactivity in the air and datas of meteorology from its position to the controlling center in Karlsruhe. The MORAM works by remote control, needs little servicing and is independent from main connection. In case of a nuclear event several MORAMs could be used as a local monitoring network or they could increase the number of the radioaerosol monitoring stations for a certain time. Normally, the MORAMs will be storaged and are always ready for action. All the tests with the prototype 1 are finished in the meantime and the result of the tests is a new improved prototype 2, which can be used in the emergency case. This prototype was given to the LfU. (orig.) [de

  11. Online devices and measuring systems for the automatic control of newspaper printing

    Science.gov (United States)

    Marszalec, Elzbieta A.; Heikkila, Ismo; Juhola, Helene; Lehtonen, Tapio

    1999-09-01

    The paper reviews the state-of-the-art color measuring systems used for the control of newspaper printing. The printing process requirements are specified and different off-line and on-line color quality control systems, commercially available and under development, are evaluated. Recent market trends in newspaper printing are discussed based on the survey. The study was made on information derived from: conference proceedings (TAGA, IARIGAI, SPIE and IS&T), journals (American Printer, Applied Optics), discussions with experts (GMI, QTI, HONEYWELL, TOBIAS, GretagMacbeth), IFRA Expo'98/Quality Measuring Technologies, commercial brochures, and the Internet. On the background of this review, three different measuring principles, currently, under investigation at VTT Information Technology, are described and their applicability to newspaper printing is evaluated.

  12. Measuring the Impact of Online Evidence Retrieval Systems using Critical Incidents & Journey Mapping.

    Science.gov (United States)

    Westbrook, Johanna I; Coiera, Enrico W; Braithwaite, Jeffrey

    2005-01-01

    Online evidence retrieval systems are one potential tool in supporting evidence-based practice. We have undertaken a program of research to investigate how hospital-based clinicians (doctors, nurses and allied health professionals) use these systems, factors influencing use and their impact on decision-making and health care delivery. A central component of this work has been the development and testing of a broad range of evaluation techniques. This paper provides an overview of the results obtained from three stages of this evaluation and details the results derived from the final stage which sought to test two methods for assessing the integration of an online evidence system and its impact on decision making and patient care. The critical incident and journey mapping techniques were applied. Semi-structured interviews were conducted with 29 clinicians who were experienced users of the online evidence system. Clinicians were asked to described recent instances in which the information obtained using the online evidence system was especially helpful with their work. A grounded approach to data analysis was taken producing three categories of impact. The journey mapping technique was adapted as a method to describe and quantify clinicians' integration of CIAP into their practice and the impact of this on patient care. The analogy of a journey is used to capture the many stages in this integration process, from introduction to the system to full integration into everyday clinical practice with measurable outcomes. Transcribed interview accounts of system use were mapped against the journey stages and scored. Clinicians generated 85 critical incidents and one quarter of these provided specific examples of system use leading to improvements in patient care. The journey mapping technique proved to be a useful method for providing a quantification of the ways and extent to which clincians had integrated system use into practice, and insights into how information

  13. On-line fast flux measurements in the BR2 reactor

    International Nuclear Information System (INIS)

    Vermeeren, L.

    2009-01-01

    Since 2001, CEA-Cadarache and the Belgian Nuclear Research Centre SCK-CEN are collaborating on the development and in-pile qualification of subminiature fission chambers (diameter of 1.5 mm). Initially, efforts concentrated on fission chambers for the in-pile measurement of thermal fluxes (with 235 U as fissile material). Meanwhile successful long-term tests of the prototypes have been performed in various environments: in low temperature (40-100 degress Celsius) BR2 pool water (up to a thermal neutron fluence of 3 1 0 21 n/cm 2 ) and in the CALLISTO PWR loop (300 degrees Celsius, 155 bars). The long-term qualification of derived industrial detectors (Photonis CFUZ53) in CALLISTO is still ongoing. However, for various types of irradiations in research reactors, the knowledge of the evolution of the fast neutron flux is even of more interest than the thermal flux data. Therefore the collaboration program was extended to the development and the in-pile qualification of subminiature or miniature fission chambers (with 3 mm diameter) for fast neutron detection, for which 242 Pu was selected as the optimal fissile material. In order to achieve the on-line in-pile measurement of fast neutron flux, the fission chambers will be operated in the Campbelling mode (based on the mean square fluctuation of the detector current). In this mode the gamma induced contribution to the signal can be efficiently suppressed. Moreover, a data processing software will take into account the evolution of the fissile deposit in order to assess on-line the fast flux sensitivity and to correct for the low energy neutron contributions. The final objective is to qualify a Fast Neutron Detector System (FNDS) able to provide on-line data for local fast neutron fluxes in Material Testing Reactors. The on-line measurement of the fast neutron flux would contribute significantly to the characterization of the irradiation conditions during test experiments with materials and innovative fuel elements

  14. Development of 3D online contact measurement system for intelligent manufacturing based on stereo vision

    Science.gov (United States)

    Li, Peng; Chong, Wenyan; Ma, Yongjun

    2017-10-01

    In order to avoid shortcomings of low efficiency and restricted measuring range exsited in traditional 3D on-line contact measurement method for workpiece size, the development of a novel 3D contact measurement system is introduced, which is designed for intelligent manufacturing based on stereo vision. The developed contact measurement system is characterized with an intergarted use of a handy probe, a binocular stereo vision system, and advanced measurement software.The handy probe consists of six track markers, a touch probe and the associated elcetronics. In the process of contact measurement, the hand probe can be located by the use of the stereo vision system and track markers, and 3D coordinates of a space point on the workpiece can be mearsured by calculating the tip position of a touch probe. With the flexibility of the hand probe, the orientation, range, density of the 3D contact measurenent can be adptable to different needs. Applications of the developed contact measurement system to high-precision measurement and rapid surface digitization are experimentally demonstrated.

  15. Assessing segmentation processes by click detection: online measure of statistical learning, or simple interference?

    Science.gov (United States)

    Franco, Ana; Gaillard, Vinciane; Cleeremans, Axel; Destrebecqz, Arnaud

    2015-12-01

    Statistical learning can be used to extract the words from continuous speech. Gómez, Bion, and Mehler (Language and Cognitive Processes, 26, 212-223, 2011) proposed an online measure of statistical learning: They superimposed auditory clicks on a continuous artificial speech stream made up of a random succession of trisyllabic nonwords. Participants were instructed to detect these clicks, which could be located either within or between words. The results showed that, over the length of exposure, reaction times (RTs) increased more for within-word than for between-word clicks. This result has been accounted for by means of statistical learning of the between-word boundaries. However, even though statistical learning occurs without an intention to learn, it nevertheless requires attentional resources. Therefore, this process could be affected by a concurrent task such as click detection. In the present study, we evaluated the extent to which the click detection task indeed reflects successful statistical learning. Our results suggest that the emergence of RT differences between within- and between-word click detection is neither systematic nor related to the successful segmentation of the artificial language. Therefore, instead of being an online measure of learning, the click detection task seems to interfere with the extraction of statistical regularities.

  16. Metrological traceability in education: A practical online system for measuring and managing middle school mathematics instruction

    Science.gov (United States)

    Torres Irribarra, D.; Freund, R.; Fisher, W.; Wilson, M.

    2015-02-01

    Computer-based, online assessments modelled, designed, and evaluated for adaptively administered invariant measurement are uniquely suited to defining and maintaining traceability to standardized units in education. An assessment of this kind is embedded in the Assessing Data Modeling and Statistical Reasoning (ADM) middle school mathematics curriculum. Diagnostic information about middle school students' learning of statistics and modeling is provided via computer-based formative assessments for seven constructs that comprise a learning progression for statistics and modeling from late elementary through the middle school grades. The seven constructs are: Data Display, Meta-Representational Competence, Conceptions of Statistics, Chance, Modeling Variability, Theory of Measurement, and Informal Inference. The end product is a web-delivered system built with Ruby on Rails for use by curriculum development teams working with classroom teachers in designing, developing, and delivering formative assessments. The online accessible system allows teachers to accurately diagnose students' unique comprehension and learning needs in a common language of real-time assessment, logging, analysis, feedback, and reporting.

  17. Metrological traceability in education: A practical online system for measuring and managing middle school mathematics instruction

    International Nuclear Information System (INIS)

    Irribarra, D Torres; Freund, R; Fisher, W; Wilson, M

    2015-01-01

    Computer-based, online assessments modelled, designed, and evaluated for adaptively administered invariant measurement are uniquely suited to defining and maintaining traceability to standardized units in education. An assessment of this kind is embedded in the Assessing Data Modeling and Statistical Reasoning (ADM) middle school mathematics curriculum. Diagnostic information about middle school students' learning of statistics and modeling is provided via computer-based formative assessments for seven constructs that comprise a learning progression for statistics and modeling from late elementary through the middle school grades. The seven constructs are: Data Display, Meta-Representational Competence, Conceptions of Statistics, Chance, Modeling Variability, Theory of Measurement, and Informal Inference. The end product is a web-delivered system built with Ruby on Rails for use by curriculum development teams working with classroom teachers in designing, developing, and delivering formative assessments. The online accessible system allows teachers to accurately diagnose students' unique comprehension and learning needs in a common language of real-time assessment, logging, analysis, feedback, and reporting

  18. Business in the Hands of Consumers: A Scale for Measuring Online Resale Motivations

    Directory of Open Access Journals (Sweden)

    Myriam ERTZ

    2016-12-01

    Full Text Available The web channel is increasingly a central aspect of the second-hand economy and, as such, favours also more sustainable post-consumption processes. This is why the field of online reselling appears increasingly important. Besides, the ever broadening scope of online reselling is key to the success of new online intermediaries that position themselves in the broader movement of collaborative consumption. While, consumers’ attachment for secondhand exchanges is not new, they have largely embraced its online declination. In response to these evolutions in the online retail environment, traditional retail companies have therefore started to create online consumer marketplaces in which consumers exchange goods by themselves. In order to best adapt such online marketplaces to consumers, it is therefore critically important to gain a better understanding of the driving forces behind online reselling. At present, knowledge about what motivates consumers to resell products online is limited. This article outlines the development and validation process of an online resale motivation (ORM scale via three studies involving 1,119 respondents. Study 1 presents the ORM scale development process and resulting multi-dimensional construct, including protester, economic, generative, recreational, practical and social facets. Study 2 replicates the scale and investigates its predictive capabilities. More specifically, the ORM scale predicts successfully online resale frequency. Consumers who are more highly motivated to resell online, will indeed resell more often online. Study 3 examines the mediating role of ORM on the relationship between planned resale intentions (PRI and online resale behaviour. The fact that consumers plan to resell a product prior to its purchase, will not directly lead them to increase the frequency at which they resell online. Rather, it is because they perceive positive economic, practical and recreational outcomes associated with

  19. Solving of some Problems with On-Line Mode Measurement of Partial Discharges

    Directory of Open Access Journals (Sweden)

    Karel Zalis

    2004-01-01

    Full Text Available This paper deals with the problems discussing the transition from off-line diagnostic methods to on-line ones. Based on the experience with commercial partial discharge measuring equipment a new digital system for the evaluation of partial discharge measurement including software and hardware facilities has been developed at the Czech Technical University in Prague. Two expert systems work in this complex evaluating system: a rule-based expert system performing an amplitude analysis of partial discharge impulses for determining the damage of the insulation system, and a neural network which is used for a phase analysis of partial discharge impulses to determine the kind of partial discharge activity. Problem of the elimination of disturbances is also discussed.

  20. Measuring Teachers and Learners' Perceptions of the Quality of Their Online Learning Experience

    Science.gov (United States)

    Gómez-Rey, Pilar; Barbera, Elena; Fernández-Navarro, Francisco

    2016-01-01

    This article explores the quality of the online learning experience based on the Sloan-C framework and the Online Learning Consortium's (OLC) quality scorecard. The OLC index has been implemented to evaluate quality in online programs from different perspectives. Despite this, the opinions of learners are ignored, and it is built using feedback…

  1. Establishment of X-ray Measurement System for On-line Monitoring of Water Content in Powder

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, J. S. [Korea Institute of Industrial Technology, Cheonan (Korea, Republic of); Choi, Y. S. [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Choi, B. J. [Idealsystem Co., Daegu (Korea, Republic of)

    2012-05-15

    On-line process monitoring is of critical importance in many industries, and therefore a variety of the state-of-the-art physical and chemical measurement techniques have been proposed. But, these techniques have their own pros and cons under the field process environments. Because the field process environments are very different from the well-organized chemical laboratories, many factors should be considered in order to optimize the process monitoring system. However, there have been few studies on the on-line measurement of water content in powder materials. For that reason, the X-ray measurement system based on the X-ray scattering technique, which was first proposed in 2011 as a new method for the determination of water content in powder, has been improved. in the present study, our original X-ray measurement system has been modified for more rapid, simple, and adequate for maximizing the field applicability of the on-line monitoring system

  2. Online Advertising

    OpenAIRE

    Goldfarb, Avi; Tucker, Catherine Elizabeth

    2011-01-01

    This chapter explores what makes online advertising different from traditional advertising channels. We argue that online advertising differs from traditional advertising channels in two important ways: measurability and targetability. Measurability is higher because the digital nature of online advertising means that responses to ads can be tracked relatively easily. Targetability is higher because data can be automatically tracked at an individual level, and it is relatively easy to show di...

  3. Natural gas large volumes measurement: going for on-line custody transfer; Medicao de grandes volumes de gas natural: rumo a transferencia de custodia on-line

    Energy Technology Data Exchange (ETDEWEB)

    Mercon, Eduardo G.; Frisoli, Caetano [PETROBRAS Transporte S.A. (TRANSPETRO), Rio de Janeiro, RJ (Brazil)

    2005-07-01

    This paper describes the structure of the natural gas flow measurement process in TRANSPETRO, and comments features and performance of existing or under-implantation equipment and systems, reviewing best practices and technology in use. This process runs through three interrelated segments: data flow measurement, strictly speaking; data transfer and acquisition; and data flow measurement certification (data consolidation to invoice). Initially, the work makes an approach to the data flow measurement segment, evaluating technical features of flow meters, and describing configurations and functions of the operating gas flow computers in TRANSPETRO's custody transfer stations. In this part it will also be presented the implantation of TRANSPETRO's system for gas chromatography data input on-line to flow computers. Further, in data transfer and acquisition, SCADA system technical aspects will be evaluated, considering communications protocols and programmable logic controllers functions in remote terminal units, and discussing their places in the measurement process. Additionally, TRANSPETRO's experience in data measurement certification tools is in discussion, as well as new upcoming tools and their potential features, from what new practices will be suggested. Finally, all the work has been conceived and carried out always aiming to the state-of-the-art technology in gas flow measurement: on-line custody transfer. (author)

  4. In core instrumentation for online nuclear heating measurements of material testing reactor

    International Nuclear Information System (INIS)

    Reynard, C.; Andre, J.; Brun, J.; Carette, M.; Janulyte, A.; Merroun, O.; Zerega, Y.; Lyoussi, A.; Bignan, G.; Chauvin, J-P.; Fourmentel, D.; Glayse, W.; Gonnier, C.; Guimbal, P.; Iracane, D.; Villard, J.-F.

    2010-01-01

    The present work focuses on nuclear heating. This work belongs to a new advanced research program called IN-CORE which means 'Instrumentation for Nuclear radiations and Calorimetry Online in REactor' between the LCP (University of Provence-CNRS) and the CEA (French Atomic Energy Commission) - Jules Horowitz Reactor (JHR) program. This program started in September 2009 and is dedicated to the conception and the design of an innovative mobile experimental device coupling several sensors and ray detectors for on line measurements of relevant physical parameters (photonic heating, neutronic flux ...) and for an accurate parametric mapping of experimental channels in the JHR Core. The work presented below is the first step of this program and concerns a brief state of the art related to measurement methods of nuclear heating phenomena in research reactor in general and MTR in particular. A special care is given to gamma heating measurements. A first part deals with numerical codes and models. The second one presents instrumentation divided into various kinds of sensor such as calorimeter measurements and gamma ionization chamber measurements. Their basic principles, characteristics such as metrological parameters, operating mode, disadvantages/advantages, ... are discussed. (author)

  5. On-line dry wood measurement in chips by nuclear means

    International Nuclear Information System (INIS)

    Oftedal, E.

    1978-01-01

    A system which has been installed and operating for two years in a Norwegian paper mill is described. It consists of a radiometric conveyor belt weighing instrument, a radiometric moisture guage and a data processor. The weighing instrument uses a cesium 137 source located above the conveyor belt with the radiation detector under the belt. The moisture gauge employs an americium-beryllium neutron source and a slow neutron detector, both placed above the belt. The data is processed and the moisture content calculated is continuously displayed. 4 analogue outputs are also available for automatic on-line process control. The results over a period of 20 months are shown, compared with results from laboratory measurements of samples. The two curves follow each other fairly closely. (JIW)

  6. Advanced power cycling test for power module with on-line on-state VCE measurement

    DEFF Research Database (Denmark)

    Choi, Ui-min; Trintis, Ionut; Blaabjerg, Frede

    2015-01-01

    module. The proposed concept can perform various stress conditions which is valid in a real mission profile and it is using a real power converter application with small loss. The concept of the proposed test setup is first presented. Then, the on-line on-state collector-emitter voltage VCE measurement......Recent research has made an effort to improve the reliability of power electronic systems to comply with more stringent constraints on cost, safety, predicted lifetime and availability in many applications. For this, studies about failure mechanisms of power electronic components and lifetime...... estimation of power semiconductor devices and capacitors have been done. Accelerated power cycling test is one of the common tests to assess the power device module and develop the lifetime model considering the physics of failure. In this paper, a new advanced power cycling test setup is proposed for power...

  7. Expert System Development on On-line Measurement of Sewage Treatment Based Process

    Directory of Open Access Journals (Sweden)

    Jianjun QIN

    2014-02-01

    Full Text Available This article puts forward a solution in which an instrument on-line automatic measurement and expert system process are optimized according to the complexity and great process dynamics of sewage treatment process. Firstly modeling has been set up with configuration sewage treatment process in which the process has been integrated into the computer software environment. Secondly certain number of water quality automatic monitoring instruments and sensor probes are set in the reaction tanks according to the needs of process changes and management. The data information acquired can be displayed and recorded at the real time. A human-machine integration expert system featuring computer automation management is developed for the base by one-off method thus to realize the intelligent and unmanned management. The advantages brought about from it can fill up the inexperience of the on-site management personnel and solve the contradiction between the water quality dynamics and difficulty in the process adjustment.

  8. An evaluation of measurement uncertainties in the on-line measurement of coal ash content by gamma-ray transmission

    International Nuclear Information System (INIS)

    Wenzhong, Liu; Li, Kong; Tan, Qu; Jingjing, Cheng

    2002-01-01

    In this paper, a significant effect producing systematic errors in the on-line measurement using gamma-ray transmission is revealed. Ash content fluctuations or thickness changes lead to a permanent negative systematic error in the results of the measurements. To study uncertainties in the measurements applicable to time-independent ash content indicators and to investigate the characteristics of the radiation attenuation process, the behavior of the quantity in question is modeled with a stationary Gaussian distribution. A systematic error-producing effect has been found, and a quantitative correction is given to compensate for it. For some other quantities in question that vary in time, a linear model is used to discuss the systematic errors in the case of automated coal gangue separator. Results of experiments that demonstrate different systematic errors for different sampling intervals are presented. The reason for these errors is the nonlinearity of the relationship between the radiation intensity, on the one hand, and the sample thickness and mass attention, on the other

  9. On-line measurement of ski-jumper trajectory: combining stereo vision and shape description

    Science.gov (United States)

    Nunner, T.; Sidla, O.; Paar, G.; Nauschnegg, B.

    2010-01-01

    Ski jumping has continuously raised major public interest since the early 70s of the last century, mainly in Europe and Japan. The sport undergoes high-level analysis and development, among others, based on biodynamic measurements during the take-off and flight phase of the jumper. We report on a vision-based solution for such measurements that provides a full 3D trajectory of unique points on the jumper's shape. During the jump synchronized stereo images are taken by a calibrated camera system in video rate. Using methods stemming from video surveillance, the jumper is detected and localized in the individual stereo images, and learning-based deformable shape analysis identifies the jumper's silhouette. The 3D reconstruction of the trajectory takes place on standard stereo forward intersection of distinct shape points, such as helmet top or heel. In the reported study, the measurements are being verified by an independent GPS measurement mounted on top of the Jumper's helmet, synchronized to the timing of camera exposures. Preliminary estimations report an accuracy of +/-20 cm in 30 Hz imaging frequency within 40m trajectory. The system is ready for fully-automatic on-line application on ski-jumping sites that allow stereo camera views with an approximate base-distance ratio of 1:3 within the entire area of investigation.

  10. On-line velocity measurements using phase probes at the SuperHILAC

    International Nuclear Information System (INIS)

    Feinberg, B.; Meaney, D.; Thatcher, R.; Timossi, C.

    1987-12-01

    Phase probes have been placed in several external beam lines at the LBL heavy ion linear accelerator (SuperHILAC) to provide non- destructive velocity measurements independent of the ion being accelerated. The system uses three probes in each line to obtain accurate velocity measurements at all beam energies. Automatic gain control and signal analysis are performed so that the energy/nucleon along with up to three probe signals are displayed on a vector graphics display with a refresh rate better than twice per second. The system uses a sensitive pseudo-correlation technique to pick out the signal from the noise, features simultaneous measurements of up to four ion velocities when more than one beam is being accelerated, and is controlled by a touch-screen operator interface. It is accurate to within /+-/0.25% and has provisions for on-line calibration tests. The phase probes thus provide a velocity measurement independent of the mass defect associated with the use of crystal detectors, which can become significant for heavy elements. They are now used as a routine tuning aid to ensure proper bunch structure, and as a beam velocity monitor. 3 refs., 5 figs

  11. On-line measurement of mechanical, optical properties and roughness parameters

    Directory of Open Access Journals (Sweden)

    Hartman, H.

    2005-12-01

    Full Text Available On-line measurements become a central importance for the control of production line output. The target is to replace traditional single local destructive quality checks by a continuous survey of the product properties. Other traditional like pyrometric temperature measurements suffer of well-known but non-soluble weakness points. New methods need the unambiguous correlation with the results of traditional testing to be representative for valid proof standards.EKO Stahl GmbH introduces several methods of on-line measurements focused actually on temperature measurement means of FTIR-Spectrometer, prediction of the mechanical properties of steel strips using the information of residual magnetization after a magnetization pulse and optical roughness measurements. The correlation between the results of the new methods and the classical proof processes has been established in a satisfactory manner.

    Las medidas on line van tomando una importancia central para el control de la calidad de la producción . El objetivo es reemplazar las pruebas destructivas puntuales tradicionales por un control continuo de las características del producto. Otros métodos tradicionales, como la medida de la temperatura con pirómetros, adolecen de conocidos pero insolubles puntos débiles. Los nuevos métodos necesitan la correlación inequívoca con los resultados de los métodos corrientes clásicos para obtener la autoridad de un estándar de prueba. La EKO Stahl GmbH ha introducido varios métodos de medidas on line y actualmente concentrados en la medida de la temperatura con espectrómetro FTIR, predicción de las características mecánicas usando la información del magnetismo residual, a partir de un impulso magnético inicial así como la medida óptica de la rugosidad. La correlación entre los resultados de los nuevos métodos y los métodos clásicos ha quedado establecida de manera satisfactoria.

  12. Artificial Fruit: Postharvest Online Monitoring of Agricultural Food by Measuring Humidity and Temperature

    Science.gov (United States)

    Hübert, T.; Lang, C.

    2012-09-01

    An online monitoring of environmental and inherent product parameters is required during transportation and storage of fruit and vegetables to avoid quality degradation and spoilage. The control of transpiration losses is suggested as an indicator for fruit freshness by humidity measurements. For that purpose, an electronic sensor is surrounded by a wet porous fiber material which is in contact with the outer atmosphere. Transpiration reduces the water content of the porous material and thus also the internal water activity. The sensor system, known as "artificial fruit," measures the relative humidity and temperature inside the wet material. Humidity and temperature data are collected and transmitted on demand by a miniaturized radio communication unit. The decrease in the measured relative humidity has been calibrated against the mass loss of tomatoes under different external influencing parameters such as temperature, humidity, and air flow. Current battery life allows the sensor system, embedded in a fruit crate, to transmit data on transpiration losses via radio transmission for up to two weeks.

  13. On-line measurement of oil contaminants in water by filter-based infrared analyzers

    International Nuclear Information System (INIS)

    Niemelae, P.

    1994-01-01

    The properties of a dedicated infrared analyzer for on-line measurement of the oil content of water, the Oili analyzer, are evaluated theoretically and with laboratory measurements. The analyzer was originally developed for controlling the discharge of ballast and bilge water from oil tankers and more than 200 such instruments have now been supplied for that purpose, representing about 10 % of the total market. Some technical improvements are suggested, and the improved instrument is shown to be capable of measuring oil in water to an accuracy of +- 20 % down to a detection limit of +5-10 ppm in the presence of high concentrations of interfering components and under varying environmental conditions. This opens up new potential applications for the instrument, e.g. the monitoring of water discharges from oil and gas production platforms. The infrared analyzer responds only to the dispersed oil fraction, and if the dissolved fraction is of interest as well, the instrument must be equipped with a UV option, as suggested here

  14. The Corrosion Inhibition Characteristics of Sodium Nitrite Using an On-line Corrosion Rate Measurement System

    International Nuclear Information System (INIS)

    Park, Mal-Yong; Kang, Dae-Jin; Moon, Jeon-Soo

    2015-01-01

    An on-line corrosion rate measurement system was developed using a personal computer, a data acquisition board and program, and a 2-electrode corrosion probe. Reliability of the developed system was confirmed with through comparison test. With this system, the effect of sodium nitrite (NaNO 2 ) as a corrosion inhibitor were studied on iron and aluminum brass that were immersed in sodium chloride (NaCl) solution. Corrosion rate was measured based on the linear polarization resistance method. The corrosion rates of aluminum brass and iron in 1% NaCl solutions were measured to be 0.290 mm per year (mmpy) and 0.2134 mmpy, respectively. With the addition of 200 ppm of NO 2 - , the corrosion rates decreased to 0.0470 mmpy and 0.0254 mmpy. The addition of NO 2 - caused a decrease in corrosion rates of both aluminum brass and iron, yet the NO 2 - acted as a more effective corrosion inhibitor for iron. than aluminum brass

  15. Carbon and Hydrogen Isotope Measurements of Alcohols and Organic Acids by Online Pyroprobe-GC-IRMS

    Science.gov (United States)

    Socki, Richard A.; Fu, Qi; Niles, Paul B.; Gibson, Everett K., Jr.

    2012-01-01

    The detection of methane in the atmosphere of Mars, combined with evidence showing widespread water-rock interaction during martian history, suggests that the production of methane on Mars may be the result of mineral surface-catalyzed CO2 and or CO reduction during Fisher-Tropsch Type (FTT) reactions. A better understanding of these reaction pathways and corresponding C and H isotope fractionations is critical to deciphering the synthesis of organic compounds produced under abiotic hydrothermal conditions. Described here is a technique for the extraction and analysis of both C and H isotopes from alcohols (C1-C4) and organic acids (C1-C6). This work is meant to provide a "proof of concept" for making meaningful isotope measurements on complex mixtures of solid-phase hydrocarbons and other intermediary products produced during high-temperature and high-pressure synthesis on mineral-catalyzed surfaces. These analyses are conducted entirely "on-line" utilizing a CDS model 5000 Pyroprobe connected to a Thermo Trace GC Ultra that is interfaced with a Thermo MAT 253 isotope ratio mass spectrometer operating in continuous flow mode. Also, this technique is designed to carry a split of the GC-separated product to a DSQ II quadrupole mass spectrometer as a means of making semi-quantitative compositional measurements. Therefore, both chemical and isotopic measurements can be carried out on the same sample.

  16. A comparison of emission calculations using different modeled indicators with 1-year online measurements.

    Science.gov (United States)

    Lengers, Bernd; Schiefler, Inga; Büscher, Wolfgang

    2013-12-01

    The overall measurement of farm level greenhouse gas (GHG) emissions in dairy production is not feasible, from either an engineering or administrative point of view. Instead, computational model systems are used to generate emission inventories, demanding a validation by measurement data. This paper tests the GHG calculation of the dairy farm-level optimization model DAIRYDYN, including methane (CH₄) from enteric fermentation and managed manure. The model involves four emission calculation procedures (indicators), differing in the aggregation level of relevant input variables. The corresponding emission factors used by the indicators range from default per cow (activity level) emissions up to emission factors based on feed intake, manure amount, and milk production intensity. For validation of the CH₄ accounting of the model, 1-year CH₄ measurements of an experimental free-stall dairy farm in Germany are compared to model simulation results. An advantage of this interdisciplinary study is given by the correspondence of the model parameterization and simulation horizon with the experimental farm's characteristics and measurement period. The results clarify that modeled emission inventories (2,898, 4,637, 4,247, and 3,600 kg CO₂-eq. cow(-1) year(-1)) lead to more or less good approximations of online measurements (average 3,845 kg CO₂-eq. cow(-1) year(-1) (±275 owing to manure management)) depending on the indicator utilized. The more farm-specific characteristics are used by the GHG indicator; the lower is the bias of the modeled emissions. Results underline that an accurate emission calculation procedure should capture differences in energy intake, owing to milk production intensity as well as manure storage time. Despite the differences between indicator estimates, the deviation of modeled GHGs using detailed indicators in DAIRYDYN from on-farm measurements is relatively low (between -6.4% and 10.5%), compared with findings from the literature.

  17. Method for online measurement of the CHON composition of raw gas from biomass gasifier

    International Nuclear Information System (INIS)

    Neves, Daniel; Thunman, Henrik; Tarelho, Luís; Larsson, Anton; Seemann, Martin; Matos, Arlindo

    2014-01-01

    Highlights: • Measuring the CHON composition of a raw gas by current methods is challenging. • An alternative method is to burn the raw gas before measuring the CHON composition. • The CHON contents of the raw gas can be accurately measured by the alternative method. • Measuring the CHON contents of the raw gas is now performed in a “one-step” analysis. • The new method is used to evaluate the operation of a dual fluidised bed gasifier. - Abstract: For unattended biomass gasification processes, rapid methods for monitoring the elemental composition (CHON) of the raw gas leaving the gasifier are needed. Conventional methods rely on time-consuming and costly laboratory procedures for analysing the condensable part of the raw gas. An alternative method, presented in this work, assesses the CHON composition of raw gas in a “one step” analysis without the need to previously characterise its chemical species composition. Our method is based on the quantitative conversion of a raw gas of complex chemical composition into CO 2 , H 2 O, and N 2 in a small combustor. The levels of these simple species can be measured with high accuracy and good time resolution, and the CHON composition of the raw gas can be determined from the mass balance across the combustor. To evaluate this method, an online combustion facility was built and used to analyse the raw gas from the Chalmers 2-MW th dual fluidised bed steam gasifier. Test runs of the developed facility demonstrated complete combustion of the raw gas and the measurements were both fast and reliable. The new method used in combination with zero-dimensional reactor modelling provides valuable data for the operational monitoring of gasification processes, such as the degree of fuel conversion, composition of the char exiting the gasifier, oxygen transport by catalytic bed material, and amount of condensables in raw gas

  18. Measuring the Customer Experience in Online Environments: A Structural Modeling Approach

    OpenAIRE

    Thomas P. Novak; Donna L. Hoffman; Yiu-Fai Yung

    2000-01-01

    Intuition and previous research suggest that creating a compelling online environment for Web consumers will have numerous positive consequences for commercial Web providers. Online executives note that creating a compelling online experience for cyber customers is critical to creating competitive advantage on the Internet. Yet, very little is known about the factors that make using the Web a compelling experience for its users, and of the key consumer behavior outcomes of this compelling exp...

  19. Light scattering and transmission measurement using digital imaging for online analysis of constituents in milk

    Science.gov (United States)

    Jain, Pranay; Sarma, Sanjay E.

    2015-05-01

    Milk is an emulsion of fat globules and casein micelles dispersed in an aqueous medium with dissolved lactose, whey proteins and minerals. Quantification of constituents in milk is important in various stages of the dairy supply chain for proper process control and quality assurance. In field-level applications, spectrophotometric analysis is an economical option due to the low-cost of silicon photodetectors, sensitive to UV/Vis radiation with wavelengths between 300 - 1100 nm. Both absorption and scattering are witnessed as incident UV/Vis radiation interacts with dissolved and dispersed constituents in milk. These effects can in turn be used to characterize the chemical and physical composition of a milk sample. However, in order to simplify analysis, most existing instrument require dilution of samples to avoid effects of multiple scattering. The sample preparation steps are usually expensive, prone to human errors and unsuitable for field-level and online analysis. This paper introduces a novel digital imaging based method of online spectrophotometric measurements on raw milk without any sample preparation. Multiple LEDs of different emission spectra are used as discrete light sources and a digital CMOS camera is used as an image sensor. The extinction characteristic of samples is derived from captured images. The dependence of multiple scattering on power of incident radiation is exploited to quantify scattering. The method has been validated with experiments for response with varying fat concentrations and fat globule sizes. Despite of the presence of multiple scattering, the method is able to unequivocally quantify extinction of incident radiation and relate it to the fat concentrations and globule sizes of samples.

  20. Increasing of MERARG experimental performances: on-line fission gas release measurement by mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Pontillon, Y.; Capdevila, H.; Clement, S. [CEA, DEN, DEC, SA3C, LAMIR, F-13108 Saint Paul lez Durance, (France); Guigues, E.; Janulyte, A.; Zerega, Y.; Andre, J. [Aix-Marseille Universite, LISA EA 4672, 13397 MARSEILLE cedex 20, (France)

    2015-07-01

    The MERARG device - implemented at the LECASTAR Hot Laboratory, at the CEA Cadarache - allows characterizing nuclear fuels with respect to the behaviour of fission gases during thermal transients representative of normal or off normal operating nuclear power plant conditions. The fuel is heated in order to extract a part or the total gas inventory it contains. Fission Gas Release (FGR) is actually recorded by mean of both on-line gamma spectrometry station and micro gas chromatography. These two devices monitor the quantity and kinetics of fission gas release rate. They only address {sup 85}Kr radioactive isotope and the elemental quantification of Kr, Xe and He (with a relatively low detection limit in the latter case, typically 5-10 ppm). In order to better estimate the basic mechanisms that promote fission gas release from irradiated nuclear fuels, the CEA fuel study department decided to improve its experimental facility by modifying MERARG to extend the studies of gamma emitter fission gases to all gases (including Helium) with a complete isotopic distribution capability. To match these specifications, a Residual Gas Analyser (RGA) has been chosen as mass spectrometer. This paper presents a review of the main aspects of the qualification/calibration phase of the RGA type analyser. In particular, results recorded over three mass ranges 1-10 u, 80-90 u and 120-140 u in the two classical modes of MERARG, i.e. on-line and off-line measurements are discussed. Results obtained from a standard gas bottle show that the quantitative analysis at a few ppm levels can be achieved for all isotopes of Kr and Xe, as well as masses 2 and 4 u. (authors)

  1. A novel methodology for online measurement of thoron using Lucas scintillation cell

    International Nuclear Information System (INIS)

    Eappen, K.P.; Sapra, B.K.; Mayya, Y.S.

    2007-01-01

    The use of Lucas scintillation cell (LSC) technique for thoron estimation requires a modified methodology as opposed to radon estimation. While in the latter, the α counting is performed after a delay period varying between few hours to few days, in the case of thoron estimation the α counting has to be carried out immediately after sampling owing to the short half-life of thoron (55 s). This can be achieved best by having an on-line LSC sampling and counting system. However, half-life of the thoron decay product 212 Pb being 10.6 h, the background accumulates in LSC during online measurements and hence subsequent use of LSC is erroneous unless normal background level is achieved in the cell. This problem can be circumvented by correcting for the average background counts accumulated during the counting period which may be theoretically estimated. In this study, a methodology has been developed to estimate the true counts due to thoron. A linear regression between the counts obtained experimentally and the fractional decay in regular intervals of time is used to obtain the actual thoron concentration. The novelty of this approach is that the background of the cell is automatically estimated as the intercept of the regression graph. The results obtained by this technique compare well with the two filter method and the thoron concentration produced from a standard thoron source. However, the LSC as such cannot be used for environmental samples because the minimum detection level is comparable with that of thoron concentrations prevailing in normal atmosphere

  2. Development and application of an on-line tritium production rate measuring method

    International Nuclear Information System (INIS)

    Yamaguchi, Seiya

    1989-06-01

    A highly sensitive on-line method for measuring the tritium production rate (TPR) of 6 Li was developed using the response difference of 6 Li and 7 Li-glass scintillators in a mixed neutron-gamma radiation field. A fitting method for subtracting the pulse height spectrum of 7 Li-glass from that of 6 Li-glass was introduced. The contribution of competing reactions such as 6 Li (n, n 'd) 4 He was estimated by kinematical analyses. An absolute value of the 6 Li content was determined by a chemical analysis. The thermal flux perturbation due to 6 Li-glass of various thickness and 6 Li contents was evaluated by measurement in a thermal neutron field and calculation by the modified Skyrme theory. A Monte Carlo calculation of the self-shielding effect was also made. The dependence of the self-shielding on neutron energy was examined by this Monte Carlo code. The edge effect, i.e., distortion of the pulse height spectrum due to partial energy deposition of the alpha and/or the triton, was investigated by measurement in a thermal neutron field and by a Monte Carlo simulation that was based on the scintillation mechanism and considered Bragg absorption and the ratio of contributions to luminescence by the alpha and the triton. The dependence of the edge effect on neutron energy was examined by this Monte Carlo code. This method was applied to the measurement of TPR distributions in simulated fusion blanket assemblies bombarded by D-T neutrons. Absolute values of the TPR were obtained with an experimental error of 3∼6 %. The measured results were compared with those of conventional β-counting methods and good agreement was obtained. An optical fiber system, using miniature lithium-glass scintillators, was fabricated for purpose of microminiaturization of detector size and adaption to strong electromagnetic field. Applicability of this system to a D-T neutron field was demonstrated. (author)

  3. SU-E-T-602: Patient-Specific Online Dose Verification Based On Transmission Detector Measurements

    International Nuclear Information System (INIS)

    Thoelking, J; Yuvaraj, S; Jens, F; Lohr, F; Wenz, F; Wertz, H; Wertz, H

    2015-01-01

    Purpose: Intensity modulated radiotherapy requires a comprehensive quality assurance program in general and ideally independent verification of dose delivery. Since conventional 2D detector arrays allow only pre-treatment verification, there is a debate concerning the need of online dose verification. This study presents the clinical performance, including dosimetric plan verification in 2D as well as in 3D and the error detection abilities of a new transmission detector (TD) for online dose verification of 6MV photon beam. Methods: To validate the dosimetric performance of the new device, dose reconstruction based on TD measurements were compared to a conventional pre-treatment verification method (reference) and treatment planning system (TPS) for 18 IMRT and VMAT treatment plans. Furthermore, dose reconstruction inside the patient based on TD read-out was evaluated by comparing various dose volume indices and 3D gamma evaluations against independent dose computation and TPS. To investigate the sensitivity of the new device, different types of systematic and random errors for leaf positions and linac output were introduced in IMRT treatment sequences. Results: The 2D gamma index evaluation of transmission detector based dose reconstruction showed an excellent agreement for all IMRT and VMAT plans compared to reference measurements (99.3±1.2)% and TPS (99.1±0.7)%. Good agreement was also obtained for 3D dose reconstruction based on TD read-out compared to dose computation (mean gamma value of PTV = 0.27±0.04). Only a minimal dose underestimation within the target volume was observed when analyzing DVH indices (<1%). Positional errors in leaf banks larger than 1mm and errors in linac output larger than 2% could clearly identified with the TD. Conclusion: Since 2D and 3D evaluations for all IMRT and VMAT treatment plans were in excellent agreement with reference measurements and dose computation, the new TD is suitable to qualify for routine treatment plan

  4. SU-E-T-602: Patient-Specific Online Dose Verification Based On Transmission Detector Measurements

    Energy Technology Data Exchange (ETDEWEB)

    Thoelking, J; Yuvaraj, S; Jens, F; Lohr, F; Wenz, F; Wertz, H; Wertz, H [University Medical Center Mannheim, University of Heidelberg, Mannheim, Baden-Wuerttemberg (Germany)

    2015-06-15

    Purpose: Intensity modulated radiotherapy requires a comprehensive quality assurance program in general and ideally independent verification of dose delivery. Since conventional 2D detector arrays allow only pre-treatment verification, there is a debate concerning the need of online dose verification. This study presents the clinical performance, including dosimetric plan verification in 2D as well as in 3D and the error detection abilities of a new transmission detector (TD) for online dose verification of 6MV photon beam. Methods: To validate the dosimetric performance of the new device, dose reconstruction based on TD measurements were compared to a conventional pre-treatment verification method (reference) and treatment planning system (TPS) for 18 IMRT and VMAT treatment plans. Furthermore, dose reconstruction inside the patient based on TD read-out was evaluated by comparing various dose volume indices and 3D gamma evaluations against independent dose computation and TPS. To investigate the sensitivity of the new device, different types of systematic and random errors for leaf positions and linac output were introduced in IMRT treatment sequences. Results: The 2D gamma index evaluation of transmission detector based dose reconstruction showed an excellent agreement for all IMRT and VMAT plans compared to reference measurements (99.3±1.2)% and TPS (99.1±0.7)%. Good agreement was also obtained for 3D dose reconstruction based on TD read-out compared to dose computation (mean gamma value of PTV = 0.27±0.04). Only a minimal dose underestimation within the target volume was observed when analyzing DVH indices (<1%). Positional errors in leaf banks larger than 1mm and errors in linac output larger than 2% could clearly identified with the TD. Conclusion: Since 2D and 3D evaluations for all IMRT and VMAT treatment plans were in excellent agreement with reference measurements and dose computation, the new TD is suitable to qualify for routine treatment plan

  5. Online measurement for geometrical parameters of wheel set based on structure light and CUDA parallel processing

    Science.gov (United States)

    Wu, Kaihua; Shao, Zhencheng; Chen, Nian; Wang, Wenjie

    2018-01-01

    The wearing degree of the wheel set tread is one of the main factors that influence the safety and stability of running train. Geometrical parameters mainly include flange thickness and flange height. Line structure laser light was projected on the wheel tread surface. The geometrical parameters can be deduced from the profile image. An online image acquisition system was designed based on asynchronous reset of CCD and CUDA parallel processing unit. The image acquisition was fulfilled by hardware interrupt mode. A high efficiency parallel segmentation algorithm based on CUDA was proposed. The algorithm firstly divides the image into smaller squares, and extracts the squares of the target by fusion of k_means and STING clustering image segmentation algorithm. Segmentation time is less than 0.97ms. A considerable acceleration ratio compared with the CPU serial calculation was obtained, which greatly improved the real-time image processing capacity. When wheel set was running in a limited speed, the system placed alone railway line can measure the geometrical parameters automatically. The maximum measuring speed is 120km/h.

  6. Calibration and validation of a MCC/IMS prototype for exhaled propofol online measurement.

    Science.gov (United States)

    Maurer, Felix; Walter, Larissa; Geiger, Martin; Baumbach, Jörg Ingo; Sessler, Daniel I; Volk, Thomas; Kreuer, Sascha

    2017-10-25

    Propofol is a commonly used intravenous general anesthetic. Multi-capillary column (MCC) coupled Ion-mobility spectrometry (IMS) can be used to quantify exhaled propofol, and thus estimate plasma drug concentration. Here, we present results of the calibration and analytical validation of a MCC/IMS pre-market prototype for propofol quantification in exhaled air. Calibration with a reference gas generator yielded an R 2 ≥0.99 with a linear array for the calibration curve from 0 to 20 ppb v . The limit of quantification was 0.3 ppb v and the limit of detection was 0.1 ppb v . The device is able to distinguish concentration differences >0.5 ppb v for the concentration range between 2 and 4 ppb v and >0.9 ppb v for the range between 28 and 30 ppb v . The imprecision at 20 ppb v is 11.3% whereas it is 3.5% at a concentration of 40 ppb v . The carry-over duration is 3min. The MCC/IMS we tested provided online quantification of gaseous propofol over the clinically relevant range at measurement frequencies of one measurement each minute. Copyright © 2017 Elsevier B.V. All rights reserved.

  7. Estimation of signal intensity for online measurement X-ray pinhole camera

    International Nuclear Information System (INIS)

    Dong Jianjun; Liu Shenye; Yang Guohong; Yu Yanning

    2009-01-01

    The signal intensity was estimated for on-line measurement X-ray pinhole camera with CCD as measurement equipment. The X-ray signal intensity counts after the attenuation of thickness-varied Be filters and different material flat mirrors respectively were estimated using the energy spectrum of certain laser prototype and the quantum efficiency curve of PI-SX1300 CCD camera. The calculated results indicate that Be filters no thicker than 200 μm can only reduce signal intensity by one order of magnitude, and so can Au flat mirror with 3 degree incident angle, Ni, C and Si flat mirrors with 5 degree incident angle,but the signal intensity counts for both attenuation methods are beyond the saturation counts of the CCD camera. We also calculated the attenuation of signal intensity for different thickness Be filters combined with flat mirrors, indicates that the combination of Be filters with the thickness between 20 and 40 μm and Au flat mirror with 3 degree incident angle or Ni flat mirror with 5 degree incident angle is a good choice for the attenuation of signal intensity. (authors)

  8. Online updating and uncertainty quantification using nonstationary output-only measurement

    Science.gov (United States)

    Yuen, Ka-Veng; Kuok, Sin-Chi

    2016-01-01

    Extended Kalman filter (EKF) is widely adopted for state estimation and parametric identification of dynamical systems. In this algorithm, it is required to specify the covariance matrices of the process noise and measurement noise based on prior knowledge. However, improper assignment of these noise covariance matrices leads to unreliable estimation and misleading uncertainty estimation on the system state and model parameters. Furthermore, it may induce diverging estimation. To resolve these problems, we propose a Bayesian probabilistic algorithm for online estimation of the noise parameters which are used to characterize the noise covariance matrices. There are three major appealing features of the proposed approach. First, it resolves the divergence problem in the conventional usage of EKF due to improper choice of the noise covariance matrices. Second, the proposed approach ensures the reliability of the uncertainty quantification. Finally, since the noise parameters are allowed to be time-varying, nonstationary process noise and/or measurement noise are explicitly taken into account. Examples using stationary/nonstationary response of linear/nonlinear time-varying dynamical systems are presented to demonstrate the efficacy of the proposed approach. Furthermore, comparison with the conventional usage of EKF will be provided to reveal the necessity of the proposed approach for reliable model updating and uncertainty quantification.

  9. Understanding channel purchase intentions : Measuring online and offline shopping value perceptions

    NARCIS (Netherlands)

    Broekhuizen, T.L.J.

    2006-01-01

    This dissertation investigates consumers’ prepurchase evaluations of buying books offline and online. It synthesizes the E-Commerce and perceived value literature to develop a conceptual model that explains online and offline purchase intentions. Based on this literature review, it is proposed that

  10. A system for accurate on-line measurement of total gas consumption or production rates in microbioreactors

    NARCIS (Netherlands)

    van Leeuwen, Michiel; Heijnen, Joseph J.; Gardeniers, Johannes G.E.; Oudshoorn, Arthur; Noorman, Henk; Visser, Jan; van der Wielen, Luuk A.M.; van Gulik, Walter M.

    2009-01-01

    A system has been developed, based on pressure controlled gas pumping, for accurate measurement of total gas consumption or production rates in the nmol/min range, applicable for on-line monitoring of bioconversions in microbioreactors. The system was validated by carrying out a bioconversion with

  11. Measuring MFT's Mental Health Literacy and Competence: The Effects of an On-Line Introductory Workshop on Eating Disorders

    Science.gov (United States)

    Beck-Ellsworth, Danielle

    2011-01-01

    Purpose of study: The purpose of the validity study was to establish known-groups validity of the two measures used for the main study by comparing the responses of the Eating Disorder experts and non-experts. The purpose of the main study was to develop an on-line introductory workshop on eating disorders and investigate the levels of competency…

  12. On-line measurement of crystalline color by color-image processing system; Gazo shori system wo mochiita kessho no online iro sokutei

    Energy Technology Data Exchange (ETDEWEB)

    Okayasu, S.; Katayama, M.; Shinohara, T. [Ajinomoto Co. Inc., Tokyo (Japan)

    1996-01-20

    Aiming for the stable operation and the rationalization of factory plant, the color-image processing has been tried to introduce into the on-line system to measure the crystalline color of L-Lysine in its refining process. Because the practical spectro-photometry was used to be employed by manual measurement. In this paper, the calculation formula of the transmittance by spectrophotometry is theoretically introduced by analyzing the relation of Lambert-Beer`s law of luminous transparency with the Kubelka-Munk`s function of the luminous dispersion using color image data. The parameters of the calculation formula were decided by actual measurement, so that the formula with accuracy value of {plus_minus}3% elucidated the possible estimation of transmittance by spectrophotometry. The system was tested on a commercial plant, and some issues are discussed. 8 refs., 8 figs., 3 tabs.

  13. Measuring Medical Student Preference: A Comparison of Classroom Versus Online Instruction for Teaching Pubmed*EC

    Science.gov (United States)

    Schimming, Laura M.

    2008-01-01

    Objective: The research analyzed evaluation data to assess medical student satisfaction with the learning experience when required PubMed training is offered entirely online. Methods: A retrospective study analyzed skills assessment scores and student feedback forms from 455 first-year medical students who completed PubMed training either through classroom sessions or an online tutorial. The class of 2006 (n = 99) attended traditional librarian-led sessions in a computer classroom. The classes of 2007 (n = 120), 2008 (n = 121), and 2009 (n = 115) completed the training entirely online through a self-paced tutorial. PubMed skills assessment scores and student feedback about the training were compared for all groups. Results: As evidenced by open-ended comments about the training, students who took the online tutorial were equally or more satisfied with the learning experience than students who attended classroom sessions, with the classes of 2008 and 2009 reporting greater satisfaction (PPubMed skills assessment (91%) was the same for all groups of students. Conclusions: Student satisfaction improved and PubMed assessment scores did not change when instruction was offered online to first-year medical students. Comments from the students who received online training suggest that the increased control and individual engagement with the web-based content led to their satisfaction with the online tutorial. PMID:18654658

  14. A tewlve detector coincidence spectrometer for on-line and off-line measurements of nuclear g-factors

    International Nuclear Information System (INIS)

    Alfter, I.; Bodenstedt, E.; Hamer, B.; Hoff, J. van den; Knichel, W.; Muenning, H.; Piel, S.; Schueth, J.; Sajok, R.

    1992-01-01

    A twelve detector γ-γ directional correlation setup is described which has been designed and constructed for high precision on-line and off-line IPAC measurements. A ring of twelve BaF 2 detectors which may be replaced by Ge detectors is arranged around a superconducting magnet providing a maximum magnetic field of 4.5 T. In on-line experiments the magnetic field has the direction of the beam which passes through a central bore of the magnet. The data acquisition system stores directly the Esub(γ 1 )-Esub(γ 2 ) coincidence matrices for all 66 two-detector combinations in two 8 Mbyte RAMs, one for each of the two field directions. This allows a very fast data evaluation with a small on-line computer. The apparatus got into operation one-and-a-halve years ago and revealed excellent properties. (orig.)

  15. On-line removal of volatile fatty acids from CELSS anaerobic bioreactor via nanofiltration.

    Science.gov (United States)

    Colon, G; Sager, J C

    2001-01-01

    The CELSS resource recovery system, which is a waste-processing system, uses aerobic and anaerobic bioreactors to recover plants nutrients and secondary foods from the inedible biomass. The anaerobic degradation of the inedible biomass, by means of culture of rumen bacteria, generates organic compounds such as volatile fatty acids (VFA) (acetic, propionic, butyric) and ammonia. The presence of VFA in the bioreactor medium at fairly low concentrations decreases the microbial population's metabolic reactions due to end-product inhibition. Technologies to remove VFA continuously from the bioreactor are of high interest. Several candidate technologies were analyzed, such as organic solvent liquid-liquid extraction, adsorption and/or ion exchange, dialysis, electrodialysis, and pressure-driven membrane separation processes. The proposed technique for the on-line removal of VFA from the anaerobic bioreactor was a nanofiltration membrane recycle bioreactor. In order to establish the nanofiltration process performance variables before coupling it to the bioreactor, a series of experiments was carried out using a 10,000 molecular weight cutoff (MWCO) tubular ceramic membrane module. The variables studied were the bioreactor slurry permeation characteristics, such as: the permeate flux, VFA and nutrient removal rates as a function of applied transmembrane pressure, fluid recirculation velocity, suspended matter concentration, and process operating time. Results indicated that the permeate flux, VFA, and nutrients removal rates are directly proportional to the fluid recirculation velocity in the range between 0.6 and 1.0 m/s, applied pressure when these are lower than 1.5 bar, and inversely proportional to the total suspended solids concentration in the range between 23,466 and 34,880 mg/L. At applied pressure higher than 1.5 bar the flux is not more linearly dependent due to concentration polarization and fouling effects over the membrane surface. It was also found that the

  16. On-line removal of volatile fatty acids from CELSS anaerobic bioreactor via nanofiltration

    Science.gov (United States)

    Colon, Guillermo

    1995-01-01

    The CELSS (controlled ecological life support system) resource recovery system, which is a waste processing system, uses aerobic and anaerobic bioreactors to recover plants nutrients and secondary foods from the inedible biomass. The anaerobic degradation of the inedible biomass by means of culture of rumen bacteria,generates organic compounds such as volatile fatty acids (acetic, propionic, butyric, VFA) and ammonia. The presence of VFA in the bioreactor medium at fairly low concentrations decreases the microbial population's metabolic reactions due to end-product inhibition. Technologies to remove VFA continuously from the bioreactor are of high interest. Several candidate technologies were analyzed, such as organic solvent liquid-liquid extraction, adsorption and/or ion exchange, dialysis, electrodialysis, and pressure driven membrane separation processes. The proposed technique for the on-line removal of VFA from the anaerobic bioreactor was a nanofiltration membrane recycle bioreactor. In order to establish the nanofiltration process performance variables before coupling it to the bioreactor, a series of experiments were carried out using a 10,000 MWCO tubular ceramic membrane module. The variables studied were the bioreactor slurry permeation characteristics, such as, the permeate flux, VFA and the nutrient removal rates as a function of applied transmembrane pressure, fluid recirculation velocity, suspended matter concentration, and process operating time. Results indicate that the permeate flux, VFA and nutrients removal rates are directly proportional to the fluid recirculation velocity in the range between 0.6 to 1.0 m/s, applied pressure when these are low than 1.5 bar, and inversely proportional to the total suspended solids concentration in the range between 23,466 to 34,880. At applied pressure higher than 1.5 bar the flux is not more linearly dependent due to concentration polarization and fouling effects over the membrange surface. It was also found

  17. Online educative activities for solar ultraviolet radiation based on measurements of cloud amount and solar exposures.

    Science.gov (United States)

    Parisi, A V; Downs, N; Turner, J; Amar, A

    2016-09-01

    A set of online activities for children and the community that are based on an integrated real-time solar UV and cloud measurement system are described. These activities use the functionality of the internet to provide an educative tool for school children and the public on the influence of cloud and the angle of the sun above the horizon on the global erythemal UV or sunburning UV, the diffuse erythemal UV, the global UVA (320-400nm) and the vitamin D effective UV. Additionally, the units of UV exposure and UV irradiance are investigated, along with the meaning and calculation of the UV index (UVI). This research will help ensure that children and the general public are better informed about sun safety by improving their personal understanding of the daily and the atmospheric factors that influence solar UV radiation and the solar UV exposures of the various wavebands in the natural environment. The activities may correct common misconceptions of children and the public about UV irradiances and exposure, utilising the widespread reach of the internet to increase the public's awareness of the factors influencing UV irradiances and exposures in order to provide clear information for minimizing UV exposure, while maintaining healthy, outdoor lifestyles. Copyright © 2016 Elsevier B.V. All rights reserved.

  18. New instrument for on-line viscosity measurement of fermentation media.

    Science.gov (United States)

    Picque, D; Corrieu, G

    1988-01-01

    In an attempt to resolve the difficult problem of on-line determination of the viscosity of non-Newtonian fermentation media, the authors have used a vibrating rod sensor mounted on a bioreactor. The sensor signal decreases nonlinearly with increased apparent viscosity. Electronic filtering of the signal damps the interfering effect of aeration and mechanical agitation. Sensor drift is very low (0.03% of measured value per hour). On the rheological level the sensor is primarily an empirical tool that must be specifically calibrated for each fermentation process. Once this is accomplished, it becomes possible to establish linear or second-degree correlations between the electrical signal from the sensor and the essential parameters of the fermentation process in question (pH of a fermented milk during acidification, concentration of extra cellular polysaccharide). In addition, by applying the power law to describe the rheological behavior of fermentation media, we observe a second-order polynomial correlation between the sensor signal and the behavior index (n).

  19. Turbidimetric Measurement for On-line Monitoring of SiO2 Particles

    International Nuclear Information System (INIS)

    Kim, In Sook; Lim, H. B.; Kim, Yang Sun

    2004-01-01

    In this work, the fundamental study of on-line monitoring of SiO 2 particles in the size range of 40 nm to 725 nm was carried out using turbidimetry. The size of particle was measured using a field emission scanning electron microscope (FE-SEM). The factors affecting on the turbidity were discussed, for example, wavelength, size, and concentration. In order to observe the dependence of turbidity on the wavelength, a turbidimetric system equipped with charged coupled detector (CCD) was built. The shape of the transmitted peak was changed and the peak maximum was shifted to the red when the concentration of particle was increased. This result indicates that the turbidity is related to the wavelength, which corresponds to the characteristic of the Mie extinction coefficient, Q, that is a function of not only particle diameter and refractive index but also wavelength. It is clear that a linear calibration curve for each particle in different size can be obtained at an optimized wavelength

  20. On-line and precise measurement of iron wear using thin layer activation reactions by proton beam

    International Nuclear Information System (INIS)

    Kosako, Toshiso; Nishimura, Kazuo.

    1990-01-01

    For the purpose of the on-line measurement of iron wear, thin layer activation (TLA) method or surface layer activation (SLA) method has been carried out since early 1970s. This method uses the irradiation of charged particle beam like protons from an accelerator onto a metal surface to produce a thin activated layer of several tens μm. The wear of this activated layer is measured by nondestructive on-line method with a radiation detector. There are two methods of the measurement. One is the activity loss measurement on the surface, and the other is the activity measurement of the metal debris collected in a filter. The former method is considered here. The purpose it to measure the wear of engine cam noses to help the development of good engine oil. Proton beam irradiation with a tandem van de Graaff accelerator, wear calibration using a gamma ray spectrometer, on-line wear measurement of cam noses of car engines by TLA method and so on are reported. The 7.00 MeV proton beam from a van de Graaff accelerator was used for activation, and Co-56, Co-57 and Co-58 were obtained in thin layers. (K.I.)

  1. Online Transcranial Magnetic Stimulation Protocol for Measuring Cortical Physiology Associated with Response Inhibition.

    Science.gov (United States)

    Guthrie, Michael D; Gilbert, Donald L; Huddleston, David A; Pedapati, Ernest V; Horn, Paul S; Mostofsky, Stewart H; Wu, Steve W

    2018-02-08

    We describe the development of a reproducible, child-friendly motor response inhibition task suitable for online Transcranial Magnetic Stimulation (TMS) characterization of primary motor cortex (M1) excitability and inhibition. Motor response inhibition prevents unwanted actions and is abnormal in several neuropsychiatric conditions. TMS is a non-invasive technology that can quantify M1 excitability and inhibition using single- and paired-pulse protocols and can be precisely timed to study cortical physiology with high temporal resolution. We modified the original Slater-Hammel (S-H) stop signal task to create a "racecar" version with TMS pulses time-locked to intra-trial events. This task is self-paced, with each trial initiating after a button push to move the racecar towards the 800 ms target. GO trials require a finger-lift to stop the racecar just before this target. Interspersed randomly are STOP trials (25%) during which the dynamically adjusted stop signal prompts subjects to prevent finger-lift. For GO trials, TMS pulses were delivered at 650 ms after trial onset; whereas, for STOP trials, the TMS pulses occurred 150 ms after the stop signal. The timings of the TMS pulses were decided based on electroencephalography (EEG) studies showing event-related changes in these time ranges during stop signal tasks. This task was studied in 3 blocks at two study sites (n=38) and we recorded behavioral performance and event-related motor-evoked potentials (MEP). Regression modelling was used to analyze MEP amplitudes using age as a covariate with multiple independent variables (sex, study site, block, TMS pulse condition [single- vs. paired-pulse], trial condition [GO, successful STOP, failed STOP]). The analysis showed that TMS pulse condition (p<0.0001) and its interaction with trial condition (p=0.009) were significant. Future applications for this online S-H/TMS paradigm include the addition of simultaneous EEG acquisition to measure TMS-evoked EEG potentials. A

  2. The online measured black carbon aerosol and source orientations in the Nam Co region, Tibet.

    Science.gov (United States)

    Zhang, Xin; Ming, Jing; Li, Zhongqin; Wang, Feiteng; Zhang, Guoshuai

    2017-11-01

    Equivalent black carbon (eBC) mass concentrations were measured by an aethalometer (AE-31) in the Nam Co, central Tibet from 2010 to 2014. Different from previous filter-sampling studies (Ming et al., J Environ Sci 22(11):1748-1756, 2010; Zhao et al., Environ Sci Pollut Res 20:5827-5838, 2013), the first high-resolution online eBC measurement conducted in central Tibet is reported here, allowing to discuss the diurnal variations as well as seasonal variabilities of eBC. Average daily eBC concentration was 74 ± 50 ng/m 3 , reflecting a global background level. Meteorological conditions influenced eBC concentrations largely at seasonal scale, which are higher in February-May but lower in June-January. The highest eBC concentrations (greater than 210 ng/m 3 ) were more associated with the W and WSW winds smaller than 6 m/s. The diurnal variations of eBC showed plateaus from 10:00 to 15:00 with seasonal variations, associated with local anthropogenic activities, such as indigenous Tibetan burning animal waste and tourism traffic. The PBLHs showed a co-variance with eBC concentrations, implicating close sources. The aerosol optical depths derived from the MODIS data over the Nam Co Observatory Station (NCOS)-included sub-area (30° N-40° N, 90° E-100° E) showed significant relationship with eBC concentrations. This suggests that nearby or short-distance sources other than long-distance transported pollutants could be important contributors to eBC concentrations at the NCOS, different from the conclusions suggested by previous studies.

  3. A new technique for online measurement of total and water-soluble copper (Cu) in coarse particulate matter (PM)

    International Nuclear Information System (INIS)

    Wang, Dongbin; Shafer, Martin M.; Schauer, James J.; Sioutas, Constantinos

    2015-01-01

    This study presents a novel system for online, field measurement of copper (Cu) in ambient coarse (2.5–10 μm) particulate matter (PM). This new system utilizes two virtual impactors combined with a modified liquid impinger (BioSampler) to collect coarse PM directly as concentrated slurry samples. The total and water-soluble Cu concentrations are subsequently measured by a copper Ion Selective Electrode (ISE). Laboratory evaluation results indicated excellent collection efficiency (over 85%) for particles in the coarse PM size ranges. In the field evaluations, very good agreements for both total and water-soluble Cu concentrations were obtained between online ISE-based monitor measurements and those analyzed by means of inductively coupled plasma mass spectrometry (ICP-MS). Moreover, the field tests indicated that the Cu monitor could achieve near-continuous operation for at least 6 consecutive days (a time resolution of 2–4 h) without obvious shortcomings. - Highlights: • A novel only PM sampling and Cu measuring technology is developed. • Very good particle collection efficiency for coarse PM is observed. • Excellent agreement is obtained between Cu ISE and offline ICP-MS measurements. • The new system can be continuously operated for at least 6 consecutive days. - A new technique for online measurements of Cu in coarse PM is described

  4. Quantitative Gd-DOTA uptake from cerebrospinal fluid into rat brain using 3D VFA-SPGR at 9.4T.

    Science.gov (United States)

    Lee, Hedok; Mortensen, Kristian; Sanggaard, Simon; Koch, Palle; Brunner, Hans; Quistorff, Bjørn; Nedergaard, Maiken; Benveniste, Helene

    2018-03-01

    We propose a quantitative technique to assess solute uptake into the brain parenchyma based on dynamic contrast-enhanced MRI (DCE-MRI). With this approach, a small molecular weight paramagnetic contrast agent (Gd-DOTA) is infused in the cerebral spinal fluid (CSF) and whole brain gadolinium concentration maps are derived. We implemented a 3D variable flip angle spoiled gradient echo (VFA-SPGR) longitudinal relaxation time (T1) technique, the accuracy of which was cross-validated by way of inversion recovery rapid acquisition with relaxation enhancement (IR-RARE) using phantoms. Normal Wistar rats underwent Gd-DOTA infusion into CSF via the cisterna magna and continuous MRI for approximately 130 min using T1-weighted imaging. Dynamic Gd-DOTA concentration maps were calculated and parenchymal uptake was estimated. In the phantom study, T1 discrepancies between the VFA-SPGR and IR-RARE sequences were approximately 6% with a transmit coil inhomogeneity correction. In the in vivo study, contrast transport profiles indicated maximal parenchymal retention of approximately 19% relative to the total amount delivered into the cisterna magna. Imaging strategies for accurate 3D contrast concentration mapping at 9.4T were developed and whole brain dynamic concentration maps were derived to study solute transport via the glymphatic system. The newly developed approach will enable future quantitative studies of the glymphatic system in health and disease states. Magn Reson Med 79:1568-1578, 2018. © 2017 International Society for Magnetic Resonance in Medicine. © 2017 International Society for Magnetic Resonance in Medicine.

  5. Use of Internet audience measurement data to gauge market share for online health information services.

    Science.gov (United States)

    Wood, Fred B; Benson, Dennis; LaCroix, Eve-Marie; Siegel, Elliot R; Fariss, Susan

    2005-07-01

    The transition to a largely Internet and Web-based environment for dissemination of health information has changed the health information landscape and the framework for evaluation of such activities. A multidimensional evaluative approach is needed. This paper discusses one important dimension of Web evaluation-usage data. In particular, we discuss the collection and analysis of external data on website usage in order to develop a better understanding of the health information (and related US government information) market space, and to estimate the market share or relative levels of usage for National Library of Medicine (NLM) and National Institutes of Health (NIH) websites compared to other health information providers. The primary method presented is Internet audience measurement based on Web usage by external panels of users and assembled by private vendors-in this case, comScore. A secondary method discussed is Web usage based on Web log software data. The principle metrics for both methods are unique visitors and total pages downloaded per month. NLM websites (primarily MedlinePlus and PubMed) account for 55% to 80% of total NIH website usage depending on the metric used. In turn, NIH.gov top-level domain usage (inclusive of NLM) ranks second only behind WebMD in the US domestic home health information market and ranks first on a global basis. NIH.gov consistently ranks among the top three or four US government top-level domains based on global Web usage. On a site-specific basis, the top health information websites in terms of global usage appear to be WebMD, MSN Health, PubMed, Yahoo! Health, AOL Health, and MedlinePlus. Based on MedlinePlus Web log data and external Internet audience measurement data, the three most heavily used cancer-centric websites appear to be www.cancer.gov (National Cancer Institute), www.cancer.org (American Cancer Society), and www.breastcancer.org (non-profit organization). Internet audience measurement has proven useful to NLM

  6. Process measuring techniques applying in-line and on-line analyzers. Betriebsmesstechnik unter Einsatz von in-line und on-line Analysatoren

    Energy Technology Data Exchange (ETDEWEB)

    Oehme, F; Jola, M

    1982-01-01

    The measurement and control of classical physical parameters such as pressure, temperature etc, is frequently not sufficient now for optimum process control in chemistry and associated fields. Only the use of inline and online analysers makes it possible to maintain the narrow limits of chemical reaction conditions. This ABC pocket book should help the user to select the best from the large number of available methods of measurement. Using 120 alphabetically arranged key words with many cross-references, it has a well-thought-out treatment of basic measurements and descriptions of apparatus, and on the other hand, it contains selected typical examples of applications. Width rather than depth of information is aimed at. The electrochemical methods discussed are potentiometry (pH value, redox potential, direct potentiometry with ion selective electrodes), conductometry (measurement of conductivity) and voltammetry (polarography, ammetry). Photometry, the measurement of density, the refractive index, surface tension and viscosity are described. From the large number of applications, the examples of textile processing, the cellulose and paper industry, the surface treatment of materials and petrochemicals are discussed. Special attention is paid to the treatment of service water, drinking water and boiler feed water. In connection with questions of work and environmental protection, emission control and the treatment of domestic and industrial waste water are described. With 119 figs.

  7. Online shear viscosity measurement of starchy melts enriched in wheat bran.

    Science.gov (United States)

    Robin, Frédéric; Bovet, Nicolas; Pineau, Nicolas; Schuchmann, Heike P; Palzer, Stefan

    2011-01-01

    Addition of wheat bran to flours modifies their expansion properties after cooking extrusion. This can be attributed to changes in the melt shear viscosity at the die. The effect of wheat bran concentration added to achieve 2 levels of dietary fibers of 12. 6% and 24.4%, and process conditions on the shear viscosity of wheat flour was therefore assessed using an online twin-slit rheometer. The shear viscosity measured at 30 s⁻¹ ranged from 9.5 × 10³ to 53.4 × 10³ Pa s. Regardless of the process conditions and bran concentration, the extruded melts showed a pseudoplastic behavior with a power law index n ranging from 0.05 to 0.27. Increasing the barrel temperature of the extruder from 120 to 180 °C, the water content from 18% to 22% or the screw speed from 400 to 800 rpm significantly decreased the melt shear viscosity at the extruder exit. The addition of bran significantly increased the melt shear viscosity only at the highest bran concentration. The effect was process condition dependant. Mathematical interpretations, based upon observations, of the experimental data were carried out. They can be used to predict the effect of the process conditions on the melt shear viscosity at the die of extruded wheat flour with increasing bran concentration. The viscosity data will be applied in future works to study the expansion properties of extruded wheat flour supplemented with bran. Incorporation of wheat bran, a readily available and low cost by-product, in extruded puffed foods is constrained due to its negative effect on the product texture. Understanding the effect of wheat bran on rheological properties of extruded melts, driving the final product properties, is essential to provide solutions to the food industry and enhance its use. © 2011 Institute of Food Technologists®

  8. Social media and online attention as an early measure of the impact of research in solid organ transplantation.

    Science.gov (United States)

    Knight, Simon R

    2014-09-15

    Traditional measures of the impact of published research, such as citation counts, are limited to measuring academic impact. The use of social media and other online tools as alternative measures of research impact is gaining popularity and used by leading medical journals. MEDLINE was searched for articles published with subject headings relating to solid organ transplantation between August 1, 2011, and July 31, 2012. Citation data were retrieved from SCOPUS, and statistics regarding mentions in social media, social bookmarking sites, news outlets, and expert recommendation sites were retrieved from the data at www.altmetric.com. Data were analyzed for associations between alternative metric data and citation rates. The search retrieved 6,981 publications. Sixty-six percent of the articles had at least one citation. Mentions in social media were 19.3%, 13.1% had social bookmarks, 0.9% had expert recommendations, and online news outlets picked up eight articles. Significantly higher citation rates were associated with mention in social media, expert recommendation, social bookmarking, and for articles identified as meta-analyses, multicenter studies, randomized controlled trials, and reviews (all Psocial media (odds ratio, 2.58; Psocial media are more likely to relate to the more controversial and emotive areas of transplantation. Social media and online attention act as early predictors of the impact of transplant research as measured by later citation rate. Blogging and expert recommendation, in particular, are associated with higher citation rates.

  9. Measuring organisational readiness for patient engagement (MORE): an international online Delphi consensus study.

    Science.gov (United States)

    Oostendorp, Linda J M; Durand, Marie-Anne; Lloyd, Amy; Elwyn, Glyn

    2015-02-14

    Widespread implementation of patient engagement by organisations and clinical teams is not a reality yet. The aim of this study is to develop a measure of organisational readiness for patient engagement designed to monitor and facilitate a healthcare organisation's willingness and ability to effectively implement patient engagement in healthcare. The development of the MORE (Measuring Organisational Readiness for patient Engagement) scale was guided by Weiner's theory of organisational readiness for change. Weiner postulates that an organisation's readiness is determined by both the willingness and ability to implement the change (i.e. in this context: patient engagement). A first version of the scale was developed based on a literature search and evaluation of pre-existing tools. We invited multi-disciplinary stakeholders to participate in a two-round online Delphi survey. Respondents were asked to rate the importance of each proposed item, and to comment on the proposed domains and items. Second round participants received feedback from the first round and were asked to re-rate the importance of the revised, new and unchanged items, and to provide comments. The first version of the scale contained 51 items divided into three domains: (1) Respondents' characteristics; (2) the organisation's willingness to implement patient engagement; and (3) the organisation's ability to implement patient engagement. 131 respondents from 16 countries (health care managers, policy makers, clinicians, patients and patient representatives, researchers, and other stakeholders) completed the first survey, and 72 of them also completed the second survey. During the Delphi process, 34 items were reworded, 8 new items were added, 5 items were removed, and 18 were combined. The scale's instructions were revised. The final version of MORE totalled 38 items; 5 on stakeholders, 13 on an organisation's willingness to implement, and 20 on an organisation's ability to implement patient

  10. On-line depth measurement for laser-drilled holes based on the intensity of plasma emission

    Science.gov (United States)

    Ho, Chao-Ching; Chiu, Chih-Mu; Chang, Yuan-Jen; Hsu, Jin-Chen; Kuo, Chia-Lung

    2014-09-01

    The direct time-resolved depth measurement of blind holes is extremely difficult due to the short time interval and the limited space inside the hole. This work presents a method that involves on-line plasma emission acquisition and analysis to obtain correlations between the machining processes and the optical signal output. Given that the depths of laser-machined holes can be estimated on-line using a coaxial photodiode, this was employed in our inspection system. Our experiments were conducted in air under normal atmospheric conditions without gas assist. The intensity of radiation emitted from the vaporized material was found to correlate with the depth of the hole. The results indicate that the estimated depths of the laser-drilled holes were inversely proportional to the maximum plasma light emission measured for a given laser pulse number.

  11. Detector Performance and Upgrade Plans of the Pixel Luminosity Telescope for Online per-Bunch Luminosity Measurement at CMS

    CERN Document Server

    CMS Collaboration

    2017-01-01

    The Pixel Luminosity Telescope (PLT) is a dedicated system for luminosity measurement at the CMS experiment using silicon pixel sensors. It was installed during LS1 and has been providing luminosity measurements throughout Run 2. The online bunch-by-bunch luminosity measurement employs the "fast-or" capability of the pixel readout chip (PSI46) to quickly identify likely tracks at the full 40MHz interaction rate. In addition, the full pixel information is read out at a lower rate, allowing for more detailed offline analysis. In this talk, we will present details of the commissioning, performance and operational history of the currently installed hardware and upgrade plans for LS2.

  12. Assessment of online monitoring strategies for measuring N2O emissions from full-scale wastewater treatment systems.

    Science.gov (United States)

    Marques, Ricardo; Rodriguez-Caballero, A; Oehmen, Adrian; Pijuan, Maite

    2016-08-01

    Clark-Type nitrous oxide (N2O) sensors are routinely used to measure dissolved N2O concentrations in wastewater treatment plants (WWTPs), but have never before been applied to assess gas-phase N2O emissions in full-scale WWTPs. In this study, a full-scale N2O gas sensor was tested and validated for online gas measurements, and assessed with respect to its linearity, temperature dependence, signal saturation and drift prior to full-scale application. The sensor was linear at the concentrations tested (0-422.3, 0-50 and 0-10 ppmv N2O) and had a linear response up to 2750 ppmv N2O. An exponential correlation between temperature and sensor signal was described and predicted using a double exponential equation while the drift did not have a significant influence on the signal. The N2O gas sensor was used for online N2O monitoring in a full-scale sequencing batch reactor (SBR) treating domestic wastewater and results were compared with those obtained by a commercial online gas analyser. Emissions were successfully described by the sensor, being even more accurate than the values given by the commercial analyser at N2O concentrations above 500 ppmv. Data from this gas N2O sensor was also used to validate two models to predict N2O emissions from dissolved N2O measurements, one based on oxygen transfer rate and the other based on superficial velocity of the gas bubble. Using the first model, predictions for N2O emissions agreed by 98.7% with the measured by the gas sensor, while 87.0% similarity was obtained with the second model. This is the first study showing a reliable estimation of gas emissions based on dissolved N2O online data in a full-scale wastewater treatment facility. Copyright © 2016 Elsevier Ltd. All rights reserved.

  13. Multinational web uses and gratifications: Measuring the Social Impact of Online Participation Across National Boundaries

    NARCIS (Netherlands)

    A.C.M. Dekkers; B. Sundararajan; L. Peters; P. Grace-Farfaglia; S.H. Park

    2014-01-01

    This paper will describe the rationale and findings from a multinational study of online uses and gratifications conducted in the United States, Korea, and the Netherlands in spring 2003. A survey research method of study was conducted using a questionnaire developed in three languages and was

  14. Measuring Malaysia School Resource Centers' Standards through iQ-PSS: An Online Management Information System

    Science.gov (United States)

    Zainudin, Fadzliaton; Ismail, Kamarulzaman

    2010-01-01

    The Ministry of Education has come up with an innovative way to monitor the progress of 9,843 School Resource Centers (SRCs) using an online management information system called iQ-PSS (Quality Index of SRC). This paper aims to describe the data collection method and analyze the current state of SRCs in Malaysia and explain how the results can be…

  15. A Measure of the Effectiveness of Incorporating 3D Human Anatomy into an Online Undergraduate Laboratory

    Science.gov (United States)

    Hilbelink, Amy J.

    2009-01-01

    Results of a study designed to determine the effectiveness of implementing three-dimensional (3D) stereo images of a human skull in an undergraduate human anatomy online laboratory were gathered and analysed. Mental model theory and its applications to 3D relationships are discussed along with the research results. Quantitative results on 62 pairs…

  16. Time-resolved SAXS measurements facilitated by online HPLC buffer exchange

    DEFF Research Database (Denmark)

    Jensen, Malene Hillerup; Toft, Katrine Nørgaard; David, Gabriel

    2010-01-01

    continuous or stopped flow. In this paper a method for obtaining TR-SAXS data from systems where the reaction is triggered by removal of a species is presented. This method is based on fast buffer exchange over a short desalting column facilitated by an online HPLC (high-performance liquid chromatography...

  17. A New Method of Measuring Online Media Advertising Effectiveness: Prospective Meta-Analysis in Marketing

    NARCIS (Netherlands)

    G. Liberali (Gui); G.L. Urban (Glen); B.G.C. Dellaert (Benedict); C. Tucker (Catherine); Y. Bart (Yakov); S. Stremersch (Stefan)

    2016-01-01

    textabstractThe authors introduce a new method, prospective meta-analysis in marketing (PMM), to estimate consumer response to online advertising on a large and adaptive scale. They illustrate their approach in a field study in the U.S., China and the Netherlands, covering equivalent ad content on

  18. DEVELOPMENT OF AN ON-LINE, REAL-TIME ALPHA RADIATION MEASURING INSTRUMENT FOR LIQUID STREAMS

    International Nuclear Information System (INIS)

    Unknown

    1999-01-01

    The US Department of Energy (DOE) has expressed a need for an on-line, real-time instrument for assaying alpha-emitting radionuclides (uranium and the transuranics) in effluent waters leaving DOE sites to ensure compliance with regulatory limits. Due to the short range of alpha particles in water (approximately40 Im), it is necessary now to intermittently collect samples of water and send them to a central laboratory for analysis. A lengthy and costly procedure is used to separate and measure the radionuclides from each sample. Large variations in radionuclide concentrations in the water may go undetected due to the sporadic sampling. Even when detected, the reading may not be representative of the actual stream concentration. To address these issues, the Advanced Technologies Group of Thermo Power Corporation (a Thermo Electron company) is developing a real-time, field-deployable alpha monitor based on a solid-state silicon wafer semiconductor (US Patent 5,652,013 and pending, assigned to the US Department of Energy). The Thermo Water Alpha Monitor will serve to monitor effluent water streams (Subsurface Contaminants Focus Area) and will be suitable for process control of remediation as well as decontamination and decommissioning (D and D) operations, such as monitoring scrubber or rinse water radioactivity levels (Mixed Waste, Plutonium, and D and D Focus Area). It would be applicable for assaying other liquids, such as oil, or solids after proper preconditioning. Rapid isotopic alpha air monitoring is also possible using this technology. This report details the program's accomplishments to date. Most significantly, the Alpha Monitoring Instrument was successfully field demonstrated on water 100X below the Environmental Protection Agency's proposed safe drinking water limit--down to under 1 pCi/1. During the Field Test, the Alpha Monitoring Instrument successfully analyzed isotopic uranium levels on a total of five different surface water, process water, and

  19. DEVELOPMENT OF AN ON-LINE, REAL-TIME ALPHA RADIATION MEASURING INSTRUMENT FOR LIQUID STREAMS

    International Nuclear Information System (INIS)

    1996-01-01

    The Department of Energy (DOE) has expressed a need for an on-line, real-time instrument for assaying alpha-emitting radionuclides (uranium and the transuranics) in effluent waters leaving DOE sites to ensure compliance with regulatory limits. Due to the short range of alpha particles in water (approximately40 Tm), it is necessary now to intermittently collect samples of water and send them to a central laboratory for analysis. A lengthy and costly procedure is used to separate and measure the radionuclides from each sample. Large variations in radionuclide concentrations in the water may go undetected due to the sporadic sampling. Even when detected, the reading may not be representative of the actual stream concentration. To address these issues, Tecogen, a division of Thermo Power Corporation, a Thermo Electron company, is developing a real-time, field-deployable, alpha monitor based on a solid-state silicon wafer semiconductor (patent pending, to be assigned to the Department of Energy). The Thermo Alpha Monitor (TAM) will serve to monitor effluent water streams (Subsurface Contaminants Focus Area) and will be suitable for process control of remediation as well as decontamination and decommissioning operations, such as monitoring scrubber or rinse water radioactivity levels (Mixed Waste Focus Area and D and D Focus Area). It would be applicable for assaying other liquids, such as oil, or solids after proper preconditioning. Rapid isotopic alpha air monitoring is also possible using this technology. This instrument for direct counting of alpha-emitters in aqueous streams is presently being developed by Thermo Power under a development program funded by the DOE Environmental Management program (DOE-EM), administered by the Morgantown Energy Technology Center (METC). Under this contract, Thermo Power has demonstrated a solid-state, silicon-based semiconductor instrument, which uses a proprietary film-based collection system to quantitatively extract the

  20. Application of a chronoamperometric measurement to the on-line monitoring of a lithium metal reduction for uranium oxide

    International Nuclear Information System (INIS)

    Kim, Tack-Jin; Cho, Young-Hwan; Choi, In-Kyu; Kang, Jun-Gill; Song, Kyuseok; Jee, Kwang-Yong

    2008-01-01

    Both a potentiometric and a chronoamperometric electrochemical technique have been applied in an attempt to develop an efficient method for an on-line monitoring of a lithium metal reduction process of uranium oxides at a high-temperature in a molten salt medium. As a result of this study, it was concluded that the chronoamperometric method provided a simple and effective way for a direct on-line monitoring measurement of a lithium metal reduction process of uranium oxides at 650 o C by the measuring electrical currents dependency on a variation of the reduction time for the reaction. A potentiometric method, by adopting a homemade oxide ion selective electrode made of ZrO 2 stabilized by a Y 2 O 3 doping, however, was found to be inappropriate for an on-line monitoring of the reduction reaction of uranium oxide in the presence of lithium metal due to an abnormal behavior of the adopted electrodes. The observed experimental results were discussed in detail by comparing them with previously published experimental data

  1. Influence Of Specific Mechanical Energy On Cornmeal Viscosity Measured By An On-line System During Twin-screw Extrusion

    OpenAIRE

    Chang Y.K.; Martinez-Bustos F.; Park T.S.; Kokini J.L.

    1999-01-01

    The influence of specific mechanical energy (SME) on cornmeal viscosity during the twin-screw extrusion at feed moisture contents of 25 and 30% and screw speeds in the range from 100 to 500 rpm was measured. Cornmeal was extruded in a co-rotating, intermeshing twin-screw coupled to a slit die rheometer. One approach to the on-line rheological measurement is to use a slit die with the extruder. In the present work it was show that shear viscosity decreased as a function of SME. The viscosity o...

  2. Process Analytical Technology and On-Line Spectroscopic Measurements of Chemical Meat Quality

    DEFF Research Database (Denmark)

    Sørensen, Klavs Martin

    This thesis deals with process analytical technology and how it can be implemented in the meat industry through on-line grading of chemical meat quality. The focus will be on two applications, namely the rapid quality control of fat quality and the development of a method for on-line detection...... of nano-molar quantification in few seconds, in addition to an accelerated extraction-free GC-MS method that through automation can deliver results much faster than other similar methods. The implementation of these high tech methods will provide the meat industry with a leading edge not only with product...... of boar taint. The chemical makeup of fat has a large effect on meat cut quality. Fat quality has traditionally been determined by methylation of a tissue sample followed by chromatography on a GC-MS system, elucidating the composition of the individual fatty acids. As this procedure typically takes far...

  3. Specalyzer—an interactive online tool to analyze spectral reflectance measurements

    Directory of Open Access Journals (Sweden)

    Alexander Koc

    2018-06-01

    Full Text Available Low-cost phenotyping using proximal sensors is increasingly becoming popular in plant breeding. As these techniques generate a large amount of data, analysis pipelines that do not require expertise in computer programming can benefit a broader user base. In this work, a new online tool Specalyzer is presented that allows interactive analysis of the spectral reflectance data generated by proximal spectroradiometers. Specalyzer can be operated from any web browser allowing data uploading, analysis, interactive plots and exporting by point and click using a simple graphical user interface. Specalyzer is evaluated with case study data from a winter wheat fertilizer trial with two fertilizer treatments. Specalyzer can be accessed online at http://www.specalyzer.org.

  4. Survey and online discussion groups to develop a patient-rated outcome measure on acceptability of treatment response in vitiligo

    Science.gov (United States)

    2014-01-01

    Background Vitiligo is a chronic depigmenting skin disorder which affects around 0.5-1% of the world’s population. The outcome measures used most commonly in trials to judge treatment success focus on repigmentation. Patient-reported outcome measures of treatment success are rarely used, although recommendations have been made for their inclusion in vitiligo trials. This study aimed to evaluate the face validity of a new patient-reported outcome measure of treatment response, for use in future trials and clinical practice. Method An online survey to gather initial views on what constitutes treatment success for people with vitiligo or their parents/carers, followed by online discussion groups with patients to reach consensus on what constitutes treatment success for individuals with vitiligo, and how this can be assessed in the context of trials. Participants were recruited from an existing database of vitiligo patients and through posts on the social network sites Facebook and Twitter. Results A total of 202 survey responses were received, of which 37 were excluded and 165 analysed. Three main themes emerged as important in assessing treatment response: a) the match between vitiligo and normal skin (how well it blends in); b) how noticeable the vitiligo is and c) a reduction in the size of the white patches. The majority of respondents said they would consider 80% or more repigmentation to be a worthwhile treatment response after 9 months of treatment. Three online discussion groups involving 12 participants led to consensus that treatment success is best measured by asking patients how noticeable their vitiligo is after treatment. This was judged to be best answered using a 5-point Likert scale, on which a score of 4 or 5 represents treatment success. Conclusions This study represents the first step in developing a patient reported measure of treatment success in vitiligo trials. Further work is now needed to assess its construct validity and responsiveness to

  5. Translating the Science of Measuring Ecosystems at a National Scale: NEON's Online Learning Portal

    Science.gov (United States)

    Wasser, L. A.

    2015-12-01

    "Big Data" are becoming increasingly common in many fields. The National Ecological Observatory Network (NEON) will collect data over the 30 years, using consistent, standardized methods across the United States. These freely available new data provide an opportunity for increased understanding of continental- and global scale processes such as changes in vegetation structure and condition, biodiversity and landuse. However, while "big data" are becoming more accessible and available, working with big data is challenging. New and potentially unfamiliar data types and associated processing methods, required to work with a growing diversity of available data take time and resources to learn. Analysis of these big datasets may further present a challenge given large file sizes, and uncertainty regarding best methods to properly statistically summarize and analyze results. Finally, resources that support learning these concepts and approaches, are distributed widely across multiple online spaces and may take time to find. This presentation will overview the development of NEON's collaborative University-focused online education portal. It will also cover content testing, community feedback and results from workshops using online content. Portal content is hosted in github to facilitate community input, accessibility version control. Content includes 1) videos and supporting graphics that explain key concepts related to NEON and related big spatio-temporal and 2) data tutorials that include subsets of spatio-temporal data that can be used to learn key big data skills in a self-paced approach, or that can be used as a teaching tool in the classroom or in a workshop. All resources utilize free and open data processing, visualization and analysis tools, techniques and scripts. All NEON materials are being developed in collaboration with the scientific community and are being tested via in-person workshops. Visit the portal online: www.neondataskills.org.

  6. Traveling the Silk Road: A Measurement of a Large Anonymous Online Marketplace

    Science.gov (United States)

    2012-11-28

    Silk Road, an anonymous, international online marketplace that operates as a Tor hidden service and uses Bitcoin as its exchange currency. We gather...analysis of Silk Road, an anonymous, international on- line marketplace that operates as a Tor hidden service and uses Bitcoin as its exchange currency. We...anonymity, Silk Road needs to also preserve payment anonymity. To that effect, Silk Road only supports Bitcoin (BTC, [30]) as a trading currency

  7. Impulsivity in Multiplayer Online Battle Arena Gamers: Preliminary Results on Experimental and Self-Report Measures.

    Science.gov (United States)

    Nuyens, Filip; Deleuze, Jory; Maurage, Pierre; Griffiths, Mark D; Kuss, Daria J; Billieux, Joël

    2016-06-01

    Background and aims Multiplayer Online Battle Arena (MOBA) games have become the most popular type of video games played worldwide, superseding the playing of Massively Multiplayer Online Role-Playing Games and First-Person Shooter games. However, empirical studies focusing on the use and abuse of MOBA games are still very limited, particularly regarding impulsivity, which is an indicator of addictive states but has not yet been explored in MOBA games. In this context, the objective of the present study is to explore the associations between impulsivity and symptoms of addictive use of MOBA games in a sample of highly involved League of Legends (LoL, currently the most popular MOBA game) gamers. Methods Thirty-six LoL gamers were recruited and completed both experimental (Single Key Impulsivity Paradigm) and self-reported impulsivity assessments (s-UPPS-P Impulsive Behavior Scale, Barratt Impulsiveness Scale), in addition to an assessment of problematic video game use (Problematic Online Gaming Questionnaire). Results Results showed links between impulsivity-related constructs and signs of excessive MOBA game involvement. Findings indicated that impaired ability to postpone rewards in an experimental laboratory task was strongly related to problematic patterns of MOBA game involvement. Although less consistent, several associations were also found between self-reported impulsivity traits and signs of excessive MOBA game involvement. Conclusions Despite these results are preliminary and based upon a small (self-selected) sample, the present study highlights potential psychological factors related to the addictive use of MOBA games.

  8. Impulsivity in Multiplayer Online Battle Arena Gamers: Preliminary Results on Experimental and Self-Report Measures

    Science.gov (United States)

    Nuyens, Filip; Deleuze, Jory; Maurage, Pierre; Griffiths, Mark D.; Kuss, Daria J.; Billieux, Joël

    2016-01-01

    Background and aims Multiplayer Online Battle Arena (MOBA) games have become the most popular type of video games played worldwide, superseding the playing of Massively Multiplayer Online Role-Playing Games and First-Person Shooter games. However, empirical studies focusing on the use and abuse of MOBA games are still very limited, particularly regarding impulsivity, which is an indicator of addictive states but has not yet been explored in MOBA games. In this context, the objective of the present study is to explore the associations between impulsivity and symptoms of addictive use of MOBA games in a sample of highly involved League of Legends (LoL, currently the most popular MOBA game) gamers. Methods Thirty-six LoL gamers were recruited and completed both experimental (Single Key Impulsivity Paradigm) and self-reported impulsivity assessments (s-UPPS-P Impulsive Behavior Scale, Barratt Impulsiveness Scale), in addition to an assessment of problematic video game use (Problematic Online Gaming Questionnaire). Results Results showed links between impulsivity-related constructs and signs of excessive MOBA game involvement. Findings indicated that impaired ability to postpone rewards in an experimental laboratory task was strongly related to problematic patterns of MOBA game involvement. Although less consistent, several associations were also found between self-reported impulsivity traits and signs of excessive MOBA game involvement. Conclusions Despite these results are preliminary and based upon a small (self-selected) sample, the present study highlights potential psychological factors related to the addictive use of MOBA games. PMID:27156376

  9. Measuring sense of presence and user characteristics to predict effective training in an online simulated virtual environment.

    Science.gov (United States)

    De Leo, Gianluca; Diggs, Leigh A; Radici, Elena; Mastaglio, Thomas W

    2014-02-01

    Virtual-reality solutions have successfully been used to train distributed teams. This study aimed to investigate the correlation between user characteristics and sense of presence in an online virtual-reality environment where distributed teams are trained. A greater sense of presence has the potential to make training in the virtual environment more effective, leading to the formation of teams that perform better in a real environment. Being able to identify, before starting online training, those user characteristics that are predictors of a greater sense of presence can lead to the selection of trainees who would benefit most from the online simulated training. This is an observational study with a retrospective postsurvey of participants' user characteristics and degree of sense of presence. Twenty-nine members from 3 Air Force National Guard Medical Service expeditionary medical support teams participated in an online virtual environment training exercise and completed the Independent Television Commission-Sense of Presence Inventory survey, which measures sense of presence and user characteristics. Nonparametric statistics were applied to determine the statistical significance of user characteristics to sense of presence. Comparing user characteristics to the 4 scales of the Independent Television Commission-Sense of Presence Inventory using Kendall τ test gave the following results: the user characteristics "how often you play video games" (τ(26)=-0.458, Pvirtual environment experience such as dizziness, nausea, headache, and eyestrain. The user characteristic "knowledge of virtual reality" was significantly related to engagement (τ(26)=0.463, Pvirtual environments and experience with gaming environments report a higher sense of presence that indicates that they will likely benefit more from online virtual training. Future research studies could include a larger population of expeditionary medical support, and the results obtained could be used to create

  10. Online absolute pose compensation and steering control of industrial robot based on six degrees of freedom laser measurement

    Science.gov (United States)

    Yang, Juqing; Wang, Dayong; Fan, Baixing; Dong, Dengfeng; Zhou, Weihu

    2017-03-01

    In-situ intelligent manufacturing for large-volume equipment requires industrial robots with absolute high-accuracy positioning and orientation steering control. Conventional robots mainly employ an offline calibration technology to identify and compensate key robotic parameters. However, the dynamic and static parameters of a robot change nonlinearly. It is not possible to acquire a robot's actual parameters and control the absolute pose of the robot with a high accuracy within a large workspace by offline calibration in real-time. This study proposes a real-time online absolute pose steering control method for an industrial robot based on six degrees of freedom laser tracking measurement, which adopts comprehensive compensation and correction of differential movement variables. First, the pose steering control system and robot kinematics error model are constructed, and then the pose error compensation mechanism and algorithm are introduced in detail. By accurately achieving the position and orientation of the robot end-tool, mapping the computed Jacobian matrix of the joint variable and correcting the joint variable, the real-time online absolute pose compensation for an industrial robot is accurately implemented in simulations and experimental tests. The average positioning error is 0.048 mm and orientation accuracy is better than 0.01 deg. The results demonstrate that the proposed method is feasible, and the online absolute accuracy of a robot is sufficiently enhanced.

  11. Can we measure working memory via the Internet? The reliability and factorial validity of an online n-back task

    Directory of Open Access Journals (Sweden)

    Kulikowski Konrad

    2016-04-01

    Full Text Available The aim of this study was to check whether an online n-back task conducted in the uncontrolled environment of the Internet can yield valid and reliable data. For this purpose, 169 participants completed an online n-back task with n1, n2 and n3 blocks on their home computers. The results have shown acceptable reliability for overall accuracy and reaction time indices across n1, n2, n3 blocks, as well as for reaction time indices for each n block. Unacceptable reliability has been found for separate n levels accuracy indices and for response bias indices. Confirmatory factor analysis has revealed that, among 8 proposed measurement models, the best fit for the data collected is a model with two uncorrelated factors: accuracy consisting of n1, n2, n3 indices and reaction time consisting of n2, n3 indices. The results of this study have demonstrated for the first time that a reliable administration of online n-back task is possible and may therefore give rise to new opportunities for working memory research.

  12. On-line measurement of moisture content of powdered food using microwave free-space transmission technique

    International Nuclear Information System (INIS)

    Kim, Ki Bok; Park, Seong Un; Kim, Ji Yeon; Kim, Jong Heon; Lee, ChanJoo

    2006-01-01

    The moisture content of food is not only the most important quality factor but also one of the essential parameters affecting their physical and chemical properties related to storage, capability of processing and quality control. The moisture measurement technique using microwave is very attractive because that method has merits of rapid and accurate measurement in the wider range of moisture content, simple implementation and inexpensive compared with other methods. In this study, microwave free-space transmission technique was applied to measure the moisture content of powdered food. The on-line measurement system consisting of microwave system with 2.5 GHz, 7.0 GHz and 10.5 GHz, conveying device to move the food samples, inlet and outlet of the food samples, guide plate to control the thickness of the food samples, temperature sensing nit, taco-meter and central processing unit having analog to digital convert and microprocessor was constructed and its performance was evaluated.

  13. Evaluation of clinical trials by Ethics Committees in Germany – results and a comparison of two surveys performed among members of the German Association of Research-Based Pharmaceutical Companies (vfa

    Directory of Open Access Journals (Sweden)

    Russ, Hagen

    2015-01-01

    Full Text Available [english] Objective: The objective of this project was to evaluate the quality and quantity of initial applications for a clinical trial according to § 7 of the German Good Clinical Practice (GCP ordinance (German: GCP-Verordnung, GCP-V, the quality of evaluations of those applications by Ethics Committees (ECs/Investigational Review Boards (IRBs in Germany as well as the pattern of EC objections in their reasoned opinions (vote. In order to identify a change over time, the results of the present survey were also compared with a survey performed in 2008.Methods: Based on reasoned opinions issued by the respective EC in charge of the coordinating principle investigator (coordinating EC in 2011, a written survey among members of the German Association of Research-Based Pharmaceutical Companies (vfa was conducted in 2012. The answers to the questionnaire were analyzed descriptively. Since the data set collected in 2011 was structurally identical with the data set gained in 2007 both surveys were compared.Results: Of the 24 companies represented on the vfa Clinical Research/Quality Assurance Subcommittee, 75% (18 took part in the survey. Survey evaluation was based on a total of 251 applications of these 18 companies submitted to 43 ECs. These account for about 21% of 1,214 applications for authorization of commercial and non-commercial phase I–IV clinical trials submitted to the regulatory authorities (BfArM and PEI in 2011.In comparison to 2007, a lower amount of applications (n=251 in 2011 vs. n=288 in 2007 was submitted to a slightly higher number of ECs (43 in 2011 vs. 40 in 2007. The amount of objections increased by 21% from 1,299 (2007 to 1,574 (2011 resulting in an average of 4.5 (2007 vs. 6.3 (2011 objections per application. Overall, the analysis of both formal and content related objections revealed almost the same pattern as in the previous survey. In total, the most frequent objections applied to the patient information and consent

  14. Evaluation of clinical trials by Ethics Committees in Germany--results and a comparison of two surveys performed among members of the German Association of Research-Based Pharmaceutical Companies (vfa).

    Science.gov (United States)

    Russ, Hagen; Busta, Susanne; Jost, Bertfried; Bethke, Thomas D

    2015-01-01

    The objective of this project was to evaluate the quality and quantity of initial applications for a clinical trial according to § 7 of the German Good Clinical Practice (GCP) ordinance (German: GCP-Verordnung, GCP-V), the quality of evaluations of those applications by Ethics Committees (ECs)/Investigational Review Boards (IRBs) in Germany as well as the pattern of EC objections in their reasoned opinions (vote). In order to identify a change over time, the results of the present survey were also compared with a survey performed in 2008. Based on reasoned opinions issued by the respective EC in charge of the coordinating principle investigator (coordinating EC) in 2011, a written survey among members of the German Association of Research-Based Pharmaceutical Companies (vfa) was conducted in 2012. The answers to the questionnaire were analyzed descriptively. Since the data set collected in 2011 was structurally identical with the data set gained in 2007 both surveys were compared. Of the 24 companies represented on the vfa Clinical Research/Quality Assurance Subcommittee, 75% (18) took part in the survey. Survey evaluation was based on a total of 251 applications of these 18 companies submitted to 43 ECs. These account for about 21% of 1,214 applications for authorization of commercial and non-commercial phase I-IV clinical trials submitted to the regulatory authorities (BfArM and PEI) in 2011. In comparison to 2007, a lower amount of applications (n=251 in 2011 vs. n=288 in 2007) was submitted to a slightly higher number of ECs (43 in 2011 vs. 40 in 2007). The amount of objections increased by 21% from 1,299 (2007) to 1,574 (2011) resulting in an average of 4.5 (2007) vs. 6.3 (2011) objections per application. Overall, the analysis of both formal and content related objections revealed almost the same pattern as in the previous survey. In total, the most frequent objections applied to the patient information and consent form followed in descending order by trial

  15. Wind turbine transformer admittance characterization based on online time-domain measurements and preliminary results from measurements done in two transformers using a SFRA

    DEFF Research Database (Denmark)

    Arana Aristi, Iván; Holbøll, Joachim; Nielsen, Arne Hejde

    2009-01-01

    This paper presents the analysis of online time-domain measurements on the primary and secondary side of a wind turbine transformer in an Offshore Wind Farm (OWF), during one switching operation realized in the collection grid. The frequency characteristics up to 10 kHz of the current and voltage...... signals of each phase were compared and the transformers admittance characteristic was estimated based on these measurements. Based on the results from the previous analysis, it was decided to acquire a Sweep Frequency Response Analyzer (SFRA) to realize detailed transformer measurements. First...... the results from the measurements in a small dry-type transformer under laboratory conditions are presented, and finally the results from a large transformer measured in a in an industrial setting are shown....

  16. Online Resources

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Online Resources. Journal of Genetics. Online Resources. Volume 97. 2018 | Online resources. Volume 96. 2017 | Online resources. Volume 95. 2016 | Online resources. Volume 94. 2015 | Online resources. Volume 93. 2014 | Online resources. Volume 92. 2013 | Online resources ...

  17. DEVELOPMENT OF AN ON-LINE, REAL-TIME ALPHA RADIATION MEASURING INSTRUMENT FOR LIQUID STREAMS

    International Nuclear Information System (INIS)

    Unknown

    1999-01-01

    Thermo Power Corporation has proven the technical viability of an on-line, real-time alpha radionuclide instrument for aqueous sample analysis through laboratory and initial field tests of the instrument. The instrument has been shown to be isotonically sensitive to extremely low (ten parts per trillion, or femto Curies per liter) levels of a broad range of radioisotopes. Performance enhancement and other scaling data obtained during the course of this investigation have shown that on-line, real-time operation is possible, with a sub 30-minute response time analyzing 20 ppb (30 pCi/1) natural uranium. Now that these initial field tests in Oak Ridge, Tennessee have been successfully completed, Thermo Power plans to conduct comprehensive field tests of the instrument. The purpose of these endurance tests will be to determine the endurance characteristics of the Thermo Alpha Monitor for Water when it is used by non-Thermo Power personnel in a series of one or more extended field tests. Such endurance testing is the vital next step towards the commercialization of the Alpha Monitor. Subsequently, it will be possible to provide the DOE with an instrument that has the capability of obtaining rapid feedback about the concentrations of alpha-emitting isotope contamination in effluent water streams (Subsurface Contaminants Focus Area). It will also be useful for process control of remediation and D and D operations such as monitoring scrubber/rinse water radioactivity levels (Mixed Waste, Plutonium and D and D Focus Areas)

  18. Processing of Scalar Inferences by Mandarin Learners of English: An Online Measure.

    Directory of Open Access Journals (Sweden)

    Yowyu Lin

    Full Text Available Scalar inferences represent the condition when a speaker uses a weaker expression such as some in a pragmatic scale like , and s/he has the intention to reject the stronger use of the other word like all in the utterance. Considerable disagreement has arisen concerning how interlocutors derive the inferences. The study presented here tries to address this issue by examining online scalar inferences among Mandarin learners of English. To date, Default Inference and Relevance Theory have made different predictions regarding how people process scalar inferences. Findings from recently emerging first language studies did not fully resolved the debate but led to even more heated debates. The current three online psycholinguistic experiments reported here tried to address the processing of scalar inferences from second language perspective. Results showed that Mandarin learners of English showed faster reaction times and a higher acceptance rate when interpreting some as some but not all and this was true even when subjects were under time pressure, which was manifested in Experiment 2. Overall, the results of the experiments supported Default Theory. In addition, Experiment 3 also found that working memory capacity plays a critical role during scalar inference processing. High span readers were faster in accepting the some but not all interpretation than low span readers. However, compared with low span readers, high span readers were more likely to accept the some and possibly all condition, possibly due to their working memory capacity to generate scenarios to fit the interpretation.

  19. On-line measurement of gaseous iodine species during a PWR severe accident

    Energy Technology Data Exchange (ETDEWEB)

    Haykal, I.; Doizi, D. [CEA, DEN, Departement de Physico-chimie, 91191 Gif sur Yvette Cedex, (France); Perrin, A. [CNRS-University of Paris Est and Paris 7, Laboratoire Inter-Universitaire des Systemes Atmospheriques, 94010 Creteil, (France); Vincent, B. [University of Burgundy, Laboratoire de physique, CNRS UMR 5027, 9, Avenue Alain Savary, BP 47870, F-21078 Dijon Cedex, (France); Manceron, L. [Synchrotron SOLEIL, L' Orme des Merisiers, St-Aubin BP48, 91192 Gif-sur-Yvette Cedex, (France); Mejean, G. [University of Joseph Fourier in Grenoble, Laboratoire de Spectrometrie Physique-CNRS UMR 5588, 38402 Saint Martin d' Heres, (France); Ducros, G. [CEA Cadarache, CEA, DEN, Departement d' Etudes des Combustibles, 13108 Saint-Paul-lez-Durance cedex, (France)

    2015-07-01

    A long-range remote sensing of severe accidents in nuclear power plants can be obtained by monitoring the online emission of volatile fission products such as xenon, krypton, caesium and iodine. The nuclear accident in Fukushima was ranked at level 7 of the International Nuclear Event Scale by the NISA (Nuclear and Industrial Safety Agency) according to the importance of the radionuclide release and the off-site impact. Among volatile fission products, iodine species are of high concern, since they can be released under aerosols as well as gaseous forms. Four years after the Fukushima accident, the aerosol/gaseous partition is still not clear. Since the iodine gaseous forms are less efficiently trapped by the Filtered Containment Venting Systems than aerosol forms, it is of crucial importance to monitor them on-line during a nuclear accident, in order to improve the source term assessment in such a situation. Therefore, we propose to detect and quantify these iodine gaseous forms by the use of highly sensitive optical methods. (authors)

  20. Measuring e-Commerce service quality from online customer review using sentiment analysis

    Science.gov (United States)

    Kencana Sari, Puspita; Alamsyah, Andry; Wibowo, Sulistyo

    2018-03-01

    The biggest e-Commerce challenge to understand their market is to chart their level of service quality according to customer perception. The opportunities to collect user perception through online user review is considered faster methodology than conducting direct sampling methodology. To understand the service quality level, sentiment analysis methodology is used to classify the reviews into positive and negative sentiment for five dimensions of electronic service quality (e-Servqual). As case study in this research, we use Tokopedia, one of the biggest e-Commerce service in Indonesia. We obtain the online review comments about Tokopedia service quality during several month observations. The Naïve Bayes classification methodology is applied for the reason of its high-level accuracy and support large data processing. The result revealed that personalization and reliability dimension required more attention because have high negative sentiment. Meanwhile, trust and web design dimension have high positive sentiments that means it has very good services. The responsiveness dimension have balance sentiment positive and negative.

  1. Optoelectronic system of online measurements of unburned carbon in coal fly ash

    Science.gov (United States)

    Golas, Janusz; Jankowski, Henryk; Niewczas, Bogdan; Piechna, Janusz; Skiba, Antoni; Szkutnik, Wojciech; Szkutnik, Zdzislaw P.; Wartak, Ryszarda; Worek, Cezary

    2001-08-01

    Carbon-in-ash level is an important consideration for combustion efficiency as well as ash marketing. The optoelectronic analyzing system for on-line determination and monitoring of the u burned carbon content of ash samples is presented. The apparatus operates on the principle that carbon content is proportional to the reflectance of IR light. Ash samples are collected iso kinetically from the flue gas duct and placed in a sample tube with a flat glass bottom. The same is then exposed to a light. The reflectance intensity is used by the system's computer to determine residual carbon content from correlation curves. The sample is then air purged back to the duct or to the attached sample canister to enable laboratory check analysis. The total cycle time takes between 5 and 10 minutes. Real time result of carbon content with accuracy 0.3-0.7 percent are reported and can be used for boiler controlling.

  2. Translating the Science of Measuring Ecosystems at a National Scale: Developing NEON's Online Learning Portal

    Science.gov (United States)

    Wasser, L. A.; Gram, W.; Goehring, L.

    2014-12-01

    "Big Data" are becoming increasingly common in many fields. The National Ecological Observatory Network (NEON) will be collecting data over the 30 years, using consistent, standardized methods across the United States. These freely available new data provide an opportunity for increased understanding of continental- and global scale processes such as changes in vegetation structure and condition, biodiversity and landuse. However, while "big data" are becoming more accessible and available, integrating big data into the university courses is challenging. New and potentially unfamiliar data types and associated processing methods, required to work with a growing diversity of available data, may warrant time and resources that present a barrier to classroom integration. Analysis of these big datasets may further present a challenge given large file sizes, and uncertainty regarding best methods to properly statistically summarize and analyze results. Finally, teaching resources, in the form of demonstrative illustrations, and other supporting media that might help teach key data concepts, take time to find and more time to develop. Available resources are often spread widely across multi-online spaces. This presentation will overview the development of NEON's collaborative University-focused online education portal. Portal content will include 1) videos and supporting graphics that explain key concepts related to NEON data products including collection methods, key metadata to consider and consideration of potential error and uncertainty surrounding data analysis; and 2) packaged "lab" activities that include supporting data to be used in an ecology, biology or earth science classroom. To facilitate broad use in classrooms, lab activities will take advantage of freely and commonly available processing tools, techniques and scripts. All NEON materials are being developed in collaboration with existing labs and organizations.

  3. Lung toxicity determination by in vitro exposure at the air liquid interface with an integrated online dose measurement

    International Nuclear Information System (INIS)

    Muelhopt, Sonja; Paur, H-R; Diabate, S; Weiss, C; Krebs, T

    2009-01-01

    Epidemiological studies show an association between the concentration of ultrafine particles in the atmosphere and the rate of mortality or morbidity due to respiratory and cardiovascular diseases. For the quantitative assessment of the toxicity of airborne nanoparticles the dose-response relationship is tested in in vitro test systems using bioassays of cell cultures as sensor. For the air-liquid interface exposure of cell cultures towards aerosols the Karlsruhe exposure system was developed. The human lung cell cultures are exposed in VITROCELL (registered) system modules with a constant flow of the conditioned aerosol. After exposure the cells are analyzed to measure the biological responses such as viability, inflammatory or oxidative stress. For the determination of the dose response relationship the accurate knowledge of the deposited particle mass is essential. A new online method is developed in the Karlsruhe exposure system: the sensor of a quartz crystal microbalance is placed in an exposure chamber instead of the membrane insert and exposed to the aerosol in the same way as the cell cultures. The deposited mass per area unit is monitored as a function of exposure time showing a linear relationship for a constant aerosol flow with defined particle concentration. A comparison of this new dose signal to a dosimetry method using fluorescein sodium particles shows a very good correlation between the sensor signal of the quartz crystal microbalance and the deposited mass on the membranes shown by spectroscopy. This system for the first time provides an online dose measurement for in vitro experiments with nanoparticles.

  4. The Amalgamation of SVR and ANFIS Models with Synchronized Phasor Measurements for On-Line Voltage Stability Assessment

    Directory of Open Access Journals (Sweden)

    Mohammed Amroune

    2017-10-01

    Full Text Available This paper presents the application of support vector regression (SVR and adaptive neuro-fuzzy inference system (ANFIS models that are amalgamated with synchronized phasor measurements for on-line voltage stability assessment. As the performance of SVR model extremely depends on the good selection of its parameters, the recently developed ant lion optimizer (ALO is adapted to seek for the SVR’s optimal parameters. In particular, the input vector of ALO-SVR and ANFIS soft computing models is provided in the form of voltage magnitudes provided by the phasor measurement units (PMUs. In order to investigate the effectiveness of ALO-SVR and ANFIS models towards performing the on-line voltage stability assessment, in-depth analyses on the results have been carried out on the IEEE 30-bus and IEEE 118-bus test systems considering different topologies and operating conditions. Two statistical performance criteria of root mean square error (RMSE and correlation coefficient (R were considered as metrics to further assess both of the modeling performances in contrast with the power flow equations. The results have demonstrated that the ALO-SVR model is able to predict the voltage stability margin with greater accuracy compared to the ANFIS model.

  5. On-line fission products measurements during a PWR severe accident: the French DECA-PF project

    Energy Technology Data Exchange (ETDEWEB)

    Ducros, G.; Allinei, P.G.; Roure, C. [CEA, DEN, F-13108 Saint-Paul-lez-Durance, (France); Rozel, C. [EDF SEPTEN, 12-14 Avenue Dutrievoz, F-69628, Villeurbanne, (France); Blanc De Lanaute, N. [CANBERRA, 1 rue des Herons, F-78182, Saint Quentin en Yvelines, (France); Musoyan, G. [AREVA, Tour AREVA, 1 place Jean Millier, F-92084 Paris La Defense Cedex, (France)

    2015-07-01

    Following the Fukushima accident, a lot of recommendations was drawn by international organizations (IAEA, OECD, NUGENIA network...) in order to improve the safety in such accidental conditions and mitigate their consequences. One of these recommendations was to improve the robustness of the instrumentation, which was dramatically lacking at Fukushima, as well as to better determine the Source Term involved in nuclear accident. The DECA-PF project (Diagnosis of a degraded reactor core through Fission Product measurements) was elaborated in this context and selected as one of 21 collaborative R and D projects in the field of nuclear safety and radioprotection, funded in May 2013 by the French National Research Agency. Over the months following the Fukushima accident, a CEA crisis team was held in order to analyze on-line the situation taking into account the data delivered by TEPCO and other organizations. Despite the difficulties encountered concerning the reliability of these data, the work performed showed the high capacity of Fission Products (FP) measurements to get a diagnosis relative to the status of the reactors and the spent fuel pools (SFP). Based on these FP measurements, it was possible to conclude that the main origin of the releases was coming from the cores and not from the SFP, in particular for SFP-4 which was of high concern, and that the degradation level of the reactors was very large, including probably an extensive core melting. To improve the reliability of this kind of diagnosis, the necessity to get such measurements as soon as possible after the accident and as near as possible from the reactor was stressed. In this way the present DECA-PF project intends to develop a new and innovative instrumentation taking into account the design of the French nuclear power plants on which sand bed filters have been implemented for severe accident management. Three complementary techniques, devoted to measure the FP release on-line, are being studied

  6. Experimental study to optimize time resolution and detection limit of online 222Rn-in-water measurements

    International Nuclear Information System (INIS)

    Just, G.; Freyer, K.; Treutler, H.C.; Philipsborn, H. von

    2001-01-01

    The possibility to detect short-term variations of the activity concentration of 222 Rn in water by online monitoring with temporal resolutions of a few minutes and a lower limit of detection of about 1 Bq/l enhances the applicability of such measurements. New applications would be possible in the field of hydro-geology in which Rn is used as tracer gas, the monitoring of pumping procedures, for the study of exchange processes during groundwater sampling and for various applications with geophysical effects. A suitable, simple method is the measuring principle proposed by Surbeck (Fribourg) some years ago which is based on the separation of air and water by a diffusion membrane. Process parameters enhancing the time resolution of the method as well as the efficiency of different radon detectors have been studied. (orig.) [de

  7. On-line measurement with automatic emulsion analysis system and off-line data processing (E531 neutrino experiment)

    International Nuclear Information System (INIS)

    Miyanishi, Motoaki

    1984-01-01

    The automatic emulsion analysis system developed by Nagoya cosmic ray observation group was practically used for the experiment (FNAL-E531) on determining the lifetime of charm particles for the first time in the world, and achieved a great successful result. The system consists of four large precise coordinate-measuring stages capable of conducting simultaneous measurement and multiple (currently four) DOMS (digitized on-line microscope), supported with one mini-computer (ECLIPS S/130). The purpose of E531 experiment was the determination of charm particle lifetime. The experiment was carried out at FNAL, USA, and by the irradiation of wide band ν sub(μ) beam equivalent to 7 x 10 18 of 350 GeV/c protons. The detector was a hybrid system of emulsions and a counter spectrometer. The scan of neutrino reaction, the scan of charm particles, and charm event measurement were analyzed in emulsions, and the on-line programs for-respective analyses were created. Nagoya group has found 726 neutrino reactions in the first run, obtained 37 charm particle candidates, and found 1442 neutrino reactions in the second run, and obtained 56 charm particle candidates. The capability of the automatic emulsion analysis system in terms of the time equired for analysis is in total 3.5 hours per event; 15 minutes for C.S. scan, 15 minutes for coupling to module, 20 minutes for tracing to vertex, 1 hour for neutrino reaction measurement, 10 minutes for offline data processing and 1.5 hours for charm particle scanning. (Wakatsuki, Y.)

  8. Signal processing and general purpose data acquisition system for on-line tomographic measurements

    Science.gov (United States)

    Murari, A.; Martin, P.; Hemming, O.; Manduchi, G.; Marrelli, L.; Taliercio, C.; Hoffmann, A.

    1997-01-01

    New analog signal conditioning electronics and data acquisition systems have been developed for the soft x-ray and bolometric tomography diagnostic in the reverse field pinch experiment (RFX). For the soft x-ray detectors the analog signal processing includes a fully differential current to voltage conversion, with up to a 200 kHz bandwidth. For the bolometers, a 50 kHz carrier frequency amplifier allows a maximum bandwidth of 10 kHz. In both cases the analog signals are digitized with a 1 MHz sampling rate close to the diagnostic and are transmitted via a transparent asynchronous xmitter/receiver interface (TAXI) link to purpose built Versa Module Europa (VME) modules which perform data acquisition. A software library has been developed for data preprocessing and tomographic reconstruction. It has been written in C language and is self-contained, i.e., no additional mathematical library is required. The package is therefore platform-free: in particular it can perform online analysis in a real-time application, such as continuous display and feedback, and is portable for long duration fusion or other physical experiments. Due to the modular organization of the library, new preprocessing and analysis modules can be easily integrated in the environment. This software is implemented in RFX over three different platforms: open VMS, digital Unix, and VME 68040 CPU.

  9. Spectroscopic and physicochemical measurements for on-line monitoring of used nuclear fuel separation processes

    Energy Technology Data Exchange (ETDEWEB)

    Nee, Ko; Nilsson, M. [Department of Chemical Engineering and Material Science, University of California, 916 Engineering Tower, Irvine, CA 92697-2575 (United States); Bryan, S.; Levitskaia, T. [Pacific Northwest National Laboratory, PO BOX 999, Richland, CA 99352 (United States)

    2013-07-01

    Separation processes for used nuclear fuel are often complicated and challenging due to the high constraints in purity of the products and safeguards of the process streams. In order to achieve a safe, secure and efficient separation process, the liquid streams in the separation process require close monitoring. Due to the high radiation environment, sampling of the materials is difficult. Availability of a detection technique that is remote, non-destructive and can avoid time-delay caused by retrieving samples would be beneficial and could minimize the exposure to personnel and provide material accountancy to avoid diversion (non-proliferation). For example, Ultra Violet (UV), Visible (Vis), Near-Infrared (NIR) and Raman spectroscopy that detect and quantify elements present in used nuclear fuel, e.g. lanthanides, actinides and molecules such as nitrate, can be used. In this work, we have carried out NIR and Raman spectroscopy to study aqueous solutions composed of different concentrations of nitric acid, sodium nitrate, and neodymium at varied temperatures. A chemometric model for online monitoring based on the PLS-Toolbox (MATLAB) software has been developed and validated to provide chemical composition of process streams based on spectroscopic data. In conclusion, both of our NIR and Raman spectra were useful for H{sup +} and NO{sub 3} prediction, and only NIR was helpful for the Nd{sup 3+} prediction.

  10. Application of round grating angle measurement composite error amendment in the online measurement accuracy improvement of large diameter

    Science.gov (United States)

    Wang, Biao; Yu, Xiaofen; Li, Qinzhao; Zheng, Yu

    2008-10-01

    The paper aiming at the influence factor of round grating dividing error, rolling-wheel produce eccentricity and surface shape errors provides an amendment method based on rolling-wheel to get the composite error model which includes all influence factors above, and then corrects the non-circle measurement angle error of the rolling-wheel. We make soft simulation verification and have experiment; the result indicates that the composite error amendment method can improve the diameter measurement accuracy with rolling-wheel theory. It has wide application prospect for the measurement accuracy higher than 5 μm/m.

  11. How accurately do instructors judge students' attitudes online? A measurement of expectations and level of satisfaction with an Online Information Systems masters program

    Directory of Open Access Journals (Sweden)

    Lauren-Nicole Macht

    2002-12-01

    Full Text Available In order to run a successful educational program, instructors as well as staff members must constantly review and adapt to the expectations, concerns, demographics and satisfaction level of their student consumers. This study was conducted in order to examine these issues in an online educational setting. First, interviews were given to the program instructors in order to determine their opinions about the students' expectations and satisfaction levels. This information was then used to create a student survey that assessed the students' expectations and level of satisfaction. These two sets of results were then compared This comparison revealed that the online instructors did have a good grasp of the online students' expectations, concerns, demographics and satisfaction level. The only areas where the instructors' concepts of student views were slightly less accurate was student concerns and student feelings about the program administration, where the instructors overestimated the level of concern the students had about successfully returning to the learning environment and underestimated the students' satisfaction with the program's administration. This leads us to conclude that, even with the added online factor, instructors strongly understand student expectations, satisfaction levels, demographics and concerns.

  12. Measuring Qatari Women’s Progress Through Reactions to Online Behavior

    Directory of Open Access Journals (Sweden)

    Mohanalakshmi Rajakumar

    2017-02-01

    Full Text Available The close kinship structure of the Gulf Cooperation Council countries of Oman, Kuwait, Saudi Arabia, Qatar, Bahrain, and the United Arab Emirates (UAE means that appeasing one’s family often supersedes personal aspirations. The family occupies a central space in the life of the individual, one that mimics the state’s involvement in the everyday lives of its citizens. Within such a context we need a new framework to understand how women’s private choices have sociopolitical implications. Qatari women are ensconced within the political and economic stability of the Arabian Gulf. The Western feminist tropes of activism and advocacy, as have been studied in Egypt and other Arab countries affected by the Arab uprisings of 2011, cannot characterize Qatari women’s behavior on social media. Yet the degree to which women present themselves online, using their real names, is a form of agency important to their context. Qatari women also use social media in order to educate themselves about the personalities and activities of potential spouses. Similarly, male Qataris consider certain behaviors as disqualifiers for potential brides. We discuss these trends within the larger context of Qatari society and the dichotomy between modernization and traditional culture in the Arabian context. This article arose out of a larger study about contemporary marriage practices and attitudes toward partner selection in Qatar today. The ways in which both males and females analyze the social media usage of potential partners is an interesting ancillary discussion against the backdrop of larger trends in Qatari society.

  13. On-line component ratio measurement of oil/gas/water mixtures using an admittance sensor

    Energy Technology Data Exchange (ETDEWEB)

    Andersen, J A

    1984-01-01

    The operator of a production platform is primarily interested in which types of fluids a well is producing and how quickly these different components are being produced. The component ratio and production rate of a well vary during the life of a field. To optimize production, measurement of each well's output is thus desirable. Current designs for subsea production systems lack means of continuously measuring three-component flows. A new method of component ratio measurement is described. The fraction of oil, gas and water flowing between two insulated electrode plates is determined by measuring both the electrical conductance and suseptance across the sensor. A preliminary evaluation of the new measurement system has been performed using a process oil/ water/air mixture. The method is not limited to small pipe diameters. The only possible limitation is that for low velocities in very large pipe diameters an in-line mixer may be required. Advantages of this new system are that real-time measurement of void fraction and water content is possible if a non-intrusive rugged sensor is used, and there are no range limitations, as each component may be measured for any given concentration. 4 references.

  14. Organization of the M-6000 computer calculating process in the CAMAC on-line measurement systems for a physical experiment

    International Nuclear Information System (INIS)

    Bespalova, T.V.; Volkov, A.S.; Golutvin, I.A.; Maslov, V.V.; Nevskaya, N.A.; Okonishnikov, A.A.; Terekhov, V.E.; Shilkin, I.P.

    1977-01-01

    Discussed are the basic results of the work on designing the software of the computer measuring complex (CMC) which uses the M-6000 computer and operates on line with an accelerator. All the CMC units comply with the CAMAC standard. The CMC incorporates a mainframe memory, twenty-four kilobytes of 16-digit words in size, and external memory on magnetic disks, 1 megabyte in size. Suggested is a modification of the technique for designing the CMC software providing for program complexes which are dynamically adjusted by an experimentalist for the given experiment for a short time. The CMC software comprises the following major portions: a software generator, data acquisition program, on-line data processing routines, off-line data processing programs and programs for data recording on magnetic tapes and disks. Testing of the designed CMC has revealed that the total data processing time equals to from 150 to 500 ms

  15. Monte Carlo aided treatments of the nonlinear inverse PGNAA measurement problem for various continuous on-line applications

    International Nuclear Information System (INIS)

    Gardner, R.P.; Guo, P.; Sood, A.; Mayo, C.W.; Dobbs, C.L.

    1998-01-01

    A review of our work on the application of the PGNAA method as applied to five industrial applications is given. Some introductory material is first given on the importance and use of Monte Carlo simulation in this area, some comments on the place of PGNAA in elemental analysis, and a brief description of the Monte Carlo - Library Least-Squares (MCLLS) approach to the nonlinear inverse PGNAA analysis problem. Then the applications of PGNAA are discussed for: (1) on-line bulk coal analysis, (2) nuclear oil well logging, (3) vitrified waste, (4) the analysis of sodium and aluminium in 'green liquor' in the presence of chlorine, and (5) the conveyor belt sorting of aluminum alloy samples. It is concluded that PGNAA is a rapidly emerging important new technology and measurement approach. (author)

  16. Online junction temperature measurement via internal gate resistance during turn-on

    DEFF Research Database (Denmark)

    Baker, Nick; Munk-Nielsen, Stig; Liserre, Marco

    2014-01-01

    A new method for junction temperature measurement of power semiconductor switches is presented. The measurement exploits the temperature dependent resistance of the temperature sensitive electrical parameter (TSEP): the internal gate resistance. This dependence can be observed during the normal...... switching transitions of an IGBT or MOSFET, and as a result the presented method uses the integral of the gate voltage during the turn-on delay. A measurement circuit can be integrated into a gate driver with no modification to converter or gate driver operation and holds significant advantages over other...

  17. VizieR Online Data Catalog: Pulsar rotation measures (Han+, 2018)

    Science.gov (United States)

    Han, J. L.; Manchester, R. N.; van Straten, W.; Demorest, P.

    2018-03-01

    The Parkes 64m observations were made in seven sessions between 2006 August and 2008 February. All observations were in the 20cm band. The Green Bank 100m telescopes (GBT) observations were made in 2007 November using the 800MHz prime focus receiver. The Green Bank Astronomy Signal Processor pulsar observing system was used with a central frequency of 774MHz and a bandwidth of 96MHz. We have measured rotation measures for 477 pulsars, of which 441 are either new or improved over previous measurements. (3 data files).

  18. On-line fast response device and method for measuring dissolved gas in a fluid

    Science.gov (United States)

    Tutu, Narinder Kumar [Manorville, NY

    2011-01-11

    A method and device for the measurement of dissolved gas within a fluid. The fluid, substantially a liquid, is pumped into a pipe. The flow of the fluid is temporally restricted, creating one or more low pressure regions. A measurement indicative of trapped air is taken before and after the restriction. The amount of dissolved air is calculated from the difference between the first and second measurements. Preferably measurements indicative of trapped air is obtained from one or more pressure transducers, capacitance transducers, or combinations thereof. In the alternative, other methods such as those utilizing x-rays or gamma rays may also be used to detect trapped air. Preferably, the fluid is a hydraulic fluid, whereby dissolved air in the fluid is detected.

  19. New method of noncontact temperature measurement in on-line textile production

    Science.gov (United States)

    Cheng, Xianping; Song, Xing-Li; Deng, Xing-Zhong

    1993-09-01

    Based on the condition of textile production the method of infrared non-contact temperature measurement is adcpted in the heat-setting and drying heat-treatment process . This method is used to monitor the moving cloth. The temperature of the cloth is displayed rapidly and exactly. The principle of the temperature measurement is analysed theoretically in this paper. Mathematical analysis and calculation are used for introducing signal transmitting method. Adopted method of combining software with hardware the temperature is corrected and compensated with the aid of a single-chip microcomputer. The results of test indicate that the application of temperature measurement instrument provides reliable parameters in the quality control. And it is an important measure on improving the quality of products.

  20. Multi Parameter Flow Meter for On-Line Measurement of Gas Mixture Composition

    Directory of Open Access Journals (Sweden)

    Egbert van der Wouden

    2015-04-01

    Full Text Available In this paper we describe the development of a system and model to analyze the composition of gas mixtures up to four components. The system consists of a Coriolis mass flow sensor, density, pressure and thermal flow sensor. With this system it is possible to measure the viscosity, density, heat capacity and flow rate of the medium. In a next step the composition can be analyzed if the constituents of the mixture are known. This makes the approach universally applicable to all gasses as long as the number of components does not exceed the number of measured properties and as long as the properties are measured with a sufficient accuracy. We present measurements with binary and ternary gas mixtures, on compositions that range over an order of magnitude in value for the physical properties. Two platforms for analyses are presented. The first platform consists of sensors realized with MEMS fabrication technology. This approach allows for a system with a high level of integration. With this system we demonstrate a proof of principle for the analyses of binary mixtures with an accuracy of 10%. In the second platform we utilize more mature steel sensor technology to demonstrate the potential of this approach. We show that with this technique, binary mixtures can be measured within 1% and ternary gas mixtures within 3%.

  1. Detection of microbial contaminations in drinking water using ATP measurements – evaluating potential for online monitoring

    DEFF Research Database (Denmark)

    Vang, Óluva Karin; Corfitzen, Charlotte B.; Albrechtsen, Hans-Jørgen

    2011-01-01

    There is an increasing call for fast and reliable methods for continuous monitoring of microbial drinking water quality in order to protect public health. The potential for Adenosine triphosphate (ATP) measurements as a real-time analysis for continuous monitoring of microbial drinking water...... quality was investigated through simulation of two contamination scenarios, i.e. drinking water contaminated with waste water and surface water at various concentrations. With ATP measurements it was possible to detect waste water diluted 1000-10,000 times in drinking water depending on sensitivity...... of reagent kit. Surface water diluted 100-1000 times was detected in drinking water with ATP measurements. ATP has the potential as an early warning tool, especially in the period when the contamination concentration is high. 2011 © American Water Works Association AWWA WQTC Conference Proceedings All Rights...

  2. On-line gamma spectroscopy measuring station for cover gas monitoring at KNK II

    International Nuclear Information System (INIS)

    Hoffmann, G.; Letz, K.D.

    1980-02-01

    An automated Ge-γ-spectrometer was developed for cover gas monitoring at KNK II which, by the gamma spectra measured, is to allow the following statements to be made on fuel cladding failure: Type, size, variation with time and subsequent development of the failure. In this report the hardware and software will be explained. Besides, an instruction manual was written for the measuring station, which allows to operate it without detailed knowledge of the manuals for the individual hardware components. (orig.) 891 HP/orig. 892 MKO [de

  3. On-line nuclear half life and spectroscopic measurements on mass-separated fission product nuclei

    International Nuclear Information System (INIS)

    McDonald, J.; Fogelberg, B.; Baecklin, A.

    1979-01-01

    A description is given of the methods and equipment employed for nuclear spectroscopy studies of short lived fission product nuclei at the OSIRIS ISOL facility in Studsvik, Sweden. Furthermore a table of new nuclear half-lives measured with this equipment is presented. (author)

  4. On-line display used with cathode ray tube film measuring device

    International Nuclear Information System (INIS)

    Fortney, L.R.; Robertson, W.J.

    1981-01-01

    An improved display has been developed for use on our computer controlled measuring device (RIPPLE). The device features a television image of the film and a digital presentation on the same X, Y display. The television image is formed using a modified left and right raster scan which can cover 50% more area in the same time as the traditional raster

  5. VizieR Online Data Catalog: JMDC : JMMC Measured Stellar Diameters Catalogue (Duvert, 2016)

    Science.gov (United States)

    Duvert, G.

    2016-11-01

    Several star diameter compilations exist that contain a fair amount of stellar angular diameter measurements. The CADARS (2011, Cat. II/224) has entries for 6888 stars and claims completeness up to 1997. CHARM2 (2005, Cat. J/A+A/431/773) lists 8231 measurements of 3243 stars, up to 2005. However all these catalogs mix results from very direct methods, such as intensity interferometry, with indirect methods, or spectrophotometric estimates of various kind (always including some model of the star), or linear diameters from eclipsing binaries (1600 entries in CADARS), which need some modelling of the two stars, as well as a good estimate of the distance to be converted into an angular diameter. In contrary, the present catalogue, called JMDC (for JMMC Measured stellar Diameters Catalog) is focussed on direct methods only, and selects only one value of the uniform-disk diameter (UDD) and limb-darkened diameter (LDD) for each historical measurement. It should be regularly updated via a specialized submission tool that will be made available on the JMMC website (www.jmmc.fr). The current version gathers 1478 measurements that have been published since the first experiments by Michelson. Prior to 1997, our bibliography relies only on the reference list of CADARS, carefully reviewed. After this date we used NASA's ADS hosted at CDS. We retained only the measurements obtained from visible/IR interferometry, intensity interferometry and lunar occultation in the database. We always retrieved the values in the original text and used SIMBAD to properly and uniquely identify the stars. The three techniques retained share the same method of converting the measurements (squared visibilities for optical interferometry, correlation of photon-counts for intensity interferometry, fast photometry for lunar occultations) into an angular diameter: fitting a geometrical function into the values, in many cases a uniform disk, which provides a uniform disk diameter (UDD) value. This UDD is

  6. Optical fiber couplers for spectrophotometry. Perspectives for in-situ on-line and remote measurements

    International Nuclear Information System (INIS)

    Boisde, G.; Linger, C.; Chevalier, G.; Perez, J.J.

    1983-01-01

    Optical fiber couplers have been developed specially for nuclear chemical spectrophotometric applications. Coupling devices are described for TELEPHOT industrial photometers and some commercial spectrophotometer, together with the probes and measurement cells employed. The value of optical multiplexing is mentioned. Non nuclear applications in medical analysis are also mentioned, together with the possibilities offered by these devices for uses other than spectrophotometry [fr

  7. Online Measurements of Highly Oxidized Organics in the Gas and Particle phase during SOAS and SENEX

    Science.gov (United States)

    Lopez-Hilfiker, F.; Lee, B. H.; Mohr, C.; Ehn, M.; Rubach, F.; Mentel, T. F.; Kleist, E.; Thornton, J. A.

    2014-12-01

    We present measurements of a large suite of gas and particle phase organic compounds made with a Filter Inlet for Gas and AEROsol (FIGAERO) coupled to a high resolution time of flight chemical ionization mass spectrometer (HR-ToF-CIMS) developed at the University of Washington and with airborne HR-ToF-CIMS measurements. The FIGAERO instrument was deployed on the Jülich Plant Atmosphere Chamber to study α-pinene oxidation, and subsequently at the SMEAR II forest station in Hyytiälä, Finland and the SOAS ground site, in Brent Alabama. During the Southern Atmosphere Study, a gas-phase only version of the HR-ToF-CIMS was deployed on the NOAA WP-3 aircraft as part of SENEX. We focus here on highly oxygenated organic compounds derived from monoterpene oxidation detected both aloft during SENEX and at the ground-based site during SOAS. In both chamber and the atmosphere, many highly oxidized, low volatility compounds were observed in the gas and particles and many of the same compositions detected in the gas-phase were detected in the particles upon temperature programmed thermal desorption. The fraction of a given compound measured in the particle phase follows expected trends with elemental composition such as O/C ratios, but many compounds would not be well described by an absorptive partitioning model assuming unity activity coefficients. The detailed structure in the thermograms reveals a significant contribution from large molecular weight organics and/or oligomers in both chamber and ambient aerosol samples. Approximately 50% of the measured organics in the particle phase are associated with compounds having effective vapour pressures 4 or more orders of magnitude lower than commonly measured monoterpene oxidation products. We discuss the implications of these findings for measurements of gas-particle partitioning and for evaluating the contribution of monoterpene oxidation to organic aerosol formation and growth. We also use the aircraft measurements and a

  8. Validity and reliability of Verbal Online Subjective Opinion (VOSO and Modified Cooper-Harper scales in measuring of mental workload

    Directory of Open Access Journals (Sweden)

    Reza Charkhandaz Yeganeh

    2016-12-01

    Full Text Available Introduction: High mental workload is one of the important factors that results in errors in safety and occupational health scope and its measurement has high importance. So, this study aimed to determine validity and reliability of Verbal Online Subjective Opinion (VOSO and Modified Cooper-Harper (MCH scales in measuring mental workload. Methods: This study was conducted on 90 male students of Iran University of Medical Sciences. In this study, the Forward-Backward translation was used for translation of scales. Moreover, Content Validity Ratio (CVR and Content Validity Index (CVI were calculated by having suggestion of 6 Ergonomics and Occupational health experts. The Hybrid Memory Search Task software was used to create mental workload. Convergent validity of scales was calculated using correlation of scales with reaction time and then Test-Retest method was used to determine the reliability of scales. Results: Content and convergent validity of scales were confirmed and correlation of both scales with reaction time were higher than 0.8. Moreover for determination of scales reliabilities, Pearson correlation coefficient between scales values in test and retest trials were 0.86 and 0.91 for VOSO and MCH respectively. Conclusion: It seems that in regard to confirmation of validity and reliability of VOSO and MCH in this study and their high correlation with reaction time, it can use these scales in measurement of mental workload.

  9. Online measurement of biogenic organic acids in the boreal forest using atmospheric pressure chemical ionization mass spectrometry (APCI-MS)

    Science.gov (United States)

    Vogel, A. L.; Brüggemann, M.; ńijälä, M.; Ehn, M.; Junninen, H.; Corrigan, A. L.; Petäjä, T.; Worsnop, D. R.; Russell, L. M.; Kulmala, M.; Williams, J.; Hoffmann, T.

    2012-04-01

    Emission of biogenic volatile organic compounds (BVOCs) by vegetation in the boreal forest and their subsequent atmospheric oxidation leads to the formation of secondary organic aerosol (SOA) which has important impacts on climate and human health. Oxidation of BVOCs produces a variety of mostly unidentified species in oxygenated organic aerosol (OOA). Presently aerosol mass spectrometers (AMS) are able to determine quantitative information about the relative oxygen to carbon content of organic aerosols and thereby reveal the photochemical age and volatility of organic aerosol by distinguishing between low volatile oxygenated organic aerosol (LV-OOA), semivolatile oxygenated organic aerosol (SV-OOA) and hydrocarbon like organic aerosol (HOA)[1]. However, the AMS can usually not be used to measure and quantify single organic compounds such as individual biogenic organic marker compounds. Here we show the results of online measurements of gas and particle phase biogenic acids during HUMPPA-COPEC 2010 at Hyytiälä, Finland. This was achieved by coupling a self built miniature Versatile Aerosol Concentration Enrichment System (mVACES) as described by Geller et al. [2] with an Atmospheric Pressure Chemical Ionization Ion Trap Mass Spectrometer (APCI IT MS; Hoffmann et al., [3]). The benefits of the on-line APCI-MS are soft ionization with little fragmentation compared to AMS, high measurement frequency and less sampling artifacts than in the common procedure of taking filter samples, extraction and detection with LC-MS. Furthermore, the ion trap of the instrument allows MS/MS experiments to be performed by isolation of single m/z ratios of selected molecular species. By subsequent addition of energy, the trapped ions form characteristic fragments which enable structural insight on the molecular level. Comparison of APCI-MS data to AMS data, acquired with a C-ToF-AMS [4], revealed a good correlation coefficient for total organics and sulphate. Furthermore, data show

  10. A programming system for bubble chamber photographs measuring tables on-line to a computer

    International Nuclear Information System (INIS)

    Miche, Roger.

    1975-06-01

    A programming system available on an industrial computer, type PDP 15/20, performing the exploitation of bubble chamber pictures with the projection tables on line to the computer was developed. This system must suit the particular conditions met in the analysis of photographs from different bubble chambers, the different stage for dealing with the views (scanning, premeasurement, measurement) adapting to different strategies in the handling of measurements. The exploitation of photographs takes place in a conversational mode to which a concrete form is given by sending messages to the operators at the tables and by receiving coded answers. In this framework, the aims of the operating system are: to guide the operator work at the tables while allowing them to interrupt the normal sequence of events, to carry out some elementary logical checks, to write on magnetic tape the checked data with the appropriate labels as required [fr

  11. On-line measurement of the microwave power in ECR ion source

    International Nuclear Information System (INIS)

    Zhou Changgeng; Kang Wu; Hu Yonghong; Li Yan; Lou Benchao; Zu Xiulan; Xiong Riheng; Chen Junguang

    2005-01-01

    It is a new technology that ECR ion source is applied in the neutron generator. Because of effect of the structure, working state of ECR ion source could not be judged by the color of gas discharging in discharging chamber as doing in high frequency ion source. Therefore, state adjusting of ECR ion source was difficult in running of the neutron generator. The method to resolve the question is described in this paper. The micro-wave power was measured in case of running by using the method of directional coupler adding small microwave power meter. Because both were in the direct proportion, the ion beam current could be educed from microwave incidence power measured, and discharge state in discharge chamber could be judged. Finally, the neutron generator might be operated in best running state. (authors)

  12. On-line plutonium measurement by alpha counting using a silica glass sensor

    International Nuclear Information System (INIS)

    Edeline, J.C.; Furgolle, B.

    1980-01-01

    Some cerium activated high purity silica glasses are good sensors for ionising particles counting. These sensors may be used for measuring plutonium concentrations in corrosive solutions which are typical in reprocessing operations. The thickness of the sensor has been reduced to minimize beta sensitivity. The thin sensor is hold by molecular adhesion to a thick glass mount which is soldered to the stainless steel sample cell [fr

  13. Program for large scanning-measuring table calibration on-line with the TRA-1001 computer

    International Nuclear Information System (INIS)

    Kalmykova, L.P.; Ososkov, G.A.; Pogodina, G.A.; Skryl', I.I.

    1975-01-01

    A description of a programme variant for complex calibration of the system of boards BPS-2, is given in which the stage of measurements and accumulation of calibration data is separated from that of data processing on CDC-1604A computers. Stage-by-stage calibration allows for simultaneous and parallel measurements on all the 6 boards. Such a possibility of the boards' operation on a computer-controlled line has been used as checking of the operators' actions with current control of the data obtained. Mathematical formulae are followed by programmes' descriptions. Reception and accumulation of coordinates of the units of the calibrating plate, with a highly precise net of straight lines, are accomplished with the help of the DATREC programme working on a guiding TPA-1001 computer with simultaneous calibration of all the six BPS-2 boards. The DATREC programme is written in the SLANG-1 language. The CALBPS programme works on CDC-1604A computer, is written in FORTRAN, and calculates transformation coefficients and corresponding precision characteristics. The work has resulted in reducing the calibration time from 10-15 min. per board to 10-15 min. per all the 6 boards. The time of accumulation in the memory TPA-1001 and of recording on the CDC-608 tape recorder of calibration data is from 3 to 5 min.; the remaining time is spent on processing on a bigger CDC-1604A computer. Examples of typical output and certain results of calibration measurements are given

  14. Prototype of a fiber optic sensor for online measurement of coating thickness

    Science.gov (United States)

    D'Emilia, Giulio

    1999-09-01

    In this paper the experimental characterization of a transducer for on line measurement of coating thickness in food industry applications is described, which is composed by a fiber optic probe and by an eddy-current proximity one. The method is based on measuring reflectance by a fiber optic probe of the coating plated on thin steel sheets. The eddy current proximity probe should be used to measure the substrate position. In order to evaluate the feasibility of this approach, a particular attention has been paid to the accuracy of the method, since an accuracy in the order of plus or minus 1 micrometer should be achieved for practical interest. With this aim, the effect of the main interfering and modifying quantities of geometrical (sensor size, probe head angle of incidence, working distance, ...) and optical (light source and photo-detector behavior stability, ...) type has been evaluated both theoretically and experimentally by using a calibration test bench in stationary working conditions. Furthermore, a calibration test bench has been built, where a translating and vibrating steel plate is realized, in order to evaluate the effect of translation velocity of the plate and also of cross vibrations. Results of dynamic calibration are also described and discussed, in order to get information about the final sensor configuration.

  15. Criteria of waist circumference according to computed tomography-measured visceral fat area and the clustering of cardiovascular risk factors

    International Nuclear Information System (INIS)

    Kashihara, Hidetoshi; Tamura, Masaki; Lee, J.S.; Akabayashi, Akira; Kawakubo, Kiyoshi

    2009-01-01

    The purpose of this study was to determine the discriminate gender-specific cutoff values of waist circumference (WC) for detecting the clustering of cardiovascular risk factors (CCRF), which reflects the intra-abdominal visceral fat area (VFA) using a large Japanese population. The study population consisted of 6,736 men and women who underwent a periodic health check-up and had a computed tomography scan for VFA measurement at the PL Tokyo Health Care Center in Tokyo, Japan. The CCRF was defined according to the Japanese Committee of the Criteria for Metabolic Syndrome. The discriminate values for detecting the CCRF were tested using receiver operating characteristics analysis. The discriminate values of VFA were 103.0 cm 2 with 68.7% sensitivity and 61.8% specificity for men and 69.0 cm 2 with 80.8% sensitivity and 70.0% specificity for women. The WC values corresponding to the VFA were 89.1 cm for men and 86.3 cm for women. The discriminate values of VFA and WC were not substantially different between people with or without raised blood pressure. For the early detection and management of the CCRF and VFA in the primary screening setting, the discriminate and convenient gender-specific WC criteria would be 90 cm for men and 85 cm for women. (author)

  16. Hygrometric measurement for on-line monitoring of PWR vessel head penetrations

    International Nuclear Information System (INIS)

    Germain, J.L.; Loisy, F.; Apolzan, S.

    1994-06-01

    In September 1991, a small leak was found on one of the reactor's upper vessel head penetrations. After inspection, other non-throughwall cracks were localized in the lower part of the vessel head adapter in questions. The same type of crack was later found inside some adapters on other French PWR units. After repairs, the safety authorities granted approval to continue unit operation, with the specific provision that a system for ongoing monitoring of the penetrations be set up. Two types of system were selected to detect leaks through any potential cracks: the first is based on nitrogen-13 detection and the second on steam detection. Both systems call for sampling the air in a confined space above the vessel head. The number and distribution of sampling taps in the circuit, and the balancing of their respective flow rates, are factors in proper monitoring of all vessel head penetrations. Gas-injection holes are also installed in the confined space. These holes are used during the sampling system qualification tests to simulate leaks in various positions and calculate the effective performance of the sampling system. Leaks are simulated using a helium-base gas tracer and measuring tracer concentrations in the sampling system. The system for measuring steam levels in air samples uses chilled-mirror hygrometers. A microcomputer takes regular readings, drives the various automatic functions of the measurement system and automatically analyses the readings so as to monitor operations and trigger an alarm at the first sign of a leak. This system has now been installed for a year and a half on three French PWR units and is functioning satisfactorily. (authors). 5 figs

  17. Measuring online interpretations and attributions of social situations: Links with adolescent social anxiety.

    Science.gov (United States)

    Haller, Simone P W; Raeder, Sophie M; Scerif, Gaia; Cohen Kadosh, Kathrin; Lau, Jennifer Y F

    2016-03-01

    We evaluated the utility of a novel, picture-based tool to measure how adolescents interpret and attribute cause to social exchanges and whether biases in these processes relate to social anxiety. Briefly presented ambiguous visual social scenes, each containing a photograph of the adolescent as the protagonist, were followed by three possible interpretations (positive, negative, neutral/unrelated) and two possible causal attributions (internal, external) to which participants responded. Ninety-five adolescents aged 14 to 17 recruited from mainstream schools, with varying levels of social anxiety rated the likelihood of positive, negative and unrelated interpretations before selecting the single interpretation they deemed as most likely. This was followed by a question prompting them to decide between an internal or external causal attribution for the interpreted event. Across scenarios, adolescents with higher levels of social anxiety rated negative interpretations as more likely and positive interpretations as less likely compared to lower socially anxious adolescents. Higher socially anxious adolescents were also more likely to select internal attributions to negative and less likely to select internal attributions for positive events than adolescents with lower levels of social anxiety. Adolescents with higher social anxiety display cognitive biases in interpretation and attribution. This tool is suitable for measuring cognitive biases of complex visual-social cues in youth populations with social anxiety and simulates the demands of daily social experiences more closely. As we did not measure depressive symptoms, we cannot be sure that biases linked to social anxiety are not due to concurrent low mood. Copyright © 2015. Published by Elsevier Ltd.

  18. VME online system of the Bonn polarized nucleon targets and polarization measurements on NH3

    International Nuclear Information System (INIS)

    Thiel, W.

    1991-02-01

    The measurement of spin observables is the main purpose of the PHOENICS detector at the Bonn Electron Accelerator ELSA. Therefore a new frosen spin target was built allowing any spin orientation by means of two perpendicular holding fields and the use of a polarizing field up to 7 Tesla. With a vertical dilution refrigerator the polarization can be frozen at a temperature of 70 mK. This thesis describe a VME based control and monitor system for the various parts of this target. It mainly consists of a VIP processor together with different kinds of I/O and interface boards. Caused by its modular structure in hard- and software it can be easyly set up to control and monitor different hardware environments. A menu and command oriented user interface running on an ATARI computer allows a comfortable operation. Secondly the new NMR system is described in detail. It is based on the Liferpool module allowing a dispersion user interface running on an ATARI computer allows a comfortable operation. Secondly the new NMR system is described in detail. It is based on the Liverpool module allowing a dispersion free detection and a simple adjustment to different magnetic fields. A similar VME system takes care of all the necessary task for the polarization measurements. Fast optodecoupled analog I/O modules a e used as an interface to the NMR hardware. Finally the first measurements with this target are presented. Using NH 3 as target material and a polarizing field of 3.5 Tesla a proton polarization of +94% and -100% could be achieved. By lowering the magnetic field to 0.35 Tesla a superradiance effect was observed. (orig.)

  19. On-line measurements of liquid carry-over from scrubbers using radioactive tracers

    Energy Technology Data Exchange (ETDEWEB)

    Haugan, A; Hassfjell, S [Institute for Energy Technology, Kjeller (Norway); Finborud, A [Mator, Porsgrunn (Norway)

    2004-07-01

    A method to measure liquid carry-over from scrubbers using gamma-emitting tracers is described and results from field tests at two onshore installations are presented. One water/1,2-ethanediol (MEG) and two hydrocarbon liquid (condensate) tracers have been used in the tests. One of the condensate tracers deposited to some extent inside the process pipe, while the other had a too high vapor pressure. The water/MEG tracer showed no MEG carry-over while the carry-over of MEG was documented to be considerable. (author)

  20. On-line measurements of liquid carry-over from scrubbers using radioactive tracers

    International Nuclear Information System (INIS)

    Haugan, A.; Hassfjell, S.; Finborud, A.

    2004-01-01

    A method to measure liquid carry-over from scrubbers using gamma-emitting tracers is described and results from field tests at two onshore installations are presented. One water/1,2-ethanediol (MEG) and two hydrocarbon liquid (condensate) tracers have been used in the tests. One of the condensate tracers deposited to some extent inside the process pipe, while the other had a too high vapor pressure. The water/MEG tracer showed no MEG carry-over while the carry-over of MEG was documented to be considerable. (author)

  1. An On-Line Water Monitor for Low Level {beta}-Radioactivity Measurements

    Energy Technology Data Exchange (ETDEWEB)

    Quirk, E J.M.

    1968-05-15

    A detection system is described for the continuous monitoring of {beta}-radioactivity in the secondary cooling water at the Studsvik R2 reactor. Radiation emanating from a water surface is measured by a large area gas proportional detector. To protect the detector from splash caused by bursting bubbles a protective film and heater assembly is interposed between the detector and the water surface. A special feature is the programmed 'exercise' sequence for the magnetic valves which eliminates a tendency for them to stick after prolonged periods of idleness. The extent to which contamination affects the background counting rate has been studied. It is shown that for the duration of the tests described the monitor remains free from the effects of contamination so long as the scaler live time is suitably chosen. Minimum measurable specific activities obtainable in practice extend from 4 x 10{sup -6} to 3.86 x 10{sup -8} Ci/m{sup 3} depending on the {beta} end-point energy in the range 167 keV - 2.26 MeV.

  2. Combination of On-line pH and Oxygen Transfer Rate Measurement in Shake Flasks by Fiber Optical Technique and Respiration Activity MOnitoring System (RAMOS

    Directory of Open Access Journals (Sweden)

    Jochen Büchs

    2007-12-01

    Full Text Available Shake flasks are commonly used for process development in biotechnologyindustry. For this purpose a lot of information is required from the growth conditions duringthe fermentation experiments. Therefore, Anderlei et al. developed the RAMOS technology[1, 2], which proviedes on-line oxygen and carbondioxide transfer rates in shake flasks.Besides oxygen consumption, the pH in the medium also plays an important role for thesuccessful cultivation of micro-organisms and for process development. For online pHmeasurement fiber optical methods based on fluorophores are available. Here a combinationof the on-line Oxygen Transfer Rate (OTR measurements in the RAMOS device with anon-line, fiber optical pH measurement is presented. To demonstrate the application of thecombined measurement techniques, Escherichia coli cultivations were performed and on-line pH measurements were compared with off-line samples. The combination of on-lineOTR and pH measurements gives a lot of information about the cultivation and, therefore, itis a powerful technique for monitoring shake flask experiments as well as for processdevelopment.

  3. Potential of on-line visible and near infrared spectroscopy for measurement of pH for deriving variable rate lime recommendations.

    Science.gov (United States)

    Tekin, Yücel; Kuang, Boyan; Mouazen, Abdul M

    2013-08-08

    This paper aims at exploring the potential of visible and near infrared (vis-NIR) spectroscopy for on-line measurement of soil pH, with the intention to produce variable rate lime recommendation maps. An on-line vis-NIR soil sensor set up to a frame was used in this study. Lime application maps, based on pH predicted by vis-NIR techniques, were compared with maps based on traditional lab-measured pH. The validation of the calibration model using off-line spectra provided excellent prediction accuracy of pH (R2 = 0.85, RMSEP = 0.18 and RPD = 2.52), as compared to very good accuracy obtained with the on-line measured spectra (R2 = 0.81, RMSEP = 0.20 and RPD = 2.14). On-line predicted pH of all points (e.g., 2,160) resulted in the largest overall field virtual lime requirement (1.404 t), as compared to those obtained with 16 validation points off-line prediction (0.28 t), on-line prediction (0.14 t) and laboratory reference measurement (0.48 t). The conclusion is that the vis-NIR spectroscopy can be successfully used for the prediction of soil pH and for deriving lime recommendations. The advantage of the on-line sensor over sampling with limited number of samples is that more detailed information about pH can be obtained, which is the reason for a higher but precise calculated lime recommendation rate.

  4. Potential of On-Line Visible and Near Infrared Spectroscopy for Measurement of pH for Deriving Variable Rate Lime Recommendations

    Directory of Open Access Journals (Sweden)

    Yücel Tekin

    2013-08-01

    Full Text Available This paper aims at exploring the potential of visible and near infrared (vis-NIR spectroscopy for on-line measurement of soil pH, with the intention to produce variable rate lime recommendation maps. An on-line vis-NIR soil sensor set up to a frame was used in this study. Lime application maps, based on pH predicted by vis-NIR techniques, were compared with maps based on traditional lab-measured pH. The validation of the calibration model using off-line spectra provided excellent prediction accuracy of pH (R2 = 0.85, RMSEP = 0.18 and RPD = 2.52, as compared to very good accuracy obtained with the on-line measured spectra (R2 = 0.81, RMSEP = 0.20 and RPD = 2.14. On-line predicted pH of all points (e.g., 2,160 resulted in the largest overall field virtual lime requirement (1.404 t, as compared to those obtained with 16 validation points off-line prediction (0.28 t, on-line prediction (0.14 t and laboratory reference measurement (0.48 t. The conclusion is that the vis-NIR spectroscopy can be successfully used for the prediction of soil pH and for deriving lime recommendations. The advantage of the on-line sensor over sampling with limited number of samples is that more detailed information about pH can be obtained, which is the reason for a higher but precise calculated lime recommendation rate.

  5. Maximising the Opportunity for Healthy Ageing: Online Mental Health Measurement and Targeted Interventions.

    Science.gov (United States)

    Iasiello, Matthew; Bartholomaeus, Jonathan; Jarden, Aaron; van Agteren, Joseph

    2018-01-01

    Longevity is a valuable resource for society, as older people are increasingly looking for new ways to contribute after retirement. Their contribution is however dependent upon their physical health, mental health and wellbeing. The potential role that mental health and wellbeing, two separate but interrelated constructs, play often are both under-recognised and insufficiently targeted. Positive ageing is a positive and constructive view of ageing, where older people actively work on maintaining a positive attitude, work towards keeping fit and healthy, and strive to maximize their wellbeing. Interventions stimulating positive ageing show promising results for both mental health and wellbeing, and telehealth can play an important role in improving the reach and effectiveness of positive ageing interventions. Telehealth solutions can also help researchers reliably measure and better understand the drivers of wellbeing at individual and population levels; results that can both form the basis for advancing the field of positive ageing and help inform public policy.

  6. Annular shape silver lined proportional counter for on-line pulsed neutron yield measurement

    International Nuclear Information System (INIS)

    Dighe, P.M.; Das, D.

    2015-01-01

    An annular shape silver lined proportional counter is developed to measure pulsed neutron radiation. The detector has 314 mm overall length and 235 mm overall diameter. The central cavity of 150 mm diameter and 200 mm length is used for placing the neutron source. Because of annular shape the detector covers >3π solid angle of the source. The detector has all welded construction. The detector is developed in two halves for easy mounting and demounting. Each half is an independent detector. Both the halves together give single neutron pulse calibration constant of 4.5×10 4 neutrons/shot count. The detector operates in proportional mode which gives enhanced working conditions in terms of dead time and operating range compared to Geiger Muller based neutron detectors

  7. Adobe Flash as a medium for online experimentation: a test of reaction time measurement capabilities.

    Science.gov (United States)

    Reimers, Stian; Stewart, Neil

    2007-08-01

    Adobe Flash can be used to run complex psychological experiments over the Web. We examined the reliability of using Flash to measure reaction times (RTs) using a simple binary-choice task implemented both in Flash and in a Linux-based system known to record RTs with millisecond accuracy. Twenty-four participants were tested in the laboratory using both implementations; they also completed the Flash version on computers of their own choice outside the lab. RTs from the trials run on Flash outside the lab were approximately 20 msec slower than those from trials run on Flash in the lab, which in turn were approximately 10 msec slower than RTs from the trials run on the Linux-based system (baseline condition). RT SDs were similar in all conditions, suggesting that although Flash may overestimate RTs slightly, it does not appear to add significant noise to the data recorded.

  8. Elemental composition of ambient aerosols measured with high temporal resolution using an online XRF spectrometer

    Directory of Open Access Journals (Sweden)

    M. Furger

    2017-06-01

    Full Text Available The Xact 625 Ambient Metals Monitor was tested during a 3-week field campaign at the rural, traffic-influenced site Härkingen in Switzerland during the summer of 2015. The field campaign encompassed the Swiss National Day fireworks event, providing increased concentrations and unique chemical signatures compared to non-fireworks (or background periods. The objective was to evaluate the data quality by intercomparison with other independent measurements and test its applicability for aerosol source quantification. The Xact was configured to measure 24 elements in PM10 with 1 h time resolution. Data quality was evaluated for 10 24 h averages of Xact data by intercomparison with 24 h PM10 filter data analysed with ICP-OES for major elements, ICP-MS for trace elements, and gold amalgamation atomic absorption spectrometry for Hg. Ten elements (S, K, Ca, Ti, Mn, Fe, Cu, Zn, Ba, Pb showed excellent correlation between the compared methods, with r2 values  ≥  0.95. However, the slopes of the regressions between Xact 625 and ICP data varied from 0.97 to 1.8 (average 1.28 and thus indicated generally higher Xact elemental concentrations than ICP for these elements. Possible reasons for these differences are discussed, but further investigations are needed. For the remaining elements no conclusions could be drawn about their quantification for various reasons, mainly detection limit issues. An indirect intercomparison of hourly values was performed for the fireworks peak, which brought good agreement of total masses when the Xact data were corrected with the regressions from the 24 h value intercomparison. The results demonstrate that multi-metal characterization at high-time-resolution capability of Xact is a valuable and practical tool for ambient monitoring.

  9. On-line Field Measurements of Speciated PM1 Emission Factors from Common South Asian Combustion Sources

    Science.gov (United States)

    DeCarlo, P. F.; Goetz, J. D.; Giordano, M.; Stockwell, C.; Maharjan, R.; Adhikari, S.; Bhave, P.; Praveen, P. S.; Panday, A. K.; Jayarathne, T. S.; Stone, E. A.; Yokelson, R. J.

    2017-12-01

    Characterization of aerosol emissions from prevalent but under sampled combustion sources in South Asia was performed as part of the Nepal Ambient Monitoring and Source Testing Experiment (NAMaSTE) in April 2015. Targeted emission sources included cooking stoves with a variety of solid fuels, brick kilns, garbage burning, crop-residue burning, diesel irrigation pumps, and motorcycles. Real-time measurements of submicron non-refractory particulate mass concentration and composition were obtained using an Aerodyne mini Aerosol Mass Spectrometer (mAMS). Speciated PM1 mass emission factors were calculated for all particulate species (e.g. organics, sulfates, nitrates, chlorides, ammonium) and for each source type using the carbon mass balance approach. Size resolved emission factors were also acquired using a novel high duty cycle particle time-of-flight technique (ePTOF). Black carbon and brown carbon absorption emission factors and absorption Angström exponents were measured using filter loading and scattering corrected attenuation at 370 nm and 880 nm with a dual spot aethalometer (Magee Scientific AE-33). The results indicate that open garbage burning is a strong emitter of organic aerosol, black carbon, and internally mixed particle phase hydrogen chloride (HCl). Emissions of HCl were attributed to the presence chlorinated plastics. The primarily coal fired brick kilns were found to be large emitters of sulfate but large differences in the organic and light absorbing component of emissions were observed between the two kiln types investigated (technologically advanced vs. traditional). These results, among others, bring on-line and field-tested aerosol emission measurements to an area of atmoshperic research dominated by off-line or laboratory based measurements.

  10. Measuring the effects of online health information: Scale validation for the e-Health Impact Questionnaire.

    Science.gov (United States)

    Kelly, Laura; Ziebland, Sue; Jenkinson, Crispin

    2015-11-01

    Health-related websites have developed to be much more than information sites: they are used to exchange experiences and find support as well as information and advice. This paper documents the development of a tool to compare the potential consequences and experiences a person may encounter when using health-related websites. Questionnaire items were developed following a review of relevant literature and qualitative secondary analysis of interviews relating to experiences of health. Item reduction steps were performed on pilot survey data (n=167). Tests of validity and reliability were subsequently performed (n=170) to determine the psychometric properties of the questionnaire. Two independent item pools entered psychometric testing: (1) Items relating to general views of using the internet in relation to health and, (2) Items relating to the consequences of using a specific health-related website. Identified sub-scales were found to have high construct validity, internal consistency and test-retest reliability. Analyses confirmed good psychometric properties in the eHIQ-Part 1 (11 items) and the eHIQ-Part 2 (26 items). This tool will facilitate the measurement of the potential consequences of using websites containing different types of material (scientific facts and figures, blogs, experiences, images) across a range of health conditions. Copyright © 2015 The Authors. Published by Elsevier Ireland Ltd.. All rights reserved.

  11. Mass measurements on short-lived Cd and Ag nuclides at the online mass spectrometer ISOLTRAP

    International Nuclear Information System (INIS)

    Breitenfeldt, Martin

    2009-01-01

    In the present work, mass determinations of the eleven neutron-deficient nuclides 99-109 Cd, of ten neutron-rich silver nuclides 112,114-121,123 Ag, and seven neutron-rich cadmium nuclides 114,120,122-124,126,128 Cd are reported. Due to the clean production of the neutron-deficient nuclides it was possible to reduce the experimental uncertainties down to 2 keV, whereas the measurements of neutron-rich nuclides were hampered by the presence of contaminations from more stable In and Cs nuclides. In the case of 99 Cd and 123 Ag the masses were determined for the first time and for the other nuclides the mass uncertainties could be reduced by up to a factor of 50 as in the case of 100 Cd. In the case of a potential isomeric mixture as for 115,117,119 Ag and 123 Cd, where no assignment to either the ground state or the excited state was possible, the experimental results were adjusted accordingly. Afterwards all results were included in the framework of the atomic-mass evaluation and thus linked and compared with other experimental data. In the case of a potential isomeric mixture as for 115,117,119 Ag and 123 Cd, where no assignment to either the ground state or the excited state was possible, the experimental results were adjusted accordingly. Afterwards all results were included in the framework of the atomic-mass evaluation and thus linked and compared with other experimental data. In the case of the neutron-deficient Cd nuclides a conflict between the mass values obtained in the present work and those published by the JYFLTRAP group [EEH + ] could be solved by performing an atomic-mass evaluation. Thus, it was revealed that reason for the conflict was a different value of the JYFLTRAP reference mass 96 Mo. Furthermore, a reduction of the mass uncertainty and a slight increase of the mass of 100 In were obtained. These mass measurements are an important step towards an understanding of the physics of the rp process that will enable a more reliable determination of

  12. On-line measurements of RuO{sub 4} during a PWR severe accident

    Energy Technology Data Exchange (ETDEWEB)

    Reymond-Laruinaz, S.; Doizi, D. [CEA, DEN, Departement de Physico-chimie, CEA/Saclay, 91191 Gif sur Yvette Cedex, (France); Manceron, L. [Societe Civile Synchrotron SOLEIL, L' Orme des Merisiers, St-Aubin BP48, 91192 Gif-sur-Yvette Cedex, (France); MONARIS, UMR 8233, Universite Pierre et Marie Curie, 4 Place Jussieu, case 49, F-75252 Paris Cedex 05, (France); Boudon, V. [Laboratoire Interdisciplinaire Carnot de Bourgogne, UMR 6303 CNRS-Universite de Bourgogne, 9 avenue Alain Savary, BP 47870, F-21078 Dijon Cedex, (France); Ducros, G. [CEA, DEN, Departement d' Etudes des Combustibles, CEA/Cadarache, 13108 Saint-Paul-lez-Durance cedex, (France)

    2015-07-01

    After the Fukushima accident, it became essential to have a way to monitor in real time the evolution of a nuclear reactor during a severe accident, in order to react efficiently and minimize the industrial, ecological and health consequences of the accident. Among gaseous fission products, the tetroxide of ruthenium RuO{sub 4} is of prime importance since it has a significant radiological impact. Ruthenium is a low volatile fission product but in case of the rupture of the vessel lower head by the molten corium, the air entering into the vessel oxidizes Ru into gaseous RuO{sub 4}, which is not trapped by the Filtered Containment Venting Systems. To monitor the presence of RuO{sub 4} allows making a diagnosis of the core degradation and quantifying the release into the atmosphere. To determine the presence of RuO{sub 4}, FTIR spectrometry was selected. To study the feasibility of the monitoring, high-resolution IR measurements were realized at the French synchrotron facility SOLEIL on the infrared beam line AILES. Thereafter, theoretical calculations were done to simulate the FTIR spectrum to describe the specific IR fingerprint of the molecule for each isotope and based on its partial pressure in the air. (authors)

  13. On the Feasibility of Prefetching and Caching for Online TV Services: A Measurement Study on Hulu

    Science.gov (United States)

    Krishnappa, Dilip Kumar; Khemmarat, Samamon; Gao, Lixin; Zink, Michael

    Lately researchers are looking at ways to reduce the delay on video playback through mechanisms like prefetching and caching for Video-on-Demand (VoD) services. The usage of prefetching and caching also has the potential to reduce the amount of network bandwidth usage, as most popular requests are served from a local cache rather than the server containing the original content. In this paper, we investigate the advantages of having such a prefetching and caching scheme for a free hosting service of professionally created video (movies and TV shows) named "hulu". We look into the advantages of using a prefetching scheme where the most popular videos of the week, as provided by the hulu website, are prefetched and compare this approach with a conventional LRU caching scheme with limited storage space and a combined scheme of prefetching and caching. Results from our measurement and analysis shows that employing a basic caching scheme at the proxy yields a hit ratio of up to 77.69%, but requires storage of about 236GB. Further analysis shows that a prefetching scheme where the top-100 popular videos of the week are downloaded to the proxy yields a hit ratio of 44% with a storage requirement of 10GB. A LRU caching scheme with a storage limitation of 20GB can achieve a hit ratio of 55% but downloads 4713 videos to achieve such high hit ratio compared to 100 videos in prefetching scheme, whereas a scheme with both prefetching and caching with the same storage yields a hit ratio of 59% with download requirement of 4439 videos. We find that employing a scheme of prefetching along with caching with trade-off on the storage will yield a better hit ratio and bandwidth saving than individual caching or prefetching schemes.

  14. Mass measurements on short-lived Cd and Ag nuclides at the online mass spectrometer ISOLTRAP

    Energy Technology Data Exchange (ETDEWEB)

    Breitenfeldt, Martin

    2009-07-03

    In the present work, mass determinations of the eleven neutron-deficient nuclides {sup 99-109}Cd, of ten neutron-rich silver nuclides {sup 112,114-121,123}Ag, and seven neutron-rich cadmium nuclides {sup 114,120,122-124,126,128}Cd are reported. Due to the clean production of the neutron-deficient nuclides it was possible to reduce the experimental uncertainties down to 2 keV, whereas the measurements of neutron-rich nuclides were hampered by the presence of contaminations from more stable In and Cs nuclides. In the case of {sup 99}Cd and {sup 123}Ag the masses were determined for the first time and for the other nuclides the mass uncertainties could be reduced by up to a factor of 50 as in the case of {sup 100}Cd. In the case of a potential isomeric mixture as for {sup 115,117,119}Ag and {sup 123}Cd, where no assignment to either the ground state or the excited state was possible, the experimental results were adjusted accordingly. Afterwards all results were included in the framework of the atomic-mass evaluation and thus linked and compared with other experimental data. In the case of a potential isomeric mixture as for {sup 115,117,119}Ag and {sup 123}Cd, where no assignment to either the ground state or the excited state was possible, the experimental results were adjusted accordingly. Afterwards all results were included in the framework of the atomic-mass evaluation and thus linked and compared with other experimental data. In the case of the neutron-deficient Cd nuclides a conflict between the mass values obtained in the present work and those published by the JYFLTRAP group [EEH{sup +}] could be solved by performing an atomic-mass evaluation. Thus, it was revealed that reason for the conflict was a different value of the JYFLTRAP reference mass {sup 96}Mo. Furthermore, a reduction of the mass uncertainty and a slight increase of the mass of {sup 100}In were obtained. These mass measurements are an important step towards an understanding of the physics of

  15. Teaching renewable energy using online PBL in investigating its effect on behaviour towards energy conservation among Malaysian students: ANOVA repeated measures approach

    Science.gov (United States)

    Nordin, Norfarah; Samsudin, Mohd Ali; Hadi Harun, Abdul

    2017-01-01

    This research aimed to investigate whether online problem based learning (PBL) approach to teach renewable energy topic improves students’ behaviour towards energy conservation. A renewable energy online problem based learning (REePBaL) instruction package was developed based on the theory of constructivism and adaptation of the online learning model. This study employed a single group quasi-experimental design to ascertain the changed in students’ behaviour towards energy conservation after underwent the intervention. The study involved 48 secondary school students in a Malaysian public school. ANOVA Repeated Measure technique was employed in order to compare scores of students’ behaviour towards energy conservation before and after the intervention. Based on the finding, students’ behaviour towards energy conservation improved after the intervention.

  16. On-line hyperfine structure and isotope shift measurements with diffuse light collection and photon burst detection

    International Nuclear Information System (INIS)

    Lassen, J.; Benck, E.C.; Schuessler, H.A.

    1997-01-01

    An experiment is presently being set up which combines collinear-fast-beam laser spectroscopy with photon burst spectroscopy. Selectivity is provided by the large kinetic isotope shifts together with the practically Doppler free linewidth of the fluorescence from the fast atom beam. The photon burst detection, based on photon correlations in the resonance fluorescence, increases the sensitivity, so that on-line optical isotope shift and hyperfine structure measurements on low intensity radioactive beams become feasible. In order to improve photon burst detection the solid angle of detection and the observation time have to be optimized. To this end a diffuse reflecting cavity has been designed and built, which collects fluorescence over a 45 cm length of the beam and covers the full solid angle. The light collection efficiency of the cavity is calculated to be about 45%. The cavity is being tested with a 11 keV beam of krypton atoms, probing the near infrared transitions in our apparatus at Texas A ampersand M University. copyright 1997 American Institute of Physics

  17. Redefining "Learning" in Statistical Learning: What Does an Online Measure Reveal About the Assimilation of Visual Regularities?

    Science.gov (United States)

    Siegelman, Noam; Bogaerts, Louisa; Kronenfeld, Ofer; Frost, Ram

    2017-10-07

    From a theoretical perspective, most discussions of statistical learning (SL) have focused on the possible "statistical" properties that are the object of learning. Much less attention has been given to defining what "learning" is in the context of "statistical learning." One major difficulty is that SL research has been monitoring participants' performance in laboratory settings with a strikingly narrow set of tasks, where learning is typically assessed offline, through a set of two-alternative-forced-choice questions, which follow a brief visual or auditory familiarization stream. Is that all there is to characterizing SL abilities? Here we adopt a novel perspective for investigating the processing of regularities in the visual modality. By tracking online performance in a self-paced SL paradigm, we focus on the trajectory of learning. In a set of three experiments we show that this paradigm provides a reliable and valid signature of SL performance, and it offers important insights for understanding how statistical regularities are perceived and assimilated in the visual modality. This demonstrates the promise of integrating different operational measures to our theory of SL. © 2017 Cognitive Science Society, Inc.

  18. Automated on-line L-edge measurement of SNM concentration for near-real-time accounting

    International Nuclear Information System (INIS)

    Russo, P.A.; Marks, T. Jr.; Stephens, M.M.; Hsue, S.T.; Baker, A.L.; Cobb, D.D.

    1982-01-01

    The L-edge densitometer developed at Los Alamos National Laboratory has been modified, tested, and demonstrated for on-line assay of special nuclear material concentration in flowing solution streams. The demonstration was part of a larger demonstration of near-real-time nuclear materials accounting during a continuous, week-long, cold operation of the Allied General Nuclear Services facility in Barnwell, South Carolina. The L-edge data were automatically analyzed and the results were transmitted to the materials accounting computer once every 5.5 min for the duration of the cold run. This report compares the results of the L-edge analyses with the delayed results obtained from destructive analysis of samples withdrawn from the same process line. Comparisons are also made with the results obtained in near real time from an automated process control instrument installed in series with the L-edge densitometer. The performance of the L-edge instrument was reliable throughout the continous operation. The assay precision was consistent with that predicted by the counting statistics of the measurement. The results of the L-edge assays show good agreement with those of the destructive assays. A gradually varying discrepancy (of a few percent) between the L-edge and the process control results remains unexplained. 9 figures

  19. Automated on-line L-edge measurement of SNM concentration for near-real-time accounting

    International Nuclear Information System (INIS)

    Russo, P.A.; Marks, T. Jr.; Stephens, M.M.; Baker, A.L.; Cobb, D.D.

    1982-09-01

    An L-edge densitometer has been modified, tested, and demonstrated for on-line assay of special nuclear material concentration in flowing solution streams. The demonstration was part of a larger demonstration of near-real-time nuclear materials accounting during a continuous, week-long, cold operation of the Barnwell facility. The L-edge data were automatically analyzed and the results were transmitted to the materials accounting computer once every 5.5 min for the duration of the cold run. This report compares the results of the L-edge analyses with the delayed results obtained from destructive analysis of samples withdrawn from the same process line. Comparisons are also made with the results obtained in near real time from an automated process control instrument installed in series with the L-edge densitometer. The performance of the L-edge instrument was reliable throughout the continuous operation. The assay precision was consistent with that predicted by the counting statistics of the measurement. The results of the L-edge assays show good agreement with those of the destructive assays. A gradually varying discrepancy (of a few percent) between the L-edge and the process control results remains unexplained

  20. Practical utility of on-line clearance and blood temperature monitors as noninvasive techniques to measure hemodialysis blood access flow.

    Science.gov (United States)

    Fontseré, Néstor; Blasco, Miquel; Maduell, Francisco; Vera, Manel; Arias-Guillen, Marta; Herranz, Sandra; Blanco, Teresa; Barrufet, Marta; Burrel, Marta; Montaña, Javier; Real, Maria Isabel; Mestres, Gaspar; Riambau, Vicenç; Campistol, Josep M

    2011-01-01

    Access blood flow (Qa) measurements are recommended by the current guidelines as one of the most important components in vascular access maintenance programs. This study evaluates the efficiency of Qa measurement with on-line conductivity (OLC-Qa) and blood temperature monitoring (BTM-Qa) in comparison with the gold standard saline dilution method (SDM-Qa). 50 long-term hemodialysis patients (42 arteriovenous fistulas/8 arteriovenous grafts) were studied. Bland-Altman and Lin's coefficient (ρ(c)) were used to study accuracy and precision. Mean values were 1,021.7 ± 502.4 ml/min SDM-Qa, 832.8 ± 574.3 ml/min OLC-Qa (p = 0.007) and 1,094.9 ± 491.9 ml/min with BTM-Qa (p = NS). Biases and ρ(c) obtained were -188.8 ml/min (ρ(c) 0.58) OLC-Qa and 73.2 ml/min (ρ(c) 0.89) BTM-Qa. The limits of agreement (bias ± 1.96 SD) obtained were from -1,119 to 741.3 ml/min (OLC-Qa) and -350.6 to 497.2 ml/min (BTM-Qa). BTM-Qa and OLC-Qa are valid noninvasive and practical methods to estimate Qa, although BTM-Qa was more accurate and had better concordance than OLC-Qa compared with SDM-Qa. Copyright © 2010 S. Karger AG, Basel.

  1. On-line mass spectrometry measurement of fission gas release from nuclear fuel submitted to thermal transients

    International Nuclear Information System (INIS)

    Guigues, E.; Janulyte, A.; Zerega, Y.; Pontillon, Y.

    2013-06-01

    The work presented in this paper has been performed in the framework of a joint research program between Aix-Marseille University and CEA Cadarache. The aim is to develop a mass spectrometer (MS) device for the MERARG facility. MERARG is devoted to the study of fission gas release measurement, from nuclear fuels submitted to annealing tests in high activity laboratory such as LECA-STAR, thanks to gamma spectrometry. The mass spectrometer will then extend the measurement capability from the γ-emitters gases to all the gases involved in the release in order to have a better understanding of the fission gas release dynamics from fuel during thermal transients. Furthermore, the mass spectrometer instrument combines the capabilities and performances of both on-line (for release kinetic) and off-line implementations (for delayed accurate analysis of capacities containing total release gas). The paper deals with two main axes: (1) the modelling of gas sampling inlet device and its performance and (2) the first MS qualification/calibration results. The inlet device samples the gas and also adapts the pressure between MERARG sweeping line at 1.2 bar and mass spectrometer chamber at high vacuum. It is a two-stage device comprising a capillary at inlet, an intermediate vacuum chamber, a molecular leak inlet and a two-stage pumping device. Pressure drops, conductance and throughputs are estimated both for mass spectrometer operation and for exhaust gas recovery. Possible gas segregation is also estimated and device modification is proposed to attain a more accurate calibration. First experimental results obtained from a standard gas bottle show that the quantitative analysis at a few ppm level can be achieved for all isotopes of Kr and Xe, as well as masses 2 and 4 u. (authors)

  2. Application of an online ion-chromatography-based instrument for gradient flux measurements of speciated nitrogen and sulfur

    Science.gov (United States)

    Rumsey, Ian C.; Walker, John T.

    2016-06-01

    The dry component of total nitrogen and sulfur atmospheric deposition remains uncertain. The lack of measurements of sufficient chemical speciation and temporal extent make it difficult to develop accurate mass budgets and sufficient process level detail is not available to improve current air-surface exchange models. Over the past decade, significant advances have been made in the development of continuous air sampling measurement techniques, resulting with instruments of sufficient sensitivity and temporal resolution to directly quantify air-surface exchange of nitrogen and sulfur compounds. However, their applicability is generally restricted to only one or a few of the compounds within the deposition budget. Here, the performance of the Monitor for AeRosols and GAses in ambient air (MARGA 2S), a commercially available online ion-chromatography-based analyzer is characterized for the first time as applied for air-surface exchange measurements of HNO3, NH3, NH4+, NO3-, SO2 and SO42-. Analytical accuracy and precision are assessed under field conditions. Chemical concentrations gradient precision are determined at the same sampling site. Flux uncertainty measured by the aerodynamic gradient method is determined for a representative 3-week period in fall 2012 over a grass field. Analytical precision and chemical concentration gradient precision were found to compare favorably in comparison to previous studies. During the 3-week period, percentages of hourly chemical concentration gradients greater than the corresponding chemical concentration gradient detection limit were 86, 42, 82, 73, 74 and 69 % for NH3, NH4+, HNO3, NO3-, SO2 and SO42-, respectively. As expected, percentages were lowest for aerosol species, owing to their relatively low deposition velocities and correspondingly smaller gradients relative to gas phase species. Relative hourly median flux uncertainties were 31, 121, 42, 43, 67 and 56 % for NH3, NH4+, HNO3, NO3-, SO2 and SO42-, respectively. Flux

  3. Personalized risk communication for personalized risk assessment: Real world assessment of knowledge and motivation for six mortality risk measures from an online life expectancy calculator.

    Science.gov (United States)

    Manuel, Douglas G; Abdulaziz, Kasim E; Perez, Richard; Beach, Sarah; Bennett, Carol

    2018-01-01

    In the clinical setting, previous studies have shown personalized risk assessment and communication improves risk perception and motivation. We evaluated an online health calculator that estimated and presented six different measures of life expectancy/mortality based on a person's sociodemographic and health behavior profile. Immediately after receiving calculator results, participants were invited to complete an online survey that asked how informative and motivating they found each risk measure, whether they would share their results and whether the calculator provided information they need to make lifestyle changes. Over 80% of the 317 survey respondents found at least one of six healthy living measures highly informative and motivating, but there was moderate heterogeneity regarding which measures respondents found most informative and motivating. Overall, health age was most informative and life expectancy most motivating. Approximately 40% of respondents would share the results with their clinician (44%) or social networks (38%), although the information they would share was often different from what they found informative or motivational. Online personalized risk assessment allows for a more personalized communication compared to historic paper-based risk assessment to maximize knowledge and motivation, and people should be provided a range of risk communication measures that reflect different risk perspectives.

  4. Measuring motivation using the transtheoretical (stages of change) model: A follow-up study of people who failed an online hearing screening.

    Science.gov (United States)

    Ingo, Elisabeth; Brännström, K Jonas; Andersson, Gerhard; Lunner, Thomas; Laplante-Lévesque, Ariane

    2016-07-01

    Acceptance and readiness to seek professional help have shown to be important factors for favourable audiological rehabilitation outcomes. Theories from health psychology such as the transtheoretical (stages-of-change) model could help understand behavioural change in people with hearing impairment. In recent studies, the University of Rhode Island change assessment (URICA) has been found to have good predictive validity. In a previous study, 224 Swedish adults who had failed an online hearing screening completed URICA and two other measures of stages of change. This follow-up aimed to: (1) determine prevalence of help-seeking at a hearing clinic and hearing aid uptake, and (2) explore the predictive validity of the stages of change measures by a follow-up on the 224 participants who had failed a hearing screening 18 months previously. A total of 122 people (54%) completed the follow-up online questionnaire, including the three measures and questions regarding experience with hearing help-seeking and hearing aid uptake. Since failing the online hearing screening, 61% of participants had sought help. A good predictive validity for a one-item measure of stages of change was reported. The Staging algorithm was the stages of change measure with the best ability to predict help-seeking 18 months later.

  5. The interplay between the anticipation and subsequent online processing of emotional stimuli as measured by pupillary dilatation: the role of cognitive reappraisal.

    Science.gov (United States)

    Vanderhasselt, Marie-Anne; Remue, Jonathan; Ng, Kwun Kei; De Raedt, Rudi

    2014-01-01

    Emotions can occur during an emotion-eliciting event, but they can also arise when anticipating the event. We used pupillary responses, as a measure of effortful cognitive processing, to test whether the anticipation of an emotional stimulus (positive and negative) influences the subsequent online processing of that emotional stimulus. Moreover, we tested whether individual differences in the habitual use of emotion regulation strategies are associated with pupillary responses during the anticipation and/or online processing of this emotional stimulus. Our results show that, both for positive and negative stimuli, pupillary diameter during the anticipation of emotion-eliciting events is inversely and strongly correlated to pupillary responses during the emotional image presentation. The variance in this temporal interplay between anticipation and online processing was related to individual differences in emotion regulation. Specifically, the results show that high reappraisal scores are related to larger pupil diameter during the anticipation which is related to smaller pupillary responses during the online processing of emotion-eliciting events. The habitual use of expressive suppression was not associated to pupillary responses in the anticipation and subsequent online processing of emotional stimuli. Taken together, the current data suggest (most strongly for individuals scoring high on the habitual use of reappraisal) that larger pupillary responses during the anticipation of an emotional stimulus are indicative of a sustained attentional set activation to prepare for an upcoming emotional stimulus, which subsequently directs a reduced need to cognitively process that emotional event. Hence, because the habitual use of reappraisal is known to have a positive influence on emotional well-being, the interplay between anticipation and online processing of emotional stimuli might be a significant marker of this well-being.

  6. The interplay between the anticipation and subsequent online processing of emotional stimuli as measured by pupillary dilatation: the role of cognitive reappraisal

    Directory of Open Access Journals (Sweden)

    Marie-Anne eVanderhasselt

    2014-03-01

    Full Text Available Emotions can occur during an emotion-eliciting event, but they can also arise when anticipating the event. We used pupillary responses, as a measure of effortful cognitive processing, to test whether the anticipation of an emotional stimulus (positive and negative influences the subsequent online processing of that emotional stimulus. Moreover, we tested whether individual differences in the habitual use of emotion regulation strategies are associated with pupillary responses during the anticipation and/or online processing of this emotional stimulus. Our results show that, both for positive and negative stimuli, pupillary diameter during the anticipation of emotion-eliciting events is inversely and strongly correlated to pupillary responses during the emotional image presentation. The variance in this temporal interplay between anticipation and online processing was related to individual differences in emotion regulation. Specifically, the results show that high reappraisal scores are related to larger pupil diameter during the anticipation and subsequent smaller pupillary responses during the online processing of emotion-eliciting events. The habitual use of expressive suppression was not associated to pupillary responses in the anticipation and subsequent online processing of emotional stimuli. All together, the current data suggest (most strongly for individuals scoring high on the habitual use of reappraisal that larger pupillary responses during the anticipation of an emotional stimulus are indicative of a sustained attentional set activation to prepare for an upcoming emotional stimulus, which subsequently directs a reduced need to cognitively process that emotional event. Because the habitual use of reappraisal is known to have a positive influence on emotional well-being, the interplay between anticipation and online processing of emotional stimuli might be a significant marker of this well-being.

  7. On-line technique for preparingand measuring stable carbon isotopeof total dissolved inorganic carbonin water samples ( d13CTDIC

    Directory of Open Access Journals (Sweden)

    S. Inguaggiato

    2005-06-01

    Full Text Available A fast and completely automated procedure is proposed for the preparation and determination of d13C of total inorganic carbon dissolved in water ( d13CTDIC. This method is based on the acidification of water samples transforming the whole dissolved inorganic carbon species into CO2. Water samples are directly injected by syringe into 5.9 ml vials with screw caps which have a pierciable rubber septum. An Analytical Precision «Carbonate Prep System» was used both to flush pure helium into the vials and to automatically dispense a fixed amount of H3PO4. Full-equilibrium conditions between produced CO2 and water are reached at a temperature of 70°C (± 0.1°C in less than 24 h. Carbon isotope ratios (13C/ 12C were measured on an AP 2003 continuous flow mass spectrometer, connected on-line with the injection system. The precision and reproducibility of the proposed method was tested both on aqueous standard solutions prepared using Na2CO3 with d13C=-10.78 per mil versus PDB (1 s= 0.08, n = 11, and at five different concentrations (2, 3, 4, 5 and 20 mmol/l and on more than thirty natural samples. Mean d13CTDIC on standard solution samples is ?10.89 < per mil versus PDB (1 s= 0.18, n = 50, thus revealing both a good analytical precision and reproducibility. A comparison between average d13CTDIC values on a quadruplicate set of natural samples and those obtained following the chemical and physical stripping method highlights a good agreement between the two analytical methods.

  8. A new lithium-ion battery internal temperature on-line estimate method based on electrochemical impedance spectroscopy measurement

    Science.gov (United States)

    Zhu, J. G.; Sun, Z. C.; Wei, X. Z.; Dai, H. F.

    2015-01-01

    The power battery thermal management problem in EV (electric vehicle) and HEV (hybrid electric vehicle) has been widely discussed, and EIS (electrochemical impedance spectroscopy) is an effective experimental method to test and estimate the status of the battery. Firstly, an electrochemical-based impedance matrix analysis for lithium-ion battery is developed to describe the impedance response of electrochemical impedance spectroscopy. Then a method, based on electrochemical impedance spectroscopy measurement, has been proposed to estimate the internal temperature of power lithium-ion battery by analyzing the phase shift and magnitude of impedance at different ambient temperatures. Respectively, the SoC (state of charge) and temperature have different effects on the impedance characteristics of battery at various frequency ranges in the electrochemical impedance spectroscopy experimental study. Also the impedance spectrum affected by SoH (state of health) is discussed in the paper preliminary. Therefore, the excitation frequency selected to estimate the inner temperature is in the frequency range which is significantly influenced by temperature without the SoC and SoH. The intrinsic relationship between the phase shift and temperature is established under the chosen excitation frequency. And the magnitude of impedance related to temperature is studied in the paper. In practical applications, through obtaining the phase shift and magnitude of impedance, the inner temperature estimation could be achieved. Then the verification experiments are conduced to validate the estimate method. Finally, an estimate strategy and an on-line estimation system implementation scheme utilizing battery management system are presented to describe the engineering value.

  9. Online measuring devices at sewage treatment plants - state of the art and future market potential; On-Line-Messtechnik auf Klaeranlagen - Aktueller Stand und Marktpotential fuer die Zukunft

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, P [Inst. fuer Siedlungswasserbau, Wasserguete- und Abfallwirtschaft der Univ. Stuttgart, Abt. Abwassertechnik (Germany); Schlegel, S [Emschergenossenschaft, Essen (Germany)

    1998-12-31

    By means of a survey commissioned by ATV/GFA, the purposes of use and spheres of use as well as the operating experience with online measuring devices for the determination of ammonium, oxidized nitrogen compounds and orthophosphate were established and evaluated. In addition, data were acquired with the aid of other units for the continuous recording of chemical and physical parameters of sewage treatment. Finally, the future market potentials and development pospects of online measuring devices were evaluated. (orig.) [Deutsch] Anhand einer im Auftrag der ATV/GFA durchgefuehrten Umfrage wurden Einsatzzweck, Einsatzbereiche und Betriebserfahrungen von On-line-Messgeraeten zur Bestimmung von Ammonium, oxidierten Stickstoffverbindungen und Orthophosphat dargestellt und bewertet. Zusaetzlich wurden auch Daten von anderen Geraeteeinheiten zur kontinuierlichen Erfassung von chemischen und physikalischen Parametern bei der Abwasserreinigung erhoben. Anschliessend wurde das zukuenftige Marktpotential und die Entwicklungsmoeglichkeiten bei der On-line-Messtechnik bewertet. (orig.)

  10. Online measuring devices at sewage treatment plants - state of the art and future market potential; On-Line-Messtechnik auf Klaeranlagen - Aktueller Stand und Marktpotential fuer die Zukunft

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, P. [Inst. fuer Siedlungswasserbau, Wasserguete- und Abfallwirtschaft der Univ. Stuttgart, Abt. Abwassertechnik (Germany); Schlegel, S. [Emschergenossenschaft, Essen (Germany)

    1997-12-31

    By means of a survey commissioned by ATV/GFA, the purposes of use and spheres of use as well as the operating experience with online measuring devices for the determination of ammonium, oxidized nitrogen compounds and orthophosphate were established and evaluated. In addition, data were acquired with the aid of other units for the continuous recording of chemical and physical parameters of sewage treatment. Finally, the future market potentials and development pospects of online measuring devices were evaluated. (orig.) [Deutsch] Anhand einer im Auftrag der ATV/GFA durchgefuehrten Umfrage wurden Einsatzzweck, Einsatzbereiche und Betriebserfahrungen von On-line-Messgeraeten zur Bestimmung von Ammonium, oxidierten Stickstoffverbindungen und Orthophosphat dargestellt und bewertet. Zusaetzlich wurden auch Daten von anderen Geraeteeinheiten zur kontinuierlichen Erfassung von chemischen und physikalischen Parametern bei der Abwasserreinigung erhoben. Anschliessend wurde das zukuenftige Marktpotential und die Entwicklungsmoeglichkeiten bei der On-line-Messtechnik bewertet. (orig.)

  11. On-line mass spectrometry system for measurements at single-crystal electrodes in hanging meniscus configuration

    NARCIS (Netherlands)

    Wonders, A.H.; Housmans, T.H.M.; Rosca, V.; Koper, M.T.M.

    2006-01-01

    We present the construction and some first applications of an On-line electrochemical mass spectrometry system for detecting volatile products formed during electrochemical reactions at a single-crystal electrode in hanging meniscus configuration. The system is based on a small inlet tip made of

  12. The Development of an Instrument to Measure the Project Competences of College Students in Online Project-Based Learning

    Science.gov (United States)

    Lin, Chien-Liang

    2018-01-01

    This study sought to develop a self-report instrument to be used in the assessment of the project competences of college students engaged in online project-based learning. Three scales of the KIPSSE instrument developed for this study, namely, the knowledge integration, project skills, and self-efficacy scales, were based on related theories and…

  13. Online measurement of nitrification inhibitors in sewage received by an industrial sewage treatment plant. Development of a nitrification toximeter; Online-Messung nitrifikationshemmender Stoffe im Zulauf einer Industrieklaeranlage - Entwicklung eines Nitrifikationstoximeters

    Energy Technology Data Exchange (ETDEWEB)

    Haid, M. [BASF AG, Ludwigshafen am Rhein (Germany)

    1999-07-01

    At an industrial sewage treatment plant, the ammonium freight in the effluent is to be further reduced in the future through nitrification. But constantly low effluent concentrations are only possible if the nitrification process is not inhibited. Bouts of critical concentrations of nitrification inhibitors in sewage received by treatment plant are potentially disturbing. Online measurement of nitrification inhibitors in sewage arriving at the treatment plant is to recognize such bouts and permit timely alert so that counter-measures can be taken, which may consist in routing sewage with such toxic concentrations into a storage basin, whereby a sharp slump in the nitrification process can be avoided. (orig.) [German] In einer Industrieklaeranlage soll kuenftig durch Nitrifikation die Ammoniumfracht im Auslauf weiter gesenkt werden. Konstant niedrige Ablaufwerte sind aber nur dann moeglich, wenn der Nitrifikationsprozess ungestoert ablaufen kann. Stoesse nitrifikationshemmender Stoffe in kritischen Konzentrationen im Zulauf zur Klaeranlage sind eine moegliche Stoergroesse. Mit Hilfe einer Online-Nitrifikationshemmmessung im Klaeranlagenzulauf sollen solche Stoesse erkannt und rechtzeitig alarmiert werden, damit Gegenmassnahmen, wie z.B. das Auffangen des toxischen Stosses durch eine Sicherheitsschaltung in einem Speicherbecken, eingeleitet und so signifikante Einbrueche des Nitrifikationsprozesses vermieden werden koennen. (orig.)

  14. Development of a method for fast and automatic radiocarbon measurement of aerosol samples by online coupling of an elemental analyzer with a MICADAS AMS

    Energy Technology Data Exchange (ETDEWEB)

    Salazar, G., E-mail: gary.salazar@dcb.unibe.ch [Department of Chemistry and Biochemistry & Oeschger Centre for Climate Change Research, University of Bern, 3012 Bern (Switzerland); Zhang, Y.L.; Agrios, K. [Department of Chemistry and Biochemistry & Oeschger Centre for Climate Change Research, University of Bern, 3012 Bern (Switzerland); Paul Scherrer Institut (PSI), 5232 Villigen (Switzerland); Szidat, S. [Department of Chemistry and Biochemistry & Oeschger Centre for Climate Change Research, University of Bern, 3012 Bern (Switzerland)

    2015-10-15

    A fast and automatic method for radiocarbon analysis of aerosol samples is presented. This type of analysis requires high number of sample measurements of low carbon masses, but accepts precisions lower than for carbon dating analysis. The method is based on online Trapping CO{sub 2} and coupling an elemental analyzer with a MICADAS AMS by means of a gas interface. It gives similar results to a previously validated reference method for the same set of samples. This method is fast and automatic and typically provides uncertainties of 1.5–5% for representative aerosol samples. It proves to be robust and reliable and allows for overnight and unattended measurements. A constant and cross contamination correction is included, which indicates a constant contamination of 1.4 ± 0.2 μg C with 70 ± 7 pMC and a cross contamination of (0.2 ± 0.1)% from the previous sample. A Real-time online coupling version of the method was also investigated. It shows promising results for standard materials with slightly higher uncertainties than the Trapping online approach.

  15. Monitoring on-line system for the lactic fermentation measurement using the integration enzyme sensor; Shusekika koso sensa wo mochiita nyusan hakko keisokuyo onrain monitringu shisutemu

    Energy Technology Data Exchange (ETDEWEB)

    Suzuki, Masayasu; Kumagaya, Tsuyoshi; Nakajima, Yoichi [Kyushu Institute of Technology, Fukuoka (Japan)

    1999-04-05

    The monitoring on-line system for the lactic fermentation measurement in which the simultaneous measurement of the substrate. Generation was possible was constructed without consuming the culture medium by using soliciting small enzyme sensor and flow injection analysis system integrate. There was the linearity that anyway was also range of concentration of 70mM or less and that it is good on the calibration curve of minute glucose, lactose, and lactic acid sensor. It became clear that it proved that all range of concentration of the substrate of these three which combining with the micro diary system, breaks in the lactic fermentation measurement with the necessity can be measured and not observe the interference by medium components, etc. either. Constructed monitoring on-line system is Lactobacillus delbrueckii and, it was applied to the lactic fermentation process of Lactobacillus lactis. Through the fermentation process for 24 hours, simultaneous measurement of glucose (or lactose) and lactic acid is possible. The measured value agreed well with the result of colorimetric method using the enzyme. (translated by NEDO)

  16. Size characterization of airborne SiO2 nanoparticles with on-line and off-line measurement techniques: an interlaboratory comparison study

    Science.gov (United States)

    Motzkus, C.; Macé, T.; Gaie-Levrel, F.; Ducourtieux, S.; Delvallee, A.; Dirscherl, K.; Hodoroaba, V.-D.; Popov, I.; Popov, O.; Kuselman, I.; Takahata, K.; Ehara, K.; Ausset, P.; Maillé, M.; Michielsen, N.; Bondiguel, S.; Gensdarmes, F.; Morawska, L.; Johnson, G. R.; Faghihi, E. M.; Kim, C. S.; Kim, Y. H.; Chu, M. C.; Guardado, J. A.; Salas, A.; Capannelli, G.; Costa, C.; Bostrom, T.; Jämting, Å. K.; Lawn, M. A.; Adlem, L.; Vaslin-Reimann, S.

    2013-10-01

    Results of an interlaboratory comparison on size characterization of SiO2 airborne nanoparticles using on-line and off-line measurement techniques are discussed. This study was performed in the framework of Technical Working Area (TWA) 34—"Properties of Nanoparticle Populations" of the Versailles Project on Advanced Materials and Standards (VAMAS) in the project no. 3 "Techniques for characterizing size distribution of airborne nanoparticles". Two types of nano-aerosols, consisting of (1) one population of nanoparticles with a mean diameter between 30.3 and 39.0 nm and (2) two populations of non-agglomerated nanoparticles with mean diameters between, respectively, 36.2-46.6 nm and 80.2-89.8 nm, were generated for characterization measurements. Scanning mobility particle size spectrometers (SMPS) were used for on-line measurements of size distributions of the produced nano-aerosols. Transmission electron microscopy, scanning electron microscopy, and atomic force microscopy were used as off-line measurement techniques for nanoparticles characterization. Samples were deposited on appropriate supports such as grids, filters, and mica plates by electrostatic precipitation and a filtration technique using SMPS controlled generation upstream. The results of the main size distribution parameters (mean and mode diameters), obtained from several laboratories, were compared based on metrological approaches including metrological traceability, calibration, and evaluation of the measurement uncertainty. Internationally harmonized measurement procedures for airborne SiO2 nanoparticles characterization are proposed.

  17. Size characterization of airborne SiO{sub 2} nanoparticles with on-line and off-line measurement techniques: an interlaboratory comparison study

    Energy Technology Data Exchange (ETDEWEB)

    Motzkus, C., E-mail: charles.motzkus@lne.fr; Mace, T.; Gaie-Levrel, F.; Ducourtieux, S.; Delvallee, A. [Laboratoire National de Metrologie et d' Essais (LNE) (France); Dirscherl, K. [Danish Fundamental Metrology (DFM) (Denmark); Hodoroaba, V.-D. [BAM Federal Institute for Materials Research and Testing (Germany); Popov, I. [The Hebrew University of Jerusalem, Unit for Nanocharacterization (Israel); Popov, O.; Kuselman, I. [National Physical Laboratory of Israel (INPL) (Israel); Takahata, K.; Ehara, K. [National Institute of Advanced Industrial Science and Technology (AIST), National Metrology Institute of Japan (NMIJ) (Japan); Ausset, P.; Maille, M. [Universite Paris-Est Creteil et Universite Paris-Diderot, Laboratoire Interuniversitaire des Systemes Atmospheriques (LISA), UMR CNRS 7583 (France); Michielsen, N.; Bondiguel, S.; Gensdarmes, F. [Institut de Radioprotection et de Surete Nucleaire (IRSN), PSN-RES, SCA, LPMA (France); Morawska, L.; Johnson, G. R.; Faghihi, E. M. [Queensland University of Technology (QUT), International Laboratory for Air Quality and Health (ILAQH) (Australia); and others

    2013-10-15

    Results of an interlaboratory comparison on size characterization of SiO{sub 2} airborne nanoparticles using on-line and off-line measurement techniques are discussed. This study was performed in the framework of Technical Working Area (TWA) 34-'Properties of Nanoparticle Populations' of the Versailles Project on Advanced Materials and Standards (VAMAS) in the project no. 3 'Techniques for characterizing size distribution of airborne nanoparticles'. Two types of nano-aerosols, consisting of (1) one population of nanoparticles with a mean diameter between 30.3 and 39.0 nm and (2) two populations of non-agglomerated nanoparticles with mean diameters between, respectively, 36.2-46.6 nm and 80.2-89.8 nm, were generated for characterization measurements. Scanning mobility particle size spectrometers (SMPS) were used for on-line measurements of size distributions of the produced nano-aerosols. Transmission electron microscopy, scanning electron microscopy, and atomic force microscopy were used as off-line measurement techniques for nanoparticles characterization. Samples were deposited on appropriate supports such as grids, filters, and mica plates by electrostatic precipitation and a filtration technique using SMPS controlled generation upstream. The results of the main size distribution parameters (mean and mode diameters), obtained from several laboratories, were compared based on metrological approaches including metrological traceability, calibration, and evaluation of the measurement uncertainty. Internationally harmonized measurement procedures for airborne SiO{sub 2} nanoparticles characterization are proposed.

  18. Size characterization of airborne SiO2 nanoparticles with on-line and off-line measurement techniques: an interlaboratory comparison study

    International Nuclear Information System (INIS)

    Motzkus, C.; Macé, T.; Gaie-Levrel, F.; Ducourtieux, S.; Delvallee, A.; Dirscherl, K.; Hodoroaba, V.-D.; Popov, I.; Popov, O.; Kuselman, I.; Takahata, K.; Ehara, K.; Ausset, P.; Maillé, M.; Michielsen, N.; Bondiguel, S.; Gensdarmes, F.; Morawska, L.; Johnson, G. R.; Faghihi, E. M.

    2013-01-01

    Results of an interlaboratory comparison on size characterization of SiO 2 airborne nanoparticles using on-line and off-line measurement techniques are discussed. This study was performed in the framework of Technical Working Area (TWA) 34—“Properties of Nanoparticle Populations” of the Versailles Project on Advanced Materials and Standards (VAMAS) in the project no. 3 “Techniques for characterizing size distribution of airborne nanoparticles”. Two types of nano-aerosols, consisting of (1) one population of nanoparticles with a mean diameter between 30.3 and 39.0 nm and (2) two populations of non-agglomerated nanoparticles with mean diameters between, respectively, 36.2–46.6 nm and 80.2–89.8 nm, were generated for characterization measurements. Scanning mobility particle size spectrometers (SMPS) were used for on-line measurements of size distributions of the produced nano-aerosols. Transmission electron microscopy, scanning electron microscopy, and atomic force microscopy were used as off-line measurement techniques for nanoparticles characterization. Samples were deposited on appropriate supports such as grids, filters, and mica plates by electrostatic precipitation and a filtration technique using SMPS controlled generation upstream. The results of the main size distribution parameters (mean and mode diameters), obtained from several laboratories, were compared based on metrological approaches including metrological traceability, calibration, and evaluation of the measurement uncertainty. Internationally harmonized measurement procedures for airborne SiO 2 nanoparticles characterization are proposed

  19. Study for on-line system to identify inadvertent control rod drops in PWR reactors using ex-core detector and thermocouple measures

    International Nuclear Information System (INIS)

    Souza, Thiago J.; Medeiros, Jose A.C.C.; Goncalves, Alessandro C.

    2015-01-01

    Accidental control rod drops event in PWR reactors leads to an unsafe operating condition. It is important to quickly identify the rod to minimize undesirable effects in such a scenario. In this event, there is a distortion in the power distribution and temperature in the reactor core. The goal of this study is to develop an on-line model to identify the inadvertent control rod dropped in PWR reactor. The proposed model is based on physical correlations and pattern recognition of ex-core detector responses and thermocouples measures. The results of the study demonstrated the feasibility of an on-line system, contributing to safer operation conditions and preventing undesirable effects, as its shutdown. (author)

  20. Study for on-line system to identify inadvertent control rod drops in PWR reactors using ex-core detector and thermocouple measures

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Thiago J.; Medeiros, Jose A.C.C.; Goncalves, Alessandro C., E-mail: tsouza@nuclear.ufrj.br, E-mail: canedo@lmp.ufrj.br, E-mail: alessandro@nuclear.ufrj.br [Coordenacao dos Programas de Pos-Graduacao em Engenharia (COPPE/UFRJ), Rio de Janeiro, RJ (Brazil). Programa de Engenharia Nuclear

    2015-07-01

    Accidental control rod drops event in PWR reactors leads to an unsafe operating condition. It is important to quickly identify the rod to minimize undesirable effects in such a scenario. In this event, there is a distortion in the power distribution and temperature in the reactor core. The goal of this study is to develop an on-line model to identify the inadvertent control rod dropped in PWR reactor. The proposed model is based on physical correlations and pattern recognition of ex-core detector responses and thermocouples measures. The results of the study demonstrated the feasibility of an on-line system, contributing to safer operation conditions and preventing undesirable effects, as its shutdown. (author)

  1. The influence of specific mechanical energy on cornmeal viscosity measured by an on-line system during twin-screw extrusion

    OpenAIRE

    CHANG, Y. K.; MARTINEZ-BUSTOS, F.; PARK, T. S.; KOKINI, J .L.

    1999-01-01

    The influence of specific mechanical energy (SME) on cornmeal viscosity during the twin-screw extrusion at feed moisture contents of 25 and 30% and screw speeds in the range from 100 to 500 rpm was measured. Cornmeal was extruded in a co-rotating, intermeshing twin-screw coupled to a slit die rheometer. One approach to the on-line rheological measurement is to use a slit die with the extruder. In the present work it was show that shear viscosity decreased as a function of SME. The viscosity o...

  2. Online Piracy

    OpenAIRE

    Daniel A. Howard

    2017-01-01

    Piracy, whether made online or in any other way is an illegal act, which should be avoided and stopped. In this era of rapid globalization and booming technology, online piracy can be seen in many forms. However, the main area of concern are the consequences that the online piracy has for the many people who are directly or indirectly involved in it. These consequences provide implications for ethical considerations. In my opinion, online piracy is an unethical act and should be avoided, howe...

  3. Development of an online library of patient-reported outcome measures in gastroenterology: The GI-PRO database

    OpenAIRE

    Khanna, P; Agarwal, N; Khanna, D; Hays, RD; Chang, L; Bolus, R; Melmed, G; Whitman, CB; Kaplan, RM; Ogawa, R; Snyder, B; Spiegel, BM

    2014-01-01

    OBJECTIVES:Because gastrointestinal (GI) illnesses can cause physical, emotional, and social distress, patient-reported outcomes (PROs) are used to guide clinical decision making, conduct research, and seek drug approval. It is important to develop a mechanism for identifying, categorizing, and evaluating the over 100 GI PROs that exist. Here we describe a new, National Institutes of Health (NIH)-supported, online PRO clearinghouse-the GI-PRO database.METHODS: Using a protocol developed by th...

  4. A scintillator-based online detector for the angularly resolved measurement of laser-accelerated proton spectra

    International Nuclear Information System (INIS)

    Metzkes, J.; Kraft, S. D.; Sobiella, M.; Stiller, N.; Zeil, K.; Schramm, U.; Karsch, L.; Schürer, M.; Pawelke, J.; Richter, C.

    2012-01-01

    In recent years, a new generation of high repetition rate (∼10 Hz), high power (∼100 TW) laser systems has stimulated intense research on laser-driven sources for fast protons. Considering experimental instrumentation, this development requires online diagnostics for protons to be added to the established offline detection tools such as solid state track detectors or radiochromic films. In this article, we present the design and characterization of a scintillator-based online detector that gives access to the angularly resolved proton distribution along one spatial dimension and resolves 10 different proton energy ranges. Conceived as an online detector for key parameters in laser-proton acceleration, such as the maximum proton energy and the angular distribution, the detector features a spatial resolution of ∼1.3 mm and a spectral resolution better than 1.5 MeV for a maximum proton energy above 12 MeV in the current design. Regarding its areas of application, we consider the detector a useful complement to radiochromic films and Thomson parabola spectrometers, capable to give immediate feedback on the experimental performance. The detector was characterized at an electrostatic Van de Graaff tandetron accelerator and tested in a laser-proton acceleration experiment, proving its suitability as a diagnostic device for laser-accelerated protons.

  5. A scintillator-based online detector for the angularly resolved measurement of laser-accelerated proton spectra.

    Science.gov (United States)

    Metzkes, J; Karsch, L; Kraft, S D; Pawelke, J; Richter, C; Schürer, M; Sobiella, M; Stiller, N; Zeil, K; Schramm, U

    2012-12-01

    In recent years, a new generation of high repetition rate (~10 Hz), high power (~100 TW) laser systems has stimulated intense research on laser-driven sources for fast protons. Considering experimental instrumentation, this development requires online diagnostics for protons to be added to the established offline detection tools such as solid state track detectors or radiochromic films. In this article, we present the design and characterization of a scintillator-based online detector that gives access to the angularly resolved proton distribution along one spatial dimension and resolves 10 different proton energy ranges. Conceived as an online detector for key parameters in laser-proton acceleration, such as the maximum proton energy and the angular distribution, the detector features a spatial resolution of ~1.3 mm and a spectral resolution better than 1.5 MeV for a maximum proton energy above 12 MeV in the current design. Regarding its areas of application, we consider the detector a useful complement to radiochromic films and Thomson parabola spectrometers, capable to give immediate feedback on the experimental performance. The detector was characterized at an electrostatic Van de Graaff tandetron accelerator and tested in a laser-proton acceleration experiment, proving its suitability as a diagnostic device for laser-accelerated protons.

  6. The Development of an Instrument to Measure the Project Competences of College Students in Online Project-Based Learning

    Science.gov (United States)

    Lin, Chien-Liang

    2018-02-01

    This study sought to develop a self-report instrument to be used in the assessment of the project competences of college students engaged in online project-based learning. Three scales of the KIPSSE instrument developed for this study, namely, the knowledge integration, project skills, and self-efficacy scales, were based on related theories and the analysis results of three project advisor interviews. Those items of knowledge integration and project skill scales focused on the integration of different disciplines and technological skills separately. Two samples of data were collected from information technology-related courses taught with an online project-based learning strategy over different semesters at a college in southern Taiwan. The validity and reliability of the KIPSSE instrument were confirmed through item analysis and confirmatory factor analysis using structural equation modeling of two samples of students' online response sets separately. The Cronbach's alpha reliability coefficient for the entire instrument was 0.931; for each scale, the alpha ranged from 0.832 to 0.907. There was also a significant correlation ( r = 0.55, p < 0.01) between the KIPSSE instrument results and the students' product evaluation scores. The findings of this study confirmed the validity and reliability of the KIPSSE instrument. The confirmation process and related implications are also discussed.

  7. A New Measure of the Perceived Influence of Sexually Explicit Online Media on the Sexual Behaviors of Men Who Have Sex With Men.

    Science.gov (United States)

    Nelson, Kimberly M; Pantalone, David W; Gamarel, Kristi E; Simoni, Jane M

    2016-01-01

    Men who have sex with men (MSM) frequently consume sexually explicit online media (SEOM), yet little is known about its influence on their sexual behaviors. We describe a sequence of four studies to develop and psychometrically validate a measure of the perceived influence of sexually explicit online media (PI-SEOM) on the sexual behaviors of MSM. Study 1 involved qualitative interviews (N = 28) and a quantitative survey (N = 100) to develop a preliminary measure. Using an Internet sample of MSM (N = 1,170), we assessed its factor structure and reliability in Studies 2 and 3 as well as convergent validity and associations with HIV-related sexual risk in Study 4. Based on findings the measure was divided into two subscales: influences on (1) self and (2) other MSM. Factor analyses confirmed a two-factor model for each subscale, measuring perceived influences on (a) general sexual scripts and (b) condomless sex scripts. Survey results indicated that the more men perceived SEOM influencing their own condomless sex scripts, the more likely they were to report engaging in sexual risk behaviors. The developed measure holds promise for assessing the influence of SEOM on the sexual behaviors of MSM and may prove useful for HIV-prevention research.

  8. Diffractive optical element-based glossmeter for the on-line measurement of normal reflectance on a printed porous coated paper

    Science.gov (United States)

    Oksman, Antti; Kuivalainen, Kalle; Ta˚G, Carl-Mikael; Juuti, Mikko; Mattila, Rauno; Hietala, Eero; Gane, Patrick A. C.; Peiponen, Kai-Erik

    2011-04-01

    Gloss of a product, such as print gloss, is mainly inspected with conventional white light glossmeters both at laboratory or production facilities. However, problems occur in conventional gloss measurement when the inspected surface is vertically moved in the plane of incidence and reflection or when the measurement area is small or curved. For a partial solution to these problems, we have previously introduced diffractive optical element-based glossmeters (DOGs) for the gloss inspection in laboratories and off-line use. We present a new construction of DOG, termed μDOG 1D, for the one-dimensional on-line print gloss measurement, in the form of the reflectance determination normal to the surface. The function of the glossmeter is demonstrated by laboratory tests and on-line measurements at a heat-set web offset printing machine. It is shown that gloss (i.e., normal reflectance) and minute gloss variation of papers and prints can be measured at the printing line using the glossmeter. This glossmeter is expected to be useful in real-time monitoring of the gloss and surface-specific absorption not only in the printing industry but also in inspection of products in other industrial sectors, such as metal finishing, laminating, paper, and construction materials manufacturing.

  9. Follow #eHealth2011: Measuring the Role and Effectiveness of Online and Social Media in Increasing the Outreach of a Scientific Conference.

    Science.gov (United States)

    Winandy, Marcel; Kostkova, Patty; de Quincey, Ed; St Louis, Connie; Szomszor, Martin

    2016-07-19

    Social media promotion is increasingly adopted by organizers of industry and academic events; however, the success of social media strategies is rarely questioned or the real impact scientifically analyzed. We propose a framework that defines and analyses the impact, outreach, and effectiveness of social media for event promotion and research dissemination to participants of a scientific event as well as to the virtual audience through the Web. Online communication channels Twitter, Facebook, Flickr, and a Liveblog were trialed and their impact measured on outreach during five phases of an eHealth conference: the setup, active and last-minute promotion phases before the conference, the actual event, and after the conference. Planned outreach through online channels and social media before and during the event reached an audience several magnitudes larger in size than would have been possible using traditional means. In the particular case of eHealth 2011, the outreach using traditional means would have been 74 attendees plus 23 extra as sold proceedings and the number of downloaded articles from the online proceedings (4107 until October 2013). The audience for the conference reached via online channels and social media was estimated at more than 5300 in total during the event. The role of Twitter for promotion before the event was complemented by an increased usage of the website and Facebook during the event followed by a sharp increase of views of posters on Flickr after the event. Although our case study is focused on a particular audience around eHealth 2011, our framework provides a template for redefining "audience" and outreach of events, merging traditional physical and virtual communities and providing an outline on how these could be successfully reached in clearly defined event phases.

  10. Interest of a simple on-line screening registry for measuring ICU burden related to an influenza pandemic.

    Science.gov (United States)

    Richard, Jean-Christophe Marie; Pham, Tài; Brun-Buisson, Christian; Reignier, Jean; Mercat, Alain; Beduneau, Gaëtan; Régnier, Bernard; Mourvillier, Bruno; Guitton, Christophe; Castanier, Matthias; Combes, Alain; Le Tulzo, Yves; Brochard, Laurent

    2012-07-09

    The specific burden imposed on Intensive Care Units (ICUs) during the A/H1N1 influenza 2009 pandemic has been poorly explored. An on-line screening registry allowed a daily report of ICU beds occupancy rate by flu infected patients (Flu-OR) admitted in French ICUs. We conducted a prospective inception cohort study with results of an on-line screening registry designed for daily assessment of ICU burden. Among the 108 centers participating to the French H1N1 research network on mechanical ventilation (REVA) - French Society of Intensive Care (SRLF) registry, 69 ICUs belonging to seven large geographical areas voluntarily participated in a website screening-registry. The aim was to daily assess the ICU beds occupancy rate by influenza-infected and non-infected patients for at least three weeks. Three hundred ninety-one critically ill infected patients were enrolled in the cohort, representing a subset of 35% of the whole French 2009 pandemic cohort; 73% were mechanically ventilated, 13% required extra corporal membrane oxygenation (ECMO) and 22% died. The global Flu-OR in these ICUs was only 7.6%, but it exceeded a predefined 15% critical threshold in 32 ICUs for a total of 103 weeks. Flu-ORs were significantly higher in University than in non-University hospitals. The peak ICU burden was poorly predicted by observations obtained at the level of large geographical areas. The peak Flu-OR during the pandemic significantly exceeded a 15% critical threshold in almost half of the ICUs, with an uneven distribution with time, geographical areas and between University and non-University hospitals. An on-line assessment of Flu-OR via a simple dedicated registry may contribute to better match resources and needs.

  11. VizieR Online Data Catalog: New spectral lag measurements of 50 Fermi/GBM GRBs (Shao+, 2017)

    Science.gov (United States)

    Shao, L.; Zhang, B.-B.; Wang, F.-R.; Wu, X.-F.; Cheng, Y.-H.; Zhang, Xi; Yu, B.-Y.; Xi, B.-J.; Wang, X.; Feng, H.-X.; Zhang, M.; Xu, D.

    2018-03-01

    This work made extensive use of the data from the Gamma-Ray Burst Monitor (GBM) on board the Fermi Gamma-ray Space Telescope. For the first step, we searched in the official GBM online burst catalog (Gruber+ 2014ApJS..211...12G ; von Kienlin+ 2014, J/ApJS/211/13) for bright bursts with a total fluence F>5x10-6erg/cm-2 in 10-1000keV. See section 2 for the details on the sample selection. (1 data file).

  12. Visual identification and similarity measures used for on-line motion planning of autonomous robots in unknown environments

    Science.gov (United States)

    Martínez, Fredy; Martínez, Fernando; Jacinto, Edwar

    2017-02-01

    In this paper we propose an on-line motion planning strategy for autonomous robots in dynamic and locally observable environments. In this approach, we first visually identify geometric shapes in the environment by filtering images. Then, an ART-2 network is used to establish the similarity between patterns. The proposed algorithm allows that a robot establish its relative location in the environment, and define its navigation path based on images of the environment and its similarity to reference images. This is an efficient and minimalist method that uses the similarity of landmark view patterns to navigate to the desired destination. Laboratory tests on real prototypes demonstrate the performance of the algorithm.

  13. Conducting interactive experiments online.

    Science.gov (United States)

    Arechar, Antonio A; Gächter, Simon; Molleman, Lucas

    2018-01-01

    Online labor markets provide new opportunities for behavioral research, but conducting economic experiments online raises important methodological challenges. This particularly holds for interactive designs. In this paper, we provide a methodological discussion of the similarities and differences between interactive experiments conducted in the laboratory and online. To this end, we conduct a repeated public goods experiment with and without punishment using samples from the laboratory and the online platform Amazon Mechanical Turk. We chose to replicate this experiment because it is long and logistically complex. It therefore provides a good case study for discussing the methodological and practical challenges of online interactive experimentation. We find that basic behavioral patterns of cooperation and punishment in the laboratory are replicable online. The most important challenge of online interactive experiments is participant dropout. We discuss measures for reducing dropout and show that, for our case study, dropouts are exogenous to the experiment. We conclude that data quality for interactive experiments via the Internet is adequate and reliable, making online interactive experimentation a potentially valuable complement to laboratory studies.

  14. Development of High Temperature Chemistry Measurement System for Establishment of On-Line Water Chemistry Surveillance Network in Nuclear Power Plant

    International Nuclear Information System (INIS)

    Yeon, Jei Won; Kim, Won Ho; Song, Kyu Seok; Joo, Ki Soo; Choi, Ke Chon; Ha, Yeong Keong; Ahn, Hong Joo; Im, Hee Jung; Maeng, Wan Young

    2010-07-01

    An integrated high-temperature water chemistry sensor (pH, E redox ) was developed for the establishment of the on-line water chemistry surveillance system in nuclear power plants. The basic performance of the integrated sensor was confirmed in high-temperature (280 .deg. C, 150kg/m 2 ) lithium borate solutions by using the relationship between the concentration of lithium ion and pH-E redox values. Especially, the effects of various environmental factors such as temperature, pressure, and flow rate on YSZ-based pH electrode were evaluated for ensuring the accuracy of high-temperature pH measurement. And the relationships between each water chemistry factor (pH, redox potential, electrical conductivity) were induced for enhancing the credibility of water chemistry measurement. In addition, on the basis of the evaluation of a nuclear plant design company, we suggested potential installation positions of the measurement system in a nuclear power plant

  15. On-line measurement of magnetic fields at GANIL; Mesures en ligne du champ magnetique du G.A.N.I.L

    Energy Technology Data Exchange (ETDEWEB)

    Lemarie, A

    2008-03-15

    On-line measurement of the magnetic fields of electromagnets at GANIL (France) was studied and developed. This type of measurement is necessary for it allows the adjustment and the monitoring of the parameters which control the transport of particle beams from the accelerators to the experimental vaults. The developments were based on nuclear magnetic resonance (NMR) magnetometers and Hall-effect magnetometers. The limitations of operating NMR probes in inhomogeneous fields required particular solutions. Techniques of positioning and appropriate compensation for field gradients were put in place. NMR probes and Hall-effect probes are integrated into the electronics for monitoring and control according to the defined standards at GANIL. The unit comprises instrumentation which perfectly meets the needs, particularly from the point of view of the measurement and the monitoring of the magnetic parameters. (author)

  16. Comparison between Random Forests, Artificial Neural Networks and Gradient Boosted Machines Methods of On-Line Vis-NIR Spectroscopy Measurements of Soil Total Nitrogen and Total Carbon

    Directory of Open Access Journals (Sweden)

    Said Nawar

    2017-10-01

    Full Text Available Accurate and detailed spatial soil information about within-field variability is essential for variable-rate applications of farm resources. Soil total nitrogen (TN and total carbon (TC are important fertility parameters that can be measured with on-line (mobile visible and near infrared (vis-NIR spectroscopy. This study compares the performance of local farm scale calibrations with those based on the spiking of selected local samples from both fields into an European dataset for TN and TC estimation using three modelling techniques, namely gradient boosted machines (GBM, artificial neural networks (ANNs and random forests (RF. The on-line measurements were carried out using a mobile, fiber type, vis-NIR spectrophotometer (305–2200 nm (AgroSpec from tec5, Germany, during which soil spectra were recorded in diffuse reflectance mode from two fields in the UK. After spectra pre-processing, the entire datasets were then divided into calibration (75% and prediction (25% sets, and calibration models for TN and TC were developed using GBM, ANN and RF with leave-one-out cross-validation. Results of cross-validation showed that the effect of spiking of local samples collected from a field into an European dataset when combined with RF has resulted in the highest coefficients of determination (R2 values of 0.97 and 0.98, the lowest root mean square error (RMSE of 0.01% and 0.10%, and the highest residual prediction deviations (RPD of 5.58 and 7.54, for TN and TC, respectively. Results for laboratory and on-line predictions generally followed the same trend as for cross-validation in one field, where the spiked European dataset-based RF calibration models outperformed the corresponding GBM and ANN models. In the second field ANN has replaced RF in being the best performing. However, the local field calibrations provided lower R2 and RPD in most cases. Therefore, from a cost-effective point of view, it is recommended to adopt the spiked European dataset

  17. Online Games

    OpenAIRE

    Kerr, Aphra; Ivory, James D.

    2015-01-01

    When we agreed to edit the theme on online games for this Encyclopedia our first question was, “What is meant by online games?” Scholars of games distinguish between nondigital games (such as board games) and digital games, rather than between online and offline games. With networked consoles and smartphones it is becoming harder and harder to find players in the wealthy industrialized countries who play “offline” digital games. Most games developers now include ...

  18. Evaluation of an on-line methodology for measuring volatile organic compounds (VOC) fluxes by eddy-covariance with a PTR-TOF-Qi-MS

    Science.gov (United States)

    Loubet, Benjamin; Buysse, Pauline; Lafouge, Florence; Ciuraru, Raluca; Decuq, Céline; Zurfluh, Olivier

    2017-04-01

    Field scale flux measurements of volatile organic compounds (VOC) are essential for improving our knowledge of VOC emissions from ecosystems. Many VOCs are emitted from and deposited to ecosystems. Especially less known, are crops which represent more than 50% of French terrestrial surfaces. In this study, we evaluate a new on-line methodology for measuring VOC fluxes by Eddy Covariance with a PTR-Qi-TOF-MS. Measurements were performed at the ICOS FR-GRI site over a crop using a 30 m long high flow rate sampling line and an ultrasonic anemometer. A Labview program was specially designed for acquisition and on-line covariance calculation: Whole mass spectra ( 240000 channels) were acquired on-line at 10 Hz and stored in a temporary memory. Every 5 minutes, the spectra were mass-calibrated and normalized by the primary ion peak integral at 10 Hz. The mass spectra peaks were then retrieved from the 5-min averaged spectra by withdrawing the baseline, determining the resolution and using a multiple-peak detection algorithm. In order to optimize the peak detection algorithm for the covariance, we determined the covariances as the integrals of the peaks of the vertical-air-velocity-fluctuation weighed-averaged-spectra. In other terms, we calculate , were w is the vertical component of the air velocity, Sp is the spectra, t is time, lag is the decorrelation lag time and denotes an average. The lag time was determined as the decorrelation time between w and the primary ion (at mass 21.022) which integrates the contribution of all reactions of VOC and water with the primary ion. Our algorithm was evaluated by comparing the exchange velocity of water vapor measured by an open path absorption spectroscopy instrument and the water cluster measured with the PTRQi-TOF-MS. The influence of the algorithm parameters and lag determination is discussed. This study was supported by the ADEME-CORTEA COV3ER project (http://www6.inra.fr/cov3er).

  19. Online stable carbon isotope ratio measurement in formic acid, acetic acid, methanol and ethanol in water by high performance liquid chromatography-isotope ratio mass spectrometry

    International Nuclear Information System (INIS)

    Tagami, Keiko; Uchida, Shigeo

    2008-01-01

    A suitable analysis condition was determined for high performance liquid chromatography-isotope ratio mass spectrometry (HPLC-IRMS) while making sequential measurements of stable carbon isotope ratios of δ 13 C in formic acid, acetic acid, methanol and ethanol dissolved in water. For this online column separation method, organic reagents are not applicable due to carbon contamination; thus, water and KH 2 PO 4 at low concentrations were tested as mobile phase in combination with a HyPURITY AQUASTAR TM column. Formic acid, acetic acid, methanol and ethanol were separated when 2 mM KH 2 PO 4 aqueous solution was used. Under the determined analysis condition for HPLC-IRMS, carbon concentrations could be measured quantitatively as well as carbon isotope ratio when carbon concentration was higher than 0.4 mM L for each chemical

  20. Development of a PIN diode based on-line measurement system for Radon (222Rn) and Thoron (220Rn) in environment

    International Nuclear Information System (INIS)

    Ashokkumar, P.; Chaudhury, Probal; Sumesh, C.G.; Sahoo, B.K.; Gaware, J.J.; Mayya, Y.S.

    2014-01-01

    Radon, thoron and their progenies are universally present in outdoor air, and can reach higher levels in indoor air due to poor ventilation. Several instruments have been developed for accurate measurement of radon and thoron in the environment. Semiconductor detector based system employing spectroscopic method has been proved to be the best among them. A PIN diode based electrostatic collection type online real-time instrument has been developed in Bhabha Atomic Research Centre for simultaneous measurement of radon and thoron in an environment while both 222 Rn and 220 Rn are present. This system can be used for determination of radon and thoron concentrations at residence or workplace. Furthermore, since the 222 Rn and 220 Rn are differentiated from each other through spectroscopy, this monitor can be used even in a mixed radon/thoron environment

  1. Are Fast Food “Trans-Fat” Claims True? An Infraspec VFA-IR Spectrometer Analysis of Trans-fat content in select food items purchased from Long John Silver’s

    Directory of Open Access Journals (Sweden)

    Sharron Jenkins

    2014-10-01

    Full Text Available Studies linking high trans-fat diets to coronary heart disease (CHD have prompted the need to regulate, limit, or completely ban trans-fat from all commercial food products, including fast foods. Many U.S. fast food chains now claim that their food items, particularly French fries, have "no trans-fat". In a previous study, our lab tested the validity of trans-fat claims made by several popular fast food restaurants by experimentally determining the %trans-fat in oil extracted from fast food French fries. In some cases, the trans-fat content was nearly twice as high as the amount reported by the restaurant in their literature. Long John Silver's, for example, reported a trans-fat content of 25% for their French fries, while our lab actually found over 40% trans-fat. The purpose of this study is to broaden our study of Long John Silver's trans-fat claims by analyzing a variety of their food items and comparing our findings with the %trans-fat reported by the restaurant literature (nutrition fact tables. Variable Filter Array (VFA IR spectroscopy was used to assess the trans-fat content of oil extracted from food samples. Our preliminary findings suggest that nearly every food item under study contained considerably more trans-fat than the amount reported in the restaurant’s literature.

  2. An online Vce measurement and temperature estimation method for high power IGBT module in normal PWM operation

    DEFF Research Database (Denmark)

    Ghimire, Pramod; de Vega, Angel Ruiz; Beczkowski, Szymon

    2014-01-01

    An on-state collector-emitter voltage (Vce) measurement and thereby an estimation of average temperature in space for high power IGBT module is presented while power converter is in operation. The proposed measurement circuit is able to measure both high and low side IGBT and anti parallel diode...

  3. AISI/DOE Advanced Process Control Program Vol. 4 of 6: ON-LINE, NON-DESTRUCTIVE MECHANICAL PROPERTY MEASUREMENT USING LASER-ULTRASOUND

    Energy Technology Data Exchange (ETDEWEB)

    Andre' Moreau; Martin Lord; Daniel Levesqure; Marc Dubois; Jean Bussiere; Jean-Pierre Monchalin; Christian Padioleau; Guy Lamouche; Teodor Veres; Martin Viens; Harold Hebert; Pierre Basseras; Cheng-Kuei Jen

    2001-03-31

    The goal of this project was to demonstrate the feasibility to measure the mechanical properties, such as yield strength, tensile strength, elongation, strain hardening exponent and plastic strain ratio parameters, of low carbon steel sheets on the production line using laser ultrasound. The ultrasound generated by the developed apparatus travels mostly back and forth in the thickness of the steel sheet. By measuring the time delay between two echoes, and the relative amplitude of these two echoes, one can measure ultrasound velocity and attenuation. These are governed by the microstructure: grain size, crystallographic texture, dislocations, etc. Thus, by recording the time behavior of the ultrasonic signal, one can extract microstructural information. These microstructural information together with the modified Hall-Petch equation allow measurement of the mechanical properties. Through laboratory investigations with a laboratory laser ultrasound system, followed by the installation of a prototype system at LTV Steel Company's No.1 Inspection Line in Cleveland, all target mechanical properties of ultra low carbon (ULC), low carbon (LC) and high strength low alloy (HSLA) steel sample lots were measured meeting or nearly meeting all the target accuracies. Thus, the project realized its goal to demonstrate that the mechanical properties of low carbon steel sheets can be measured on-line using laser ultrasound

  4. A comparison of hepatitis A and hepatitis B measures among vaccinated and susceptible online men who have sex with men.

    Science.gov (United States)

    Gilbert, L K; Levandowski, B A; Scanlon, K E; Peterson, R S

    2010-06-01

    Hepatitis A virus (HAV) and hepatitis B virus (HBV) continue to be major health concerns among men who have sex with men (MSM). The Internet both facilitates high-risk sexual encounters and provides opportunities for promoting healthy behaviours. This study compared self-reported HAV and HBV vaccination levels, based on demographics, health characteristics, hepatitis knowledge, attitudes and risk behaviours among MSM using an online survey posted from February through June 2005. Each participant (n = 968) reported whether they were vaccinated, infected or susceptible for hepatitis A and/or for hepatitis B. Men whose health-care provider recommended vaccination were 12.91 (95% confidence interval [CI] 8.11, 20.55) times more likely to be vaccinated against HAV and 17.93 (95% CI 10.82, 29.70) times more likely to be vaccinated against HBV than those at risk of infection, respectively. These data provide essential information for public health professionals to successfully promote vaccination among members of this population.

  5. Teaching Renewable Energy Using Online PBL in Investigating Its Effect on Behaviour towards Energy Conservation among Malaysian Students: ANOVA Repeated Measures Approach

    Science.gov (United States)

    Nordin, Norfarah; Samsudin, Mohd Ali; Harun, Abdul Hadi

    2017-01-01

    This research aimed to investigate whether online problem based learning (PBL) approach to teach renewable energy topic improves students' behaviour towards energy conservation. A renewable energy online problem based learning (REePBaL) instruction package was developed based on the theory of constructivism and adaptation of the online learning…

  6. Microbial electrochemical monitoring of volatile fatty acids during anaerobic digestion

    DEFF Research Database (Denmark)

    Zhang, Yifeng; Jin, Xiangdan; Angelidaki, Irini

    2015-01-01

    desalination cell, MDC) was built to realize the on-line measuring the concentration of volatile fatty acid (VFA). The correlation between current densities of the biosensor and VFA concentrations was firstly evaluated with synthetic digestate. Two linear relationships were observed between current densities...

  7. Self-tuning wireless power transmission scheme based on on-line scattering parameters measurement and two-side power matching.

    Science.gov (United States)

    Luo, Yanting; Yang, Yongmin; Chen, Zhongsheng

    2014-04-10

    Sub-resonances often happen in wireless power transmission (WPT) systems using coupled magnetic resonances (CMR) due to environmental changes, coil movements or component degradations, which is a serious challenge for high efficiency power transmission. Thus self-tuning is very significant to keep WPT systems following strongly magnetic resonant conditions in practice. Traditional coupled-mode ways is difficult to solve this problem. In this paper a two-port power wave model is presented, where power matching and the overall systemic power transmission efficiency are firstly defined by scattering (S) parameters. Then we propose a novel self-tuning scheme based on on-line S parameters measurements and two-side power matching. Experimental results testify the feasibility of the proposed method. These findings suggest that the proposed method is much potential to develop strongly self-adaptive WPT systems with CMR.

  8. Building online brand perceptual map.

    Science.gov (United States)

    Chiang, I-Ping; Lin, Chih-Ying; Wang, Kaisheng M

    2008-10-01

    Many companies have launched their products or services online as a new business focus, but only a few of them have survived the competition and made profits. The most important key to an online business's success is to create "brand value" for the customers. Although the concept of online brand has been discussed in previous studies, there is no empirical study on the measurement of online branding. As Web 2.0 emerges to be critical to online branding, the purpose of this study was to measure Taiwan's major Web sites with a number of personality traits to build a perceptual map for online brands. A pretest identified 10 most representative online brand perceptions. The results of the correspondence analysis showed five groups in the perceptual map. This study provided a practical view of the associations and similarities among online brands for potential alliance or branding strategies. The findings also suggested that brand perceptions can be used with identified consumer needs and behaviors to better position online services. The brand perception map in the study also contributed to a better understanding of the online brands in Taiwan.

  9. The NRPI multi-purpose on-line monitoring station for measurement of natural radioactivity in the ambient atmosphere and in the soil

    International Nuclear Information System (INIS)

    Jilek, K.; Slezakova, M.; Fronka, A.; Prokop, T.; Neubauer, L.

    2017-01-01

    During years 2010 12 an automated, on-line and wireless outdoor measurement station of atmospheric radon, gamma dose rate and meteorological parameters was realised at the National Radiation Protection Institute (NRPI) in Prague. At the turn of the year 2013 an expansion of the existing station was completed. Under the project funded by the Czech Technological Agency a new updated station was established, additionally equipped with modules for measurement of atmospheric radon/thoron short-lived decay products, radon in water and soil and radon exhalation rate from soil. After the introduction of the station updated key detection parameters and benefits, its use for atmospheric modelling and monitoring is demonstrated. There are summarised results from the 3-year measurement period in the NRPI outdoor area in Prague and from simultaneous annual measurement performed by another similar station located near uranium mud fields in DIAMO, state enterprise, Straz pod Ralskem. Observed seasonal and diurnal variations of atmospheric radon concentrations and variability of the equilibrium factor, F, are illustrated and compared. (authors)

  10. A three axis turntable's online initial state measurement method based on the high-accuracy laser gyro SINS

    Science.gov (United States)

    Gao, Chunfeng; Wei, Guo; Wang, Qi; Xiong, Zhenyu; Wang, Qun; Long, Xingwu

    2016-10-01

    As an indispensable equipment in inertial technology tests, the three-axis turntable is widely used in the calibration of various types inertial navigation systems (INS). In order to ensure the calibration accuracy of INS, we need to accurately measure the initial state of the turntable. However, the traditional measuring method needs a lot of exterior equipment (such as level instrument, north seeker, autocollimator, etc.), and the test processing is complex, low efficiency. Therefore, it is relatively difficult for the inertial measurement equipment manufacturers to realize the self-inspection of the turntable. Owing to the high precision attitude information provided by the laser gyro strapdown inertial navigation system (SINS) after fine alignment, we can use it as the attitude reference of initial state measurement of three-axis turntable. For the principle that the fixed rotation vector increment is not affected by measuring point, we use the laser gyro INS and the encoder of the turntable to provide the attitudes of turntable mounting plat. Through this way, the high accuracy measurement of perpendicularity error and initial attitude of the three-axis turntable has been achieved.

  11. Online dictionaries

    DEFF Research Database (Denmark)

    Tarp, Sven

    2012-01-01

    This article initially provides a panoramic overview and a preliminary typologization of present and future online dictionaries based upon their application of the available technologies and suggests that the future of lexicography will be the development of highly sophisticated tools which may......, need, consultation, and data. The article then proceeds to the discussion of some advanced information science techniques that may contribute to the desired individualization. Upon this basis, it finally discusses the interaction between online dictionaries and external sources like the Internet...

  12. Online marketing

    OpenAIRE

    Zrůst, Daniel

    2013-01-01

    The aim of this thesis is to evaluate pay per click marketing as suitable marketing tool for promotion and distribution of a given product. The paper describes basic vocabulary related to PPC advertising, common metrics, tools used by online marketers, and logic of running PPC campaigns. The paper also tries to quantify impact of Internet on economies. The second part applies the theory to analysis of consumers' conversion path while searching online in common search engines where PPC marketi...

  13. Online Learning Self-Efficacy in Students with and without Online Learning Experience

    Science.gov (United States)

    Zimmerman, Whitney Alicia; Kulikowich, Jonna M.

    2016-01-01

    A need was identified for an instrument to measure online learning self-efficacy, which encompassed the wide variety of tasks required of successful online students. The Online Learning Self-Efficacy Scale (OLSES) was designed to include tasks required of students enrolled in paced online courses at one university. In the present study, the…

  14. Online Shop System with Zencart

    OpenAIRE

    Uqbah Iqbal

    2016-01-01

    Written by Sabri Saifulsham and Syazwan Saifulsham, this book has eleven chapters that using quantitative research methodology to describes the three main components of success in building and managing online shops, namely the potential of products, obtain product and build and manage online stores. All three of these components are combined into a single system that can help anyone to build an online store even if no basic technical skills. The measures described also make it easy to use Zen...

  15. On-line in-situ measurements in the boundary layer: Manned hydrogen balloons as quasi Lagrange platforms

    Energy Technology Data Exchange (ETDEWEB)

    Rappengluck, B.; Fabian, P. [Ludwig-Maximilian Univ., Dept. of Bioclimatology and Emission Research, Munich (Germany); Euskirchen, J. [Inst. for Scientific Balloonflight e.V., Waidhofen (Germany)

    1999-11-01

    In-situ measurements of atmospheric trace constituents such as nitrogen dioxide, ozone, peroxy acetyl nitrate (PAN), and non-methane hydrocarbon compounds (NMHC) are essential parameters for understanding photochemical processes. This paper discusses some of the lessons learned and some of the results of a field measurement project dubbed BERLIOZ (for Berlin Ozone), carried out in July/August 1998 in the Greater Berlin Area to investigate several key questions concerning the evolution of photochemical smog within an urban plume, and the role of advection and turbulence for oxidants. A comprehensive network of ground-based measurement sites, vertical sounding techniques such as tethered balloons and laser-based radar, mobile stations for profile measurements, five aircraft and one manned free-balloon were used in the project. BERLIOZ was the first major atmospheric research project to use a hydrogen balloon platform for quasi-Lagrangian measurements. It confirmed the balloon`s suitability as a tool for better understanding of large area information gathered by remote sensing missions. 5 refs., 6 figs.

  16. Evaluation of clinical trials by Ethics Committees in Germany: Experience of applicants with the review of requests for opinion of the Ethics Committees - results of a survey among members of the German Association of Research-Based Pharmaceutical Companies (VFA

    Directory of Open Access Journals (Sweden)

    Russ, Hagen

    2009-07-01

    Full Text Available The review of requests for a positive opinion of the ethics committees (application procedure as a requirement to start a clinical trial in Germany has been completely redesigned with the transposition of EU Directive 2001/20/EC in the 12th Amendment of the German Medicines Act in August 2004. The experience of applicants (sponsors, legal representatives of sponsors in the EU and persons or organizations authorized by the sponsors to make the application, respectively in terms of interactions with the ethics committees in Germany has been positive overall, especially with respect to ethics committee adherence to the statutory timelines applicable for review of requests. However, inconsistencies between ethics committees exist in terms of the form and content of the requirements for application documents and their evaluation.With the objective of further improving both the quality of applications and the evaluation of those applications by ethics committees, a survey among members of the German Association of Research-Based Pharmaceutical Companies (VFA was conducted from January to April 2008. Based on reasoned opinions issued by the respective ethics committee in charge of the coordinating principal investigator (coordinating ethics committee, the type and frequency of formal and content-related objections to applications according to § 7 of the German Good Clinical Practice (GCP Regulation were systematically documented, and qualitative and quantitative analyses performed. 21 out of 44 members of the VFA participated in the survey. 288 applications for Phase I–IV studies submitted between January and December 2007 to 40 ethics committees were evaluated.This survey shows that about one in six applications is incomplete and has formal and/or content objections, respectively, especially those that pertain to documents demonstrating the qualification of the investigator and/or suitability of the facilities. These objections are attributable to

  17. Introducing process analytical technology (PAT) in filamentous cultivation process development: comparison of advanced online sensors for biomass measurement

    DEFF Research Database (Denmark)

    Rønnest, Nanna Petersen; Stocks, Stuart M.; Eliasson Lantz, Anna

    2011-01-01

    cultivation data, such as the carbon dioxide evolution rate (CER) and the concentration of dissolved oxygen. Prediction models for the biomass concentrations were estimated on the basis of the individual sensors and on combinations of the sensors. The results showed that the more advanced sensors based on MWF...... and scanning DE spectroscopy did not offer any advantages over the simpler sensors based on dual frequency DE spectroscopy, turbidity, and CER measurements for prediction of biomass concentration. By combining CER, DE spectroscopy, and turbidity measurements, the prediction error was reduced to 1.5 g...

  18. Application of an online ion chromatography-based instrument for gradient flux measurements of speciated nitrogen and sulfur

    Science.gov (United States)

    In North America, the dry component of total nitrogen and sulfur deposition remains uncertain due to a lack of measurements of sufficient chemical speciation and temporal extent to develop complete annual mass budgets or of sufficient process level detail to improve current air-s...

  19. DL-sQUAL: A Multiple-Item Scale for Measuring Service Quality of Online Distance Learning Programs

    Science.gov (United States)

    Shaik, Naj; Lowe, Sue; Pinegar, Kem

    2006-01-01

    Education is a service with multiplicity of student interactions over time and across multiple touch points. Quality teaching needs to be supplemented by consistent quality supporting services for programs to succeed under the competitive distance learning landscape. ServQual and e-SQ scales have been proposed for measuring quality of traditional…

  20. Testing of an automated online EA-IRMS method for fast and simultaneous carbon content and stable isotope measurement of aerosol samples

    Science.gov (United States)

    Major, István; Gyökös, Brigitta; Túri, Marianna; Futó, István; Filep, Ágnes; Hoffer, András; Molnár, Mihály

    2016-04-01

    Comprehensive atmospheric studies have demonstrated that carbonaceous aerosol is one of the main components of atmospheric particulate matter over Europe. Various methods, considering optical or thermal properties, have been developed for quantification of the accurate amount of both organic and elemental carbon constituents of atmospheric aerosol. The aim of our work was to develop an alternative fast and easy method for determination of the total carbon content of individual aerosol samples collected on prebaked quartz filters whereby the mass and surface concentration becomes simply computable. We applied the conventional "elemental analyzer (EA) coupled online with an isotope ratio mass spectrometer (IRMS)" technique which is ubiquitously used in mass spectrometry. Using this technique we are able to measure simultaneously the carbon stable isotope ratio of the samples, as well. During the developing process, we compared the EA-IRMS technique with an off-line catalytic combustion method worked out previously at Hertelendi Laboratory of Environmental Studies (HEKAL). We tested the combined online total carbon content and stable isotope ratio measurement both on standard materials and real aerosol samples. Regarding the test results the novel method assures, on the one hand, at least 95% of carbon recovery yield in a broad total carbon mass range (between 100 and 3000 ug) and, on the other hand, a good reproducibility of stable isotope measurements with an uncertainty of ± 0.2 per mill. Comparing the total carbon results obtained by the EA-IRMS and the off-line catalytic combustion method we found a very good correlation (R2=0.94) that proves the applicability of both preparation method. Advantages of the novel method are the fast and simplified sample preparation steps and the fully automated, simultaneous carbon stable isotope ratio measurement processes. Furthermore stable isotope ratio results can effectively be applied in the source apportionment

  1. Improved online δ18O measurements of nitrogen- and sulfur-bearing organic materials and a proposed analytical protocol

    Science.gov (United States)

    Qi, H.; Coplen, T.B.; Wassenaar, L.I.

    2011-01-01

    It is well known that N2 in the ion source of a mass spectrometer interferes with the CO background during the δ18O measurement of carbon monoxide. A similar problem arises with the high-temperature conversion (HTC) analysis of nitrogenous O-bearing samples (e.g. nitrates and keratins) to CO for δ18O measurement, where the sample introduces a significant N2 peak before the CO peak, making determination of accurate oxygen isotope ratios difficult. Although using a gas chromatography (GC) column longer than that commonly provided by manufacturers (0.6 m) can improve the efficiency of separation of CO and N2 and using a valve to divert nitrogen and prevent it from entering the ion source of a mass spectrometer improved measurement results, biased δ18O values could still be obtained. A careful evaluation of the performance of the GC separation column was carried out. With optimal GC columns, the δ18O reproducibility of human hair keratins and other keratin materials was better than ±0.15 ‰ (n = 5; for the internal analytical reproducibility), and better than ±0.10 ‰ (n = 4; for the external analytical reproducibility).

  2. Active Learning through Online Instruction

    Science.gov (United States)

    Gulbahar, Yasemin; Kalelioglu, Filiz

    2010-01-01

    This article explores the use of proper instructional techniques in online discussions that lead to meaningful learning. The research study looks at the effective use of two instructional techniques within online environments, based on qualitative measures. "Brainstorming" and "Six Thinking Hats" were selected and implemented…

  3. Fiber optic based OSL set up for online and offline measurements of dose due to ionizing radiation

    International Nuclear Information System (INIS)

    Rawat, N.S.; Kulkarni, M.S.; Upadhyay, B.N.; Srikanth, G.; Bindra, K.S.; Oak, S.M.

    2016-01-01

    An optic-fiber dosimetry system based on optically stimulated luminescence (OSL) and radio-luminescence (RL) from Al_2O_3 : C single-crystal (detector) was designed and developed. The set up is intended to measure dose and dose rates at various radiological installations. The Al_2O_3:C single crystal (from Landaeur Inc. USA) was coupled to a fiber optic delivery system and OSL from the detector is stimulated via the optical fiber cable using light from a Nd:YAG laser. OSL and RL signals are later used to predict cumulative dose and dose rates using "6"0Co gamma source. (author)

  4. On-line measurements of oscillating mitochondrial membrane potential in glucose-fermenting Saccharomyces cerevisiae

    DEFF Research Database (Denmark)

    Andersen, Ann Zahle; Poulsen, Allan K.; Brasen, Jens Christian

    2007-01-01

    We employed the fluorescent cyanine dye DiOC(2)(3) to measure membrane potential in semi-anaerobic yeast cells under conditions where glycolysis was oscillating. Oscillations in glycolysis were studied by means of the naturally abundant nicotinamide adenine dinucleotide (NADH). We found...... studies showed that glycolytic oscillations perturb the mitochondrial membrane potential and that the mitochondria do not have any controlling effect on the dynamics of glycolysis under these conditions. Depolarization of the mitochondrial membrane by addition of FCCP quenched mitochondrial membrane...... potential oscillations and delocalized DiOC(2)(3), while glycolysis continued to oscillate unaffected....

  5. Operation related on-line measurements of low temperature fire side corrosion during co-combustion of biomass and oil; Driftrelaterad direktmaetning av laagtemperaturkorrosion i en braensleeldad kraftvaermeanlaeggning

    Energy Technology Data Exchange (ETDEWEB)

    Eriksson, Thomas [Studsvik Nuclear AB, Nykoeping (Sweden)

    2000-05-01

    A number of combustion plants have experienced corrosion attack on air preheaters and economisers when fired with biomass fuels. In certain plants the problems are great and reconstruction has been performed so that exposed components can be exchanged during operation. The electrochemical techniques offer on-line measurements of the changes in corrosion rate in the low temperature region in a waste incinerator. The purpose with this study was to evaluate the technique in a biomass fired boiler where the corrosion rate is considerable lower compared to a waste incinerator. Experiments were performed at the Haesselby plant, boiler 3, which was fired with pure biomass as well as a mixture of biomass and oil during the test period. It was found that the electrochemical technique is a useful tool for on-line measurements of the changes in corrosion rate in biomass fired utilities. Since the corrosion rate in the low temperature region is dependent on the boiler construction, electrochemical measurements give valuable information on the corrosion rate during optimisation of the fuel mixture, SNCR and temperature or the low temperature components. This is of special importance when introducing new fuels or fuel mixtures. Soot blowing is of prime importance for the total corrosion. During a few minutes an individual soot blower can initiate such a high corrosion rate that it represents the total corrosion. The material temperature is another important parameter. Above a certain temperature the corrosion rate is negligible. During co-combustion this temperature was found to be in the region 65-85 deg C. The influence of the SNCR with ammonia, with respect to corrosion, is dependent on the fuel mixture used. In utilities where acidic combustion products are formed, ammonia has a neutralising effect e.g. in Hoegdalen. At the Haesselby plant this neutralising effect was not found. During cocombustion with oil the ammonia forms ammoniahydrosulphate which increases the corrosion

  6. Online Measurement of the Energy Spread of Multi-Turn Beam in the Fermilab Booster at Injection

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, J. [Brown U.; Bhat, C. M. [Fermilab; Hendricks, B. S. [Fermilab

    2017-07-01

    We have developed a computer program interfaced with the ACNET environment of Fermilab accelerators to measure energy spread of the proton beam from the LINAC at an injection into the Booster. It uses a digitizing oscilloscope and provides users an ability to configure the scope settings for optimal data acquisition from a resistive wall current monitor. When the program is launched, a) a one shot timeline is generated to initiate beam injection into the Booster, b) a gap of about 40 ns is produced in the injected beam using a set of fast kickers, c) collects line charge distribution data from the wall current monitor for the first 200 μs from the injection and d) performs complete data analysis to extract full beam energy spread of the beam. The program also gives the option to store the data for offline analyses. We illustrate a case with an example. We also present results on beam energy spread as a function of beam intensity from recent measurements.

  7. PBL online

    DEFF Research Database (Denmark)

    Kolbæk, Ditte; Nortvig, Anne-Mette

    2017-01-01

    Problem- and Project-Based Learning (PBL) is a widely used pedagogical method in higher education. Although PBL encourages self-directed learning and works with the students’ own projects and problems, it also includes teacher presentations, discussions and group reflections, both on......-campus and online. Therefore, the teacher’s plans might be relevant to the students’ projects, but that is not always the case. This study investigates how master’s students interact with an online Problem-Based Learning design and examines how technology influences these interactions. The empirical data stem from...... lessons at an online master’s course, and they were collected and analyzed using a netnographic approach. The study finds that concepts like self-directed learning and active involvement of everyone can have very different meanings from the teachers’ and the students’ points of view. If the students do...

  8. Use of NAD(P)H fluorescence measurement for on-line monitoring of metabolic state of Azohydromonas australica in poly(3-hydroxybutyrate) production.

    Science.gov (United States)

    Gahlawat, Geeta; Srivastava, Ashok K

    2013-02-01

    Culture fluorescence measurement is an indirect and non-invasive method of biomass estimation to assess the metabolic state of the microorganism in a fermentation process. In the present investigation, NAD(P)H fluorescence has been used for on-line in situ characterization of metabolic changes occurring during different phases of batch cultivation of Azohydromonas australica in growth associated poly(3-hydroxybutyrate) or PHB production. A linear correlation between biomass concentration and net NAD(P)H fluorescence was obtained during early log phase (3-12 h) and late log phase (24-39 h) of PHB fermentation. After 12 h (mid log phase) cultivation PHB accumulation shot up and a drop in culture fluorescence was observed which synchronously exhibited continuous utilization of NAD(P)H for the synthesis of biomass and PHB formation simultaneously. A decrease in the observed net fluorescence value was observed again towards the end of fermentation (at 39 h) which corresponded very well with the culture starvation and substrate depletion towards the end of cultivation inside the bioreactor. It was therefore concluded that NAD(P)H fluorescence measurements could be used for indication of the time of fresh nutrient (substrate) feed during substrate limitation to further enhance the PHB production.

  9. The influence of specific mechanical energy on cornmeal viscosity measured by an on-line system during twin-screw extrusion

    Directory of Open Access Journals (Sweden)

    Y. K. CHANG

    1999-09-01

    Full Text Available The influence of specific mechanical energy (SME on cornmeal viscosity during the twin-screw extrusion at feed moisture contents of 25 and 30% and screw speeds in the range from 100 to 500 rpm was measured. Cornmeal was extruded in a co-rotating, intermeshing twin-screw coupled to a slit die rheometer. One approach to the on-line rheological measurement is to use a slit die with the extruder. In the present work it was show that shear viscosity decreased as a function of SME. The viscosity of cornmeal at the exit die was influenced by screw speed, rate of total mass flow, mass temperature inside the extruder and SME. An increase in screw speed resulted in an increase in SME and a decrease in viscosity. A reduction in slit die height and an increase in screw speed and mass temperature led to a remarkable macromolecular degradation of the starch, as evidenced by the decrease in viscosity.

  10. First on-line mass measurements at SHIPTRAP and mass determinations of neutron-rich Fr and Ra isotopes at ISOLTRAP

    CERN Document Server

    Rahaman, Saidu

    SHIPTRAP is an ion trap facility behind the velocity filter SHIP at GSI/Darmstadt. Its aim are precision studies of transuranium nuclides produced in a fusion reaction and separated by SHIP. The current set-up for high-precision mass measurements consists of three main functional parts: (i) a gas cell for stopping the energetic ions from SHIP, (ii) radiofrequency quadrupole structures to cool and to bunch the ions extracted from the gas cell, and (iii) a superconducting magnet with two cylindrical Penning traps at a field strength of 7 T. In this work the Penning trap system has been installed and extensively characterized. The first on-line mass measurements of short-lived nuclides were carried out and the masses of $^{147}$Er and $^{148}$Er could be experimentally determined for the first time. Here a relative mass uncertainty of $\\delta$ m/m of about 1$\\times$ 10$^{-6}$ was achieved. Furthermore the masses of heavy neutron-rich $^{229-232}$Ra and $^{230}$Fr isotopes have been determined with a relative m...

  11. Online safety

    CERN Document Server

    Healey, Justin

    2015-01-01

    Australians are increasingly connecting online through computers, mobile phones and other electronic devices to access the internet and social media. In the process, young people in particular are becoming more at risk of being exposed to fraud, identity theft, unauthorised access to personal information, stalking, harassment and exposure to illicit or offensive materials. This book presents a range of cybersafety tips to arm readers with an informed awareness of the risks online and offer advice on how to stay protected. A chapter in the book is specifically dedicated to understanding and dea

  12. Online Communities

    DEFF Research Database (Denmark)

    Sørensen, Henrik; Lassen, Astrid Heidemann; Gorm Hansen, Katrine

    Online Communities” er et medie for brugere og fagfolk, hvor de kan mødes digitalt for at dele erfaringer, og dette kan anvendes som inspiration indenfor Brugerdreven Innovation. Via ”desk research” kan virksomheder opnå adgang til varierende mængder af brugere på en forholdsvist enkelt måde. I...... denne rapport beskrives eksperimentets opbygning, resultater og mulige værdi. Vi håber hermed på at kunne give praktisk indsigt i, hvorledes virksomheder fra byggematerialeindustrien kan agere i online communities....

  13. On-line, real-time measurements of decontamination factors for a low-level waste incinerator

    International Nuclear Information System (INIS)

    Close, D.A.; Draper, W.E.

    1982-01-01

    A method is described to monitor the distribution of radioactive isotopes through the off-gas treatment system of an incinerator. Simulated commercial waste spiked with known amounts of five fission products, 131 I, 106 Ru, 137 Cs, 59 Fe, 60 Co, were incinerated. High resolution photon detectors were installed on the off-gas handling system of the controlled air incinerator at the Los Alamos National Laboratory to determine relative decontamination factors, which ranged from a low of 40 for 137 Cs to a high of 50O0 for 131 I. Background measurements were made to determine the residual activity in the incinerator. Due to the constant purging of the system to maintain a negative pressure with respect to the surrounding environment, the residual activity decays more rapidly than dictated by its half-life. (orig.)

  14. Self-Powered Neutron Detector Qualification for Absolute On-Line In-Pile Neutron Flux Measurements in BR2

    Science.gov (United States)

    Vermeeren, L.; Wéber, M.

    2003-06-01

    A set of ten Self-Powered Neutron Detectors with Co, Rh and Ag emitters has been irradiated in several channels of the BR2 research reactor at SCK•CEN aiming at a comparison of their performance as thermal neutron flux detectors under various conditions. To allow for a correct interpretation of their signals, all detector sensitivity contributions (prompt and delayed) were calculated using a dedicated Monte Carlo model. The various contributions were also measured separately; the agreement between calculated and experimental data, including data from activation dosimetry, was excellent. Detailed neutron flux profiles were obtained from the SPND data, after correction for the finite detector lengths and for the slow response of delayed SPNDs.

  15. A continuous on-line method for fission yield measurements with the combined GJTR-SISAK technique

    International Nuclear Information System (INIS)

    Bjoernstad, T.

    1981-01-01

    The principles of a method for fission yield measurements with the combined GJRT-SISAK techniques are outlined. Only the simple case where parent effects can be neglected is considered in detail. The article includes derivation of a relation between the production rate and the counting rate of a nuclide. The expression contains various efficiency parameters and the system dependent delay probability function p(t). The way to experimentally determine these parameters and the delay probability curve, as well as the fitting of an analytical function to the curve are shown. The method is general in the sense that the main principles are independent upon the nuclide under study, fissile target material and bombarding particle used. (orig.)

  16. Development and first application of an Aerosol Collection Module (ACM) for quasi online compound specific aerosol measurements

    Science.gov (United States)

    Hohaus, Thorsten; Kiendler-Scharr, Astrid; Trimborn, Dagmar; Jayne, John; Wahner, Andreas; Worsnop, Doug

    2010-05-01

    Atmospheric aerosols influence climate and human health on regional and global scales (IPCC, 2007). In many environments organics are a major fraction of the aerosol influencing its properties. Due to the huge variety of organic compounds present in atmospheric aerosol current measurement techniques are far from providing a full speciation of organic aerosol (Hallquist et al., 2009). The development of new techniques for compound specific measurements with high time resolution is a timely issue in organic aerosol research. Here we present first laboratory characterisations of an aerosol collection module (ACM) which was developed to allow for the sampling and transfer of atmospheric PM1 aerosol. The system consists of an aerodynamic lens system focussing particles on a beam. This beam is directed to a 3.4 mm in diameter surface which is cooled to -30 °C with liquid nitrogen. After collection the aerosol sample can be evaporated from the surface by heating it to up to 270 °C. The sample is transferred through a 60cm long line with a carrier gas. In order to test the ACM for linearity and sensitivity we combined it with a GC-MS system. The tests were performed with octadecane aerosol. The octadecane mass as measured with the ACM-GC-MS was compared versus the mass as calculated from SMPS derived total volume. The data correlate well (R2 0.99, slope of linear fit 1.1) indicating 100 % collection efficiency. From 150 °C to 270 °C no effect of desorption temperature on transfer efficiency could be observed. The ACM-GC-MS system was proven to be linear over the mass range 2-100 ng and has a detection limit of ~ 2 ng. First experiments applying the ACM-GC-MS system were conducted at the Jülich Aerosol Chamber. Secondary organic aerosol (SOA) was formed from ozonolysis of 600 ppbv of b-pinene. The major oxidation product nopinone was detected in the aerosol and could be shown to decrease from 2 % of the total aerosol to 0.5 % of the aerosol over the 48 hours of

  17. On-Line Self-Calibrating Single Crystal Sapphire Optical Sensor Instrumentation for Accurate and Reliable Coal Gasifier Temperature Measurement

    Energy Technology Data Exchange (ETDEWEB)

    Kristie Cooper; Gary Pickrell; Anbo Wang

    2005-11-01

    This report summarizes technical progress April-September 2005 on the Phase II program ''On-Line Self-Calibrating Single Crystal Sapphire Optical Sensor Instrumentation for Accurate and Reliable Coal Gasifier Temperature Measurement'', funded by the Federal Energy Technology Center of the U.S. Department of Energy, and performed by the Center for Photonics Technology of the Bradley Department of Electrical and Computer Engineering at Virginia Tech. The outcome of the first phase of this program was the selection of broadband polarimetric differential interferometry (BPDI) for further prototype instrumentation development. This approach is based on the measurement of the optical path difference (OPD) between two orthogonally polarized light beams in a single-crystal sapphire disk. The objective of this program is to bring the sensor technology, which has already been demonstrated in the laboratory, to a level where the sensor can be deployed in the harsh industrial environments and will become commercially viable. Due to the difficulties described on the last report, field testing of the BPDI system has not continued to date. However, we have developed an alternative high temperature sensing solution, which is described in this report. The sensing system will be installed and tested at TECO's Polk Power Station. Following a site visit in June 2005, our efforts have been focused on preparing for that field test, including he design of the sensor mechanical packaging, sensor electronics, the data transfer module, and the necessary software codes to accommodate this application.. We are currently ready to start sensor fabrication.

  18. The Relationship between Searches Performed in Online Databases and the Number of Full-Text Articles Accessed: Measuring the Interaction between Database and E-Journal Collections

    Science.gov (United States)

    Lamothe, Alain R.

    2011-01-01

    The purpose of this paper is to report the results of a quantitative analysis exploring the interaction and relationship between the online database and electronic journal collections at the J. N. Desmarais Library of Laurentian University. A very strong relationship exists between the number of searches and the size of the online database…

  19. Online Mentoring as an Extracurricular Measure to Encourage Talented Girls in STEM (Science, Technology, Engineering, and Mathematics): An Empirical Study of One-on-One versus Group Mentoring

    Science.gov (United States)

    Stoeger, Heidrun; Hopp, Manuel; Ziegler, Albert

    2017-01-01

    Online mentoring provides an effective means of extracurricular gifted education for talented girls in science, technology, engineering, and mathematics (STEM). Comparative studies on the effectiveness of one-on-one versus group mentoring are lacking, however. The authors investigated this question in the context of a Germany-wide online mentoring…

  20. Online Reputation in Automotive

    Directory of Open Access Journals (Sweden)

    Vodák Josef

    2017-01-01

    Full Text Available This paper deals with the issue of online reputation, namely the social networking profile of businesses. Selected companies in the automotive industry through social profiles communicate with their customers, the public and they trying to improve their name and the name of their products in the public eye. Online reputation analysis was carried out to determine the current situation on the territory of Slovakia. On the basis of the data found, measures were proposed to improve the current state and reputation of automotive companies. Recommendations suggested by the findings can be used on any market to improve the current state and increase the competitiveness of automotive companies.

  1. Online Measurement of Exhaled NO Concentration and Its Production Sites by Fast Non-equilibrium Dilution Ion Mobility Spectrometry

    Science.gov (United States)

    Peng, Liying; Jiang, Dandan; Wang, Zhenxin; Liu, Jiwei; Li, Haiyang

    2016-03-01

    Exhaled nitric oxide (NO) is one of the most promising breath markers for respiratory diseases. Its profile for exhalation and the respiratory NO production sites can provide useful information for medical disease diagnosis and therapeutic procedures. However, the high-level moisture in exhaled gas always leads to the poor selectivity and sensitivity for ion spectrometric techniques. Herein, a method based on fast non-equilibrium dilution ion mobility spectrometry (NED-IMS) was firstly proposed to directly monitor the exhaled NO profile on line. The moisture interference was eliminated by turbulently diluting the original moisture to 21% of the original with the drift gas and dilution gas. Weak enhancement was observed for humid NO response and its limit of detection at 100% relative humidity was down to 0.58 ppb. The NO concentrations at multiple exhalation flow rates were measured, while its respiratory production sites were determined by using two-compartment model (2CM) and Högman and Meriläinen algorithm (HMA). Last but not the least, the NO production sites were analyzed hourly to tentatively investigate the daily physiological process of NO. The results demonstrated the capacity of NED-IMS in the real-time analysis of exhaled NO and its production sites for clinical diagnosis and assessment.

  2. Sampling and sample preparation development for analytical and on-line measurement techniques of process liquids; Naeytteenoton ja kaesittelyn kehittaeminen prosessinesteiden analytiikan ja on-line mittaustekniikan tarpeisiin - MPKT 11

    Energy Technology Data Exchange (ETDEWEB)

    Karttunen, K [Oulu Univ. (Finland)

    1999-12-31

    Main goal of the research project is to develop sampling and sample handling methods and techniques for pulp and paper industry to be used for analysis and on-line purposes. The research focus specially on the research and development of the classification and separation methods and techniques needed for liquid and colloidal substances as well as in ion analysis. (orig.)

  3. Sampling and sample preparation development for analytical and on-line measurement techniques of process liquids; Naeytteenoton ja kaesittelyn kehittaeminen prosessinesteiden analytiikan ja on-line mittaustekniikan tarpeisiin - MPKT 11

    Energy Technology Data Exchange (ETDEWEB)

    Karttunen, K. [Oulu Univ. (Finland)

    1998-12-31

    Main goal of the research project is to develop sampling and sample handling methods and techniques for pulp and paper industry to be used for analysis and on-line purposes. The research focus specially on the research and development of the classification and separation methods and techniques needed for liquid and colloidal substances as well as in ion analysis. (orig.)

  4. Tar formation in a steam-O2 blown CFB gasifier and a steam blown PBFB gasifier (BabyHPR) : Comparison between different on-line measurement techniques and the off-line SPA sampling and analysis method

    NARCIS (Netherlands)

    Meng, X.; Mitsakis, P.; Mayerhofen, M.; De Jong, W.; Gaderer, M.; Verkooijen, A.H.M.; Spliethoff, H.

    2012-01-01

    Two on-line tar measurement campaigns were carried out using an atmospheric pressure 100 “”kWth steam-O2 blown circulating fluidized bed (CFB) gasifier at the Delft University of Technology (TUD) and a 30–40kWth steam blown pressurized bubbling fluidized bed (PBFB) gasifier BabyHPR (Heatpipe

  5. Online 1990.

    Science.gov (United States)

    Goldstein, Morris

    This paper examines the co-existence of online and CD-ROM technologies in terms of their existing pricing structures, marketing strategies, functionality, and future roles. "Fixed Price Unlimited Usage" (FPUU) pricing and flat-rate pricing are discussed as viable alternatives to current pricing practices. In addition, it is argued that the…

  6. Food online

    NARCIS (Netherlands)

    Veer, van der Lomme C.

    2017-01-01

    In this thesis the research focuses on the legal rules and regulations in the Netherlands that apply in the context of food purchases by consumers that are concluded online. Sale of food via the Internet takes place in the area of Civil Code requirements on distance selling and public law

  7. Out Online

    DEFF Research Database (Denmark)

    Raun, Tobias

    Trans people are increasingly stepping out of the shadow of pathologization and secretiveness to tell their life stories, share information and to connect with like-minded others, using YouTube as a platform. "Out Online: Trans Self-Representation and Community Building on YouTube" explores...

  8. The MICE Online Systems

    CERN Multimedia

    CERN. Geneva

    2012-01-01

    The Muon Ionization Cooling Experiment (MICE) is designed to test transverse cooling of a muon beam, demonstrating an important step along the path toward creating future high intensity muon beam facilities. Protons in the ISIS synchrotron impact a titanium target, producing pions which decay into muons that propagate through the beam line to the MICE cooling channel. Along the beam line, particle identification (PID) detectors, scintillating fiber tracking detectors, and beam diagnostic tools identify and measure individual muons moving through the cooling channel. The MICE Online Systems encompass all tools; including hardware, software, and documentation, within the MLCR (MICE Local Control Room) that allow the experiment to efficiently record high quality data. Controls and Monitoring (C&M), Data Acquisition (DAQ), Online Monitoring and Reconstruction, Data Transfer, and Networking all fall under the Online Systems umbrella. C&M controls all MICE systems including the target, conventional an...

  9. On-line slurry viscosity and concentration measurement as a real-time waste stream characterization tool. 1998 annual progress report

    International Nuclear Information System (INIS)

    Powell, R.L.

    1998-01-01

    'This project seeks to develop an on-line sensor to measure the viscosity of dense slurries. This report summarizes work after two years of a three year project. The flow behavior of slurries is important for many of the proposed unit operations to be used in the conveying and processing of tank wastes. One alternative for determining the rheological properties of such materials is to obtain samples and test them off-line using conventional rheometers. Such a protocol is not practical for a wide variety of wastes. Rather, it is the goal of this work to find on-line, in-process techniques for measurement. There are two systems that the authors have propose examining: (1) Nuclear magnetic resonance imaging (NMRI), and, (2) Ultrasonic Doppler Velocimetry. Central to both of these techniques is the measurement of velocity profiles in pipe flows. For the NMRI measurements, the presence of particles has two principal effects on the NMRI velocity profiles: a decrease in signal intensity and image blurring. Similar effects are observed in turbulent flows due to the local random fluctuations in the flow. This similarity has led us to turbulent flow using NMRI. The governing equations for the signal obtained by NMRI are the Bloch-Torrey equations. Previously, the author showed a relationship between turbulent fluctuations and spatial signal intensity variations, assuming isotropic turbulence. However, this assumption does not reflect the true nature of turbulence in a pipe flow where the turbulence is not isotropic. In the new work the Bloch-Torrey equations will be solved by first, time averaging and then employing a turbulence model for pipe flow. The purpose of the time averaging is to smooth the fluctuations of time scale smaller than that of NMRI data acquisition. After this work with single phase fluids, the authors shall undertake NMRI experiments of slurry flow. Various operational parameters will be optimized during the experiments to obtain velocity profile of the

  10. Self-Reported Measures Of Strength And Sport-Specific Skills Distinguish Ranking In An International Online Fitness Competition.

    Science.gov (United States)

    Serafini, Paul R; Feito, Yuri; Mangine, Gerald T

    2017-02-08

    To determine if self-reported performance measures could distinguish ranking during the 2016 CrossFit Open, data from three thousand male (n=1500; 27.2±8.4 y; 85.2±7.9 kg; 177.0±6.5 cm) and female (n=1500, 28.7±4.9 y; 63.7±5.8 kg; 163.7±6.6 cm) competitors was used for this study. Competitors were split by gender and grouped into quintiles (Q1-Q5) based upon their final ranking. Quintiles were compared for one-repetition maximum (1RM) squat, deadlift, clean and jerk (CJ), snatch, 400-m sprint, 5,000-m run, and benchmark workouts (Fran, Helen, Grace, Filthy-50, and Fight-gone-bad). Separate one-way analyses of variance revealed all competitors in Q1 reported greater (p<0.05) 1RM loads for squat (Males: 201.6±19.1 kg; Females: 126.1±13.0 kg), deadlift (Males: 232.4±20.5 kg; Females: 148.3±14.5 kg), CJ (Males: 148.9±12.1 kg; Females: 95.7±8.4 kg), and snatch (Males: 119.4±10.9 kg; Females 76.5±7.6 kg) compared to other quintiles. In addition, Males in Q1 (59.3±5.9 sec) reported faster (p<0.05) 400-m times than Q3 only (62.6±7.3 sec), but were not different from any group in the 5,000-m run. Females in Q2 (67.5 ± 8.8 sec) reported faster (p<0.05) 400-m times than Q3-Q5 (73.5-74.8 sec) and faster (21.3 ± 1.8 min, p<0.02) 5,000-m times than Q4 (22.6±2.2 min) and Q5 (22.6±1.9 min). Faster (p<0.05) Fran times were reported by Q1 (males: 138.2±13.3 sec; females: 159.4±28.3 sec) compared to other groups, while the results of other workouts were variable. These data indicate that the most successful athletes excel in all areas of fitness/skill, while lower-ranking athletes should focus on developing strength and power after achieving sufficient proficiency in sport-specific skills.

  11. Trust and Online Reputation Systems

    Science.gov (United States)

    Kwan, Ming; Ramachandran, Deepak

    Web 2.0 technologies provide organizations with unprecedented opportunities to expand and solidify relationships with their customers, partners, and employees—while empowering firms to define entirely new business models focused on sharing information in online collaborative environments. Yet, in and of themselves, these technologies cannot ensure productive online interactions. Leading enterprises that are experimenting with social networks and online communities are already discovering this fact and along with it, the importance of establishing trust as the foundation for online collaboration and transactions. Just as today's consumers must feel secure to bank, exchange personal information and purchase products and services online; participants in Web 2.0 initiatives will only accept the higher levels of risk and exposure inherent in e-commerce and Web collaboration in an environment of trust. Indeed, only by attending to the need to cultivate online trust with customers, partners and employees will enterprises ever fully exploit the expanded business potential posed by Web 2.0. But developing online trust is no easy feat. While various preliminary attempts have occurred, no definitive model for establishing or measuring it has yet been established. To that end, nGenera has identified three, distinct dimensions of online trust: reputation (quantitative-based); relationship (qualitative-based) and process (system-based). When considered together, they form a valuable model for understanding online trust and a toolbox for cultivating it to support Web 2.0 initiatives.

  12. Modified method for intravital-fluorescent microscopy for on-line measurement of vasomotion in cutaneous microcirculation of mice in vivo

    International Nuclear Information System (INIS)

    Traikov, L.; Jia, F.; Ushiyama, A.; Masuda, H.; Ohkubo, C.

    2004-01-01

    The purpose of this study was establishing of the suitable method for long term investigations of changes of the blood vessel diameter up to 60 min continuous measurements with the main aim to be detected possible changes in low frequency component of vasomotion at cutaneous microcirculation of mice in vivo without using anesthetized animals. For investigation of micro-circulatory changes of blood vessel diameter, it is necessary to be used as high as possible quality video images with high resolution (1591x1061 pixels) - at this time the best method for this purpose is intravital microscopy, with high magnification and high resolution this method allows to be observed blood vessels from 5 to 100 μm - and also to be determined blood vessel wall and surrounded blood vessel cells. In this investigation BALB/c mice were used, and a Dorsal Skin-fold Chamber (DSC), were surgically implanted 4 days before the experiment. Intravital video-microscopy measurements of vasomotion in vivo were realized by 3CCD-camera, SONY Inc. and Nikon Inc. microscopy system. Fluorescence signal from the blood vessel, were enhanced by using DVS-3000 system (Hamamatsu Inc.) Vasomotion or temporal changes of the blood vessel diameter was measured by High-speed Digital Machine Vision System CV-2100 (KEYENCE Inc.), using an edge-gap detection algorithm (with a sampling time 389 ms), for on-line calculating the outer diameter of the blood vessels by means of fluorescence-image visualization (with precision 0.5 μm), after caudal vein injection of (from 50h150 μl per 25g animal) Fluorescein Isothiocyanate (FITC)-labeled Dextrans from 60-250 kDa concentration 2.5% in PBS solution pH=7.5. First part of this study was set up the intensity of the fluorescence using different concentrations and molecular weight Dextrans for visualization of the blood plasma with enough high intensity and as low as possible effects on the blood viscosity. Set up of the edge finding algorithm from off-line calculations

  13. First on-line applications of a multi-reflection time-of-flight mass separator at ISOLTRAP and the mass measurement of 82Zn

    International Nuclear Information System (INIS)

    Wolf, Robert

    2013-01-01

    This thesis describes the implementation and first on-line application of a multi-reflection time-of-flight (MR-ToF) mass analyzer for high-resolution mass separation at the ISOLTRAP mass spectrometer at ISOLDE/CERN. On the one hand, the major objective was to improve ISOLTRAPs mass-measurement capabilities with respect to the ratio of delivered contaminating ions to ions of interest. On the other hand, the time necessary to purify wanted from unwanted species should be reduced as much as possible to enable access to even more exotic nuclei. The device has been set up, optimized and tested at the University of Greifswald before its move to ISOLTRAP. The achieved performance comprises mass resolving powers of up to 2 x 10 5 reached at observation times of 30 ms and a contamination suppression of about four orders of magnitude by use of a Bradbury-Nielsen gate. With the characteristics, it outperforms clearly the so far state-of-the-art purification method of a gas-filled Penning trap. To improve the utilization of the MR-ToF mass analyzer, the in-trap lift method has been developed. It simplifies the application and optimization of the device, which is a crucial time factor in an on-line experiment. The device was the first of its kind successfully applied to radioactive ion beams for a mass analysis, for a mass separation (in combination with the Bradbury-Nielsen gate) as a preparatory step for a subsequent Penning-trap mass measurement and as a high-precision mass spectrometer of its own. The later was recently used for the first mass measurement of the neutron-rich calcium isotopes 53 Ca and 54 Ca. The so-far achieved mass-resolving power of 2 x 10 5 belongs to the highest reported for time-of-flight mass analyzers at all. The first successful application of the MR-ToF system as the only mass separator at ISOLTRAP resulted in the mass measurement of 82 Zn. The new mass value has been compared to mass extrapolations of the most recent Hartree-Fock-Bogolyubov (HFB

  14. First on-line applications of multi-reflection time-of-flight mass separator at ISOLTRAP and the mass measurement of $^{82}$Zn

    CERN Document Server

    Wolf, Robert

    This thesis describes the implementation and first on-line application of a multi-reflection time-of-flight (MR-ToF) mass analyzer for high-resolution mass separation at the ISOLTRAP mass spectrometer at ISOLDE/CERN. On the one hand, the major objective was to improve ISOLTRAPs mass-measurement capabilities with respect to the ratio of delivered contaminating ions to ions of interest. On the other hand, the time necessary to purify wanted from unwanted species should be reduced as much as possible to enable access to even more exotic nuclei. The device has been set up, optimized and tested at the University of Greifswald before its move to ISOLTRAP. The achieved performance comprises mass resolving powers of up to 200000 reached at observation times of 30ms and a contamination suppression of about four orders of magnitude by use of a Bradbury-Nielsen gate. With the characteristics, it outperforms clearly the so far state-of-the-art purification method of a gas-filled Penning trap. To improve the utilization o...

  15. On-line hydrogen-isotope measurements of organic samples using elemental chromium: An extension for high temperature elemental-analyzer techniques

    Science.gov (United States)

    Gehre, Matthias; Renpenning, Julian; Gilevska, Tetyana; Qi, Haiping; Coplen, Tyler B.; Meijer, Harro A.J.; Brand, Willi A.; Schimmelmann, Arndt

    2015-01-01

    The high temperature conversion (HTC) technique using an elemental analyzer with a glassy carbon tube and filling (temperature conversion/elemental analysis, TC/EA) is a widely used method for hydrogen isotopic analysis of water and many solid and liquid organic samples with analysis by isotope-ratio mass spectrometry (IRMS). However, the TC/EA IRMS method may produce inaccurate δ2H results, with values deviating by more than 20 mUr (milliurey = 0.001 = 1‰) from the true value for some materials. We show that a single-oven, chromium-filled elemental analyzer coupled to an IRMS substantially improves the measurement quality and reliability for hydrogen isotopic compositions of organic substances (Cr-EA method). Hot chromium maximizes the yield of molecular hydrogen in a helium carrier gas by irreversibly and quantitatively scavenging all reactive elements except hydrogen. In contrast, under TC/EA conditions, heteroelements like nitrogen or chlorine (and other halogens) can form hydrogen cyanide (HCN) or hydrogen chloride (HCl) and this can cause isotopic fractionation. The Cr-EA technique thus expands the analytical possibilities for on-line hydrogen-isotope measurements of organic samples significantly. This method yielded reproducibility values (1-sigma) for δ2H measurements on water and caffeine samples of better than 1.0 and 0.5 mUr, respectively. To overcome handling problems with water as the principal calibration anchor for hydrogen isotopic measurements, we have employed an effective and simple strategy using reference waters or other liquids sealed in silver-tube segments. These crimped silver tubes can be employed in both the Cr-EA and TC/EA techniques. They simplify considerably the normalization of hydrogen-isotope measurement data to the VSMOW-SLAP (Vienna Standard Mean Ocean Water-Standard Light Antarctic Precipitation) scale, and their use improves accuracy of the data by eliminating evaporative loss and associated isotopic fractionation while

  16. On-line hydrogen-isotope measurements of organic samples using elemental chromium: an extension for high temperature elemental-analyzer techniques.

    Science.gov (United States)

    Gehre, Matthias; Renpenning, Julian; Gilevska, Tetyana; Qi, Haiping; Coplen, Tyler B; Meijer, Harro A J; Brand, Willi A; Schimmelmann, Arndt

    2015-01-01

    The high temperature conversion (HTC) technique using an elemental analyzer with a glassy carbon tube and filling (temperature conversion/elemental analysis, TC/EA) is a widely used method for hydrogen isotopic analysis of water and many solid and liquid organic samples with analysis by isotope-ratio mass spectrometry (IRMS). However, the TC/EA IRMS method may produce inaccurate δ(2)H results, with values deviating by more than 20 mUr (milliurey = 0.001 = 1‰) from the true value for some materials. We show that a single-oven, chromium-filled elemental analyzer coupled to an IRMS substantially improves the measurement quality and reliability for hydrogen isotopic compositions of organic substances (Cr-EA method). Hot chromium maximizes the yield of molecular hydrogen in a helium carrier gas by irreversibly and quantitatively scavenging all reactive elements except hydrogen. In contrast, under TC/EA conditions, heteroelements like nitrogen or chlorine (and other halogens) can form hydrogen cyanide (HCN) or hydrogen chloride (HCl) and this can cause isotopic fractionation. The Cr-EA technique thus expands the analytical possibilities for on-line hydrogen-isotope measurements of organic samples significantly. This method yielded reproducibility values (1-sigma) for δ(2)H measurements on water and caffeine samples of better than 1.0 and 0.5 mUr, respectively. To overcome handling problems with water as the principal calibration anchor for hydrogen isotopic measurements, we have employed an effective and simple strategy using reference waters or other liquids sealed in silver-tube segments. These crimped silver tubes can be employed in both the Cr-EA and TC/EA techniques. They simplify considerably the normalization of hydrogen-isotope measurement data to the VSMOW-SLAP (Vienna Standard Mean Ocean Water-Standard Light Antarctic Precipitation) scale, and their use improves accuracy of the data by eliminating evaporative loss and associated isotopic fractionation while

  17. SOURCE TERM ESTIMATION BASED on PLANT STATUS and on GAMMA DOSE RATES Measured by an ON-line environmental Monitoring Network

    International Nuclear Information System (INIS)

    Stubna, M.; Bujan, A.; Duranova, T.

    1997-01-01

    A number of severe accident analyses for reactor unit with WWER-440 (213) has been performed in order to evaluate the source term and radiological consequences. As a tool for these analyses the WWER modified version of Source Term Code Package and Real Time Accident Release Consequences codes have been used. A set of emergency procedures - manuals for quick estimation of the source term and countermeasures introduction during early -pre-release phase of severe accident progression has been developed at Nuclear Power Plants Research Institute Trnava, Inc. These manuals are subdivided into three groups: 1.) evaluation of the barriers integrity, 2.) source term estimation and 3.) estimation of the distances for the countermeasures introduction. A methodology and computer module for interpretation of environmental data - source term assessment during post-release phase from on-line environmental network has been developed at Nuclear Power Plants Research Institute Trnava, Inc. The method is based on the conversion of measured dose rates to the source term,i.e. airborne radioactivity release rate, taking into account real meteorological data and location of the measure points. The bootstrap method for the estimation of the mean value of source term Q as integral value of the release and confidence interval of Q has been selected. The methodology of Q distribution into fission product groups according to code Real Time Accident Release Consequences needs is based on known plant status, i.e. on the results of pre calculated accident sequences. The paper describes the methodologies introduced above and the way of their application

  18. Online Innovation

    DEFF Research Database (Denmark)

    Vujovic, Sladjana; Ulhøi, John Parm

    2008-01-01

      Purpose - The aim of this paper is to investigate the role of online networking during the innovation process, including its role(s) in communication, cooperation and coordination. The paper neither implicitly assumes that online computer-based networking is a prerequisite for the innovation...... process nor denies the possibility that innovation can emerge and successfully survive without it. It merely presupposes that, in cases of innovation where information and communication technologies play a substantial role, non-proprietarity may offer an interesting alternative to innovations based...... on proprietary knowledge. Design/methodology/approach - The paper borrows from the theory of communities-of-practice, which takes into account social relations, contacts, and the transfer and incorporation of knowledge. Open source innovation is not the exclusive preserve of computer nerds, but also has...

  19. Online kinship

    DEFF Research Database (Denmark)

    Andreassen, Rikke

    2016-01-01

    The article shows how the technology of social media sites facilitates new kinds of kinship. It ana-lyzes how ‘donor families’ – i.e., families in which the children are conceived via sperm and/or egg donations – negotiate kinship, family formations and gender when connecting with each other online...... families as well as interviews with users of this Facebook group, the article shows how the affordances of social media, especially the Facebook application for smart phones, are central to the formation and maintenance of new kinship relations. Furthermore, the article illustrates how conventional....... Family formation and parenting are closely connected with gender and gender norms, and online donor families, therefore, offer an opportunity for understanding gender and gender for-mations in contemporary times and contemporary media. By analyzing commentary threads of a Facebook group connecting donor...

  20. Online wind turbine measurement laboratory

    DEFF Research Database (Denmark)

    Hansen, K.S.; Helgesen Pedersen, K.O.; Schmidt Paulsen, U.

    2006-01-01

    conditions, 3) electrical quantities and 4) mechanical loads in terms of strain gauge signals. The data acquisition system has been designed and implemented by Risø together with students and teachers from DTU. It is based on LabVIEW© combined with a MySQL database for data management. The system enables...... calculations and extreme loads estimation in basic wind turbine courses. Power quality analysis is carried out based on high speed sampled, three-phase voltage and current signals. The wide spectrum of sensors enables a detailed study of the correlation between meteorological, mechanical and electrical...

  1. Effects of GC temperature and carrier gas flow rate on on-line oxygen isotope measurement as studied by on-column CO injection.

    Science.gov (United States)

    Chen, Zhi-Gang; Yin, Xi-Jie; Zhou, Youping

    2015-08-01

    Although deemed important to δ 18 O measurement by on-line high-temperature conversion techniques, how the GC conditions affect δ 18 O measurement is rarely examined adequately. We therefore directly injected different volumes of CO or CO-N 2 mix onto the GC column by a six-port valve and examined the CO yield, CO peak shape, CO-N 2 separation, and δ 18 O value under different GC temperatures and carrier gas flow rates. The results show the CO peak area decreases when the carrier gas flow rate increases. The GC temperature has no effect on peak area. The peak width increases with the increase of CO injection volume but decreases with the increase of GC temperature and carrier gas flow rate. The peak intensity increases with the increase of GC temperature and CO injection volume but decreases with the increase of carrier gas flow rate. The peak separation time between N 2 and CO decreases with an increase of GC temperature and carrier gas flow rate. δ 18 O value decreases with the increase of CO injection volume (when half m/z 28 intensity is rate. On average, the δ 18 O value of the injected CO is about 1‰ higher than that of identical reference CO. The δ 18 O distribution pattern of the injected CO is probably a combined result of ion source nonlinearity and preferential loss of C 16 O or oxygen isotopic exchange between zeolite and CO. For practical application, a lower carrier gas flow rate is therefore recommended as it has the combined advantages of higher CO yield, better N 2 -CO separation, lower He consumption, and insignificant effect on δ 18 O value, while a higher-than-60 °C GC temperature and a larger-than-100 µl CO volume is also recommended. When no N 2 peak is expected, a higher GC temperature is recommended, and vice versa. Copyright © 2015 John Wiley & Sons, Ltd. Copyright © 2015 John Wiley & Sons, Ltd.

  2. Online networks destroy social trust

    OpenAIRE

    Sabatini, Fabio; Sarracino, Francesco

    2014-01-01

    Studies in the social capital literature have documented two stylised facts: first, a decline in measures of social participation has occurred in many OECD countries. Second, and more recently, the success of social networking sites (SNSs) has resulted in a steep rise in online social participation. Our study adds to this body of research by conducting the first empirical assessment of how online networking affects two economically relevant aspects of social capital, i.e. trust and sociabilit...

  3. One year online measurements of water-soluble ions at the industrially polluted town of Nanjing, China: Sources, seasonal and diurnal variations.

    Science.gov (United States)

    Wang, Honglei; An, Junlin; Cheng, Mengtian; Shen, Lijuan; Zhu, Bin; Li, Yi; Wang, Yuesi; Duan, Qing; Sullivan, Amy; Xia, Li

    2016-04-01

    Half-hourly mass concentrations water-soluble ions (WSIs) and PM2.5 were measured online a Rapid Collector of Fine Particles and Ion Chromatography system (RCFP-IC) and FH62C14 Continuous Particulate Monitor in Nanjing from October 18, 2013 to November 17, 2014. The WSIs concentration ranged from 7.07 to 333.42 μg m(-3) with an annual mean of 76.32 μg m(-3). The WSIs ranked in the order of SO4(2-) > NH4(+) > NO3(-) > Cl(-) > NO2(-) > K(+) > Ca(2+) > Na(+) > Mg(2+). The PM2.5 concentration ranged from 4.00 to 400 μg m(-3) with an annual mean of 83.58 μg m(-3). The concentrations of WSIs varied in the order of winter (115.77 μg m(-3)) > spring (76.10 μg m(-3)) > autumn (63.72 μg m(-3)) > summer (59.75 μg m(-3)), with the highest level in January (123.99 μg m(-3)) and lowest level in August (43.73 μg m(-3)). Different WSIs had distinct diurnal variations. The source analysis of the WSIs in the PCA/APCS mode illustrated that the sources consisted of secondary aerosol, coal combustion, mineral dust, biomass burning, traffic emissions and sea salt. In addition, there were seasonal variations amongst the various sources. The haze formation mechanism was different in summer and winter. The winter was dominated by NH4NO3 (18.56%), (NH4)2SO4 (28.63%), NH4(+) (11.27%), SO4(2-) (18.35%) and NO3(-) (13.13%), and by NH3 (25.93%), (NH4)2SO4 (13.37%), SO4(2-) (15.74%) and NO3(-) (9.97%) in summer. Consequently, the proportions of HCl, HNO3, NH4(+), SO4(2-) and NO3(-) were much larger during haze episodes in winter, while it was dominated by NH4NO3, NH4(+), (NH4)2SO4, SO4(2-) and NO3(-) during summer haze episodes. Copyright © 2016 Elsevier Ltd. All rights reserved.

  4. Didattica online

    Directory of Open Access Journals (Sweden)

    L. Charrier

    2003-05-01

    Full Text Available

    Obiettivi: formare un gruppo di operatori della Facoltà di Medicina e Chirurgia alle metodiche di progettazione e gestione di processi di didattica integrata basati sull’uso di tecnologie e risorse di rete, al fine di produrre e pubblicare materiale ODL per la Facoltà. Nel caso specifico, il progetto da realizzare era il modulo “Il rischio biologico” nell’ambito del corso “Rischio lavorativo in ambito sanitario”, allo scopo di integrare l’attività d’aula e offrire un pacchetto formativo cui i corsi di laurea interessati possano accedere per la didattica e la valutazione.

    Materiali e metodi: l’azione formativa è stata condotta con la tecnica “project based”, basata cioè sullo sviluppo di un progetto da parte dei borsisti. Le attività sono state articolate come incontri e attività di esercitazione in presenza sugli strumenti di produzione del materiale didattico (DreamWeaver, attività in “computer conferencing” sui temi trattati a lezione, attività di studio individuale assistite a distanza e attività assistita, sia in presenza che a distanza, di progettazione e realizzazione dei moduli didattici da fruirsi in rete con approccio ODL. Risultati: é stato prodotto il modulo “Il rischio biologico”, destinato agli studenti dei Corsi di Laurea della Facoltà di Medicina e Chirurgia e delle Scuole di Specializzazione. Il modulo è stato strutturato in quattro unità didattiche (Legislazione, Precauzioni, Misure di contenimento, Vaccinazioni, ciascuna delle quali contiene documenti di lettura e consultazione, riferimenti normativi in materia di rischio in ambito sanitario, immagini che presentano comportamenti (utilizzo dei DPI, lavaggio delle mani…, esercizi e test di autovalutazione con feedback e soluzioni consultabili online.

     Conclusioni: il modulo sarà fruibile online a partire dal I semestre dell’ anno accademico 2003-2004; si sta

  5. Measurement of trace levels of antibiotics in river water using on-line enrichment and triple-quadrupole LC-MS/MS.

    Science.gov (United States)

    Dinh, Quoc Tuc; Alliot, Fabrice; Moreau-Guigon, Elodie; Eurin, Joëlle; Chevreuil, Marc; Labadie, Pierre

    2011-09-15

    This study presents the development of an automated on-line solid phase extraction (SPE)-liquid chromatography-tandem mass spectrometry (LC-MS/MS) method for the determination of 23 antibiotics in environmental water samples. After optimisation of LC-MS/MS conditions, SPE parameters such as sorbent type, sample pH or sample volume were optimised. Antibiotic recoveries ranged from 64% to 98% and compared favourably with those achieved using off-line SPE. Limits of detection were in the range 0.5-13.7 ng L(-1). This on-line SPE-LC-MS/MS procedure was applied to the analysis of water samples taken in three rivers within the Seine River basin, near Paris (France). The obtained results revealed the occurrence of 12 antibiotics, including tylosin, erythromycin, tetracycline, amoxicillin, trimethoprim, sulfamethoxazole, oxolinic acid, flumequine, norfloxacin, ciprofloxacin, ofloxacin, and vancomycin (2-1435 ng L(-1)). Copyright © 2011 Elsevier B.V. All rights reserved.

  6. Euroscepticism Online

    DEFF Research Database (Denmark)

    Dutceac Segesten, Anamaria; Bossetta, Michael

    The 2014 elections for the European Parliament are likely to result in the highest number of MEPs representing right-wing parties across Europe. The prolonged eurocrisis and its direct, visible effects (e.g. unemployment and poverty) have already polarized the public opinion in many of EU:s membe...... and nationalism as the two poles on a continuum of attitudes coming out of the discourses. We discuss finally the consequences of the expected Swedish-Danish divergence of online debate content for the idea of a unified European public sphere.......The 2014 elections for the European Parliament are likely to result in the highest number of MEPs representing right-wing parties across Europe. The prolonged eurocrisis and its direct, visible effects (e.g. unemployment and poverty) have already polarized the public opinion in many of EU:s member......-criticism between Sweden and Denmark? Methodologically we combine quantitative and qualitative content analysis of the forum discussions pertaining to the EU critique taking place on the two platforms respectively. Our focus is thus not on the republished content originated in traditional media channels...

  7. [Online gaming. Potential risk and prevention programs].

    Science.gov (United States)

    Malischnig, Doris

    2014-12-01

    Online gaming is more and more common and increasingly accessible. Due to a lack of social control the participation could be a potential risk for certain customers. The given article focuses on prevention measures that are provided by the Austrian online gaming operator, the Austrian Lotteries, provider of the online gaming platform win2day, in the light of the specifics of Internet gaming in order to avoid problems with gaming.

  8. University Student Online Plagiarism

    Science.gov (United States)

    Wang, Yu-mei

    2008-01-01

    This article reports a study investigating university student online plagiarism. The following questions are investigated: (a) What is the incidence of student online plagiarism? (b) What are student perceptions regarding online plagiarism? (c) Are there any differences in terms of student perceptions of online plagiarism and print plagiarism? (d)…

  9. Online Archives

    Directory of Open Access Journals (Sweden)

    Julian D. Richards

    2004-01-01

    Full Text Available Online archives are of increasing importance in Archaeological Informatics, but like any new genre they prompt a number of questions. What is their relationship to publication? What should go in them? How should they be delivered and indexed? Can they be preserved? Whilst their delivery requires technology, we must also consider how that technology should best be employed in the service of our discipline. This article attempts to address some of these questions but it need not be read from start to finish. The links from this summary provide one fairly linear route through the text but each section is self-contained and can also be accessed directly from the Contents page. The problems posed by effective publication of archaeological fieldwork have exercised the profession for many decades. The issues raised go to the core of discussion of whether preservation by record is a valid concept, and indeed whether archaeological data exist. There are different schools of thought about the relationship between publication and archiving, but hopefully we can accept that data are recorded observations but still agree that they have a re-use value for re-examination and re-interpretation. Since the 1960s archaeology has experienced a publication crisis point. The scenario is familiar. Excavation is destruction; it is an unrepeatable experiment and the archaeologist has a professional obligation to make a full and accessible record of his/her observations. Yet full publication is increasingly expensive and difficult, and excavation monographs are read by few people, and bought by even fewer. In England the development of post-PPG16 fieldwork has exacerbated the problem by creating a mountain of unpublished grey literature and making the work of synthesis even harder; a similar situation exists in other countries. Meanwhile museum archives are also reaching breaking point; most are running out of storage space, few can provide facilities for access, and

  10. Online Marketing Trends

    OpenAIRE

    Horecká, Ivana

    2015-01-01

    This thesis deals with online marketing trends. Its main goal is to define the latest online marketing trends, create a website with the free online marketing trends, and analyse their effectiveness. The theoretical part brings a thorough description of the latest online marketing trends. Moreover, it provides an insight into the latest trends in the website development. The chosen online marketing trends defined in the theoretical part are subsequently applied on a newly created website. All...

  11. Online Shopping Behavior

    OpenAIRE

    Shahzad, Hashim

    2015-01-01

    Online shopping is a very much developed phenomena in Scandinavian countries. Different online factors impact online consumers’ behavior differently depending on the environment of different regions. Sweden is one of the developed and technologically advanced countries. To see the impact of different factors on consumers’ online shopping behavior, the purpose of this study is to analyse the factors that influence consumers’ online shopping behavior in Sweden’s context. One of the objectives o...

  12. Analisis Intensi Berprestasi Mahasiswa Binus Online Learning

    Directory of Open Access Journals (Sweden)

    Agus Putranto

    2013-12-01

    Full Text Available The utilization of e-learning can improve learning effectiveness and flexibility. Universitas Bina Nusantara (BINUS provides an online learning program called BINUS Online learning. It offers the student to do a study through online activities, where the students are couraged to learn individually. This research was conducted to obtain a perspective of student intention from BINUS Online learning to mark good achievement. Non experimental method with quatitative approached is implemented where the respondents are students of Information System department and Marketing Management Department. The sampling techniques used is non probability purposive sampling. All variables are measured using questionnaire based on Fishbein and Ajzen model. The data of the research are analyzed using descriptive statistics and multiple linier regression analysis. The results show that the intention to mark an achievement of students of BINUS Online learning is very high. It means that BINUS Online learning Program students have strong intention to get good marks and study achievements.

  13. Evaluation of the usefulness of visceral fat area measurement by the bioelectrical impedance method during workplace health screening

    International Nuclear Information System (INIS)

    Igarashi, Chiyo

    2008-01-01

    In the field of occupational health, health guidance concerning obesity is often conducted in order to prevent lifestyle-related diseases. With recent awareness of the concept of metabolic syndrome, measurement of the visceral fat area (VFA) by CT has been useful for health guidance, but it is difficult in workplace health screening. Presently, the BMI (Body Mass Index), body fat percentage measured by the bioelectrical impedance method, and waist girth at the umbilical level (abdominal girth) are practical indices of obesity used in such health screening. In this study, VAF was measured in 590 clerical or sales workers in the manufacturing industry using a body fat meter capable of a visceral fat measurement by the bioelectrical impedance method. The relationship of this value to the results of biochemical tests and lifestyle was then evaluated using analysis of covariance structures. Analysis indicated that the risk of lifestyle-related disease was closely related to the degree of obesity. Among indices of the degree of obesity, VFA was more closely related than BMI or body fat percentage, and only slightly less closely related than abdominal girth to the risk of lifestyle-related diseases. Since VFA is effective in screening for latent obesity, health guidance based on digital data, and the subjects' body imaging, its measurement by the bioelectrical impedance method is considered useful for workplace health management. (author)

  14. Online Privacy as a Corporate Social Responsibility

    DEFF Research Database (Denmark)

    Pollach, Irene

    2011-01-01

    Information technology and the Internet have added a new stakeholder concern to the corporate social responsibility agenda: online privacy. While theory suggests that online privacy is a corporate social responsibility, only very few studies in the business ethics literature have connected...... of the companies have comprehensive privacy programs, although more than half of them voice moral or relational motives for addressing online privacy. The privacy measures they have taken are primarily compliance measures, while measures that stimulate a stakeholder dialogue are rare. Overall, a wide variety...

  15. Selected examples of online measuring techniques for N and P elimination at sewage treatment plants; Ausgewaehlte Beispiele fuer die Online-Messtechnik zur N- und P-Elimination in Klaeranlagen

    Energy Technology Data Exchange (ETDEWEB)

    Wolffson, C.

    1997-12-31

    More stringent demands on the pollutant concentration of effluents call for stricter self-monitoring and enhanced process control. Devices for measuring ammonium, nitrate and phosphate that suit practical requirements are available. The readings continuously obtained can be additionally used by the control room, within the framework of modern sewage plant process control, for process monitoring. Apart from the financial advantages of saving ventilation energy and chemicals, control loops with continuous measurements are superior in that they enhance the process stability of sewage treatment. (orig.) [Deutsch] Verschaerfte Einleitungsbedingungen erfordern verstaerkte Eigenueberwachung und verbesserte Prozessregelung. Betriebstaugliche Dauermessgeraete fuer Ammonium, Nitrat und Phosphat stehen zur Verfuegung. Die kontinuierlich anfallenden Messwerte koennen im Rahmen der modernen Klaeranlagenleittechnik neben der Prozessregelung zusaetzlich in den Schaltwarten zur Prozessueber-wachung genutzt werden. Neben den Einsparungsmoeglichkeiten fuer Belueftungsenergie und Chemikalien, die einen finanziellen Vorteil bedeuten, liegt der entscheidende Vorzug der Regelkreise mit konti-nuierlichen Messungen in der Verbesserung der Prozessstabilitaet der Abwasserreinigung. (orig.)

  16. Absolute on-line in-pile measurement of neutron fluxes using self-powered neutron detectors: Monte Carlo sensitivity calculations

    Energy Technology Data Exchange (ETDEWEB)

    Vermeeren, L. [SCK/CEN, B-2400 Mol (Belgium)

    2001-07-01

    Self-powered neutron detectors (SPND) are well suited to monitor continuously the neutronic operating conditions of driver fuel of research reactors and to follow its burnup evolution. This is of particular importance when advanced or new MTR fuel designs need to be qualified. We have developed a detailed MCNP-4B based Monte Carlo approach for the calculation of neutron sensitivities of SPNDs. Results for the neutron sensitivity of a Rh SPND are in excellent agreement with experimental data recently obtained at the BR2 research reactor. A critical comparison of the Monte Carlo results with results from standard analytical methods reveals an important deficiency of the analytical methods in the description of the electron transport efficiency. Our calculation method allows a reliable on-line determination of the absolute in-pile neutron flux. (author)

  17. The Social Presences in Text-Based Collaborations Via Electronic Devices: Measuring the ‘Online-Self’ of the Young Generation in Bangladesh

    Directory of Open Access Journals (Sweden)

    Masoom Muhammad Rehan

    2016-12-01

    Full Text Available The procedural revolution of technology making people more and more linked to virtual based lives, and providing an outline to live in online-based curriculums. However, not all the nations have the same level of access and equal opportunities to grip the fruit of communication technology, hence the social presence in cyberspace suppose to differ from nations to nations. The study tends to explore the facets of technology-mediated text-based correspondences of the young generation, who often apt to use their own technologically advanced telecommunication devices. To conceptualize the qualitative aspect of the study into quantitative findings, the key assumptions are tested in each step of the factor analysis process. Based on the scanned cases of the survey, the study concludes that the young generation of the nations, where technological advancement is yet to flourish is less formal, more emotionally sensitive and more open about their state of the mind compared to the technologically advanced nations.

  18. Absolute on-line in-pile measurement of neutron fluxes using self-powered neutron detectors: Monte Carlo sensitivity calculations

    International Nuclear Information System (INIS)

    Vermeeren, L.

    2001-01-01

    Self-powered neutron detectors (SPND) are well suited to monitor continuously the neutronic operating conditions of driver fuel of research reactors and to follow its burnup evolution. This is of particular importance when advanced or new MTR fuel designs need to be qualified. We have developed a detailed MCNP-4B based Monte Carlo approach for the calculation of neutron sensitivities of SPNDs. Results for the neutron sensitivity of a Rh SPND are in excellent agreement with experimental data recently obtained at the BR2 research reactor. A critical comparison of the Monte Carlo results with results from standard analytical methods reveals an important deficiency of the analytical methods in the description of the electron transport efficiency. Our calculation method allows a reliable on-line determination of the absolute in-pile neutron flux. (author)

  19. Elevated urinary levels of carcinogenic N-nitrosamines in patients with urinary tract infections measured by isotope dilution online SPE LC–MS/MS

    International Nuclear Information System (INIS)

    Hu, Chiung-Wen; Shih, Ying-Ming; Liu, Hung-Hsin; Chiang, Yi-Chen; Chen, Chih-Ming; Chao, Mu-Rong

    2016-01-01

    Highlights: • Nine N-nitrosamines in urine were quantified by LC–MS/MS. • N-nitrosodiphenylamine was firstly identified in human urine. • UTI patients had much higher N-nitrosamines concentrations than healthy subjects. • N-nitrosamines were dramatically decreased after antibiotic treatment. • NDMA was correlated with the pH, WBC esterase activity or nitrite in UTI patients. - Abstract: N-nitrosamines (NAms) are well-documented for their carcinogenic potential. Human exposure to NAms may arise from the daily environment and endogenous formation via the reaction of secondary amines with nitrites or from bacteria infection. We describe the use of isotope dilution online solid-phase extraction (SPE) LC–MS/MS to quantify nine NAms in human urine. This method was validated and further applied to healthy subjects and patients with urinary tract infection (UTI). N-nitrosodimethylamine (NDMA), N-nitrosomethylethylamine (NMEA), N-nitrosopyrrolidine (NPYR) and N-nitrosomorpholine (NMOR) were analyzed with an APCI source, while N-nitrosodiethylamine (NDEA), N-nitrosopiperidine (NPIP), N-nitrosodi-n-propylamine (NDPA), N-nitrosodibutylamine (NDBA) and N-nitrosodiphenylamine (NDPhA) were quantified with an ESI source, due to their effect on the sensitivity and chromatography. NDMA was the most abundant N-nitrosamine, while NDPhA was firstly identified in human. UTI patients had three to twelve-fold higher concentrations for NDMA, NPIP, NDEA, NMOR and NDBA in urine than healthy subjects, and the NAms were significantly decreased after antibiotics treatment. NDMA concentrations were also significantly correlated with the pH value, leukocyte esterase activity or nitrite in urines of UTI patients. Our findings by online SPE LC–MS/MS method evidenced that UTI patients experienced various NAms exposures, especially the potent carcinogen NDMA, which was likely induced by bacteria infection.

  20. Elevated urinary levels of carcinogenic N-nitrosamines in patients with urinary tract infections measured by isotope dilution online SPE LC–MS/MS

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Chiung-Wen [Department of Public Health, Chung Shan Medical University, Taichung 402, Taiwan (China); Shih, Ying-Ming [Department of Public Health, Chung Shan Medical University, Taichung 402, Taiwan (China); Division of Chest Medicine, Department of Internal Medicine, Changhua Christian Hospital, Changhua 500, Taiwan (China); Liu, Hung-Hsin [Department of Occupational Safety and Health, Chung Shan Medical University, Taichung 402, Taiwan (China); Chiang, Yi-Chen [Department of Public Health, Chung Shan Medical University, Taichung 402, Taiwan (China); School of Public Health, Xiamen University, Xiamen 361102, Fujian (China); Chen, Chih-Ming [Department of Occupational Safety and Health, Chung Shan Medical University, Taichung 402, Taiwan (China); Chao, Mu-Rong, E-mail: chaomurong@gmail.com [Department of Occupational Safety and Health, Chung Shan Medical University, Taichung 402, Taiwan (China); Department of Occupational Medicine, Chung Shan Medical University Hospital, Taichung 402, Taiwan (China)

    2016-06-05

    Highlights: • Nine N-nitrosamines in urine were quantified by LC–MS/MS. • N-nitrosodiphenylamine was firstly identified in human urine. • UTI patients had much higher N-nitrosamines concentrations than healthy subjects. • N-nitrosamines were dramatically decreased after antibiotic treatment. • NDMA was correlated with the pH, WBC esterase activity or nitrite in UTI patients. - Abstract: N-nitrosamines (NAms) are well-documented for their carcinogenic potential. Human exposure to NAms may arise from the daily environment and endogenous formation via the reaction of secondary amines with nitrites or from bacteria infection. We describe the use of isotope dilution online solid-phase extraction (SPE) LC–MS/MS to quantify nine NAms in human urine. This method was validated and further applied to healthy subjects and patients with urinary tract infection (UTI). N-nitrosodimethylamine (NDMA), N-nitrosomethylethylamine (NMEA), N-nitrosopyrrolidine (NPYR) and N-nitrosomorpholine (NMOR) were analyzed with an APCI source, while N-nitrosodiethylamine (NDEA), N-nitrosopiperidine (NPIP), N-nitrosodi-n-propylamine (NDPA), N-nitrosodibutylamine (NDBA) and N-nitrosodiphenylamine (NDPhA) were quantified with an ESI source, due to their effect on the sensitivity and chromatography. NDMA was the most abundant N-nitrosamine, while NDPhA was firstly identified in human. UTI patients had three to twelve-fold higher concentrations for NDMA, NPIP, NDEA, NMOR and NDBA in urine than healthy subjects, and the NAms were significantly decreased after antibiotics treatment. NDMA concentrations were also significantly correlated with the pH value, leukocyte esterase activity or nitrite in urines of UTI patients. Our findings by online SPE LC–MS/MS method evidenced that UTI patients experienced various NAms exposures, especially the potent carcinogen NDMA, which was likely induced by bacteria infection.

  1. African Journals Online (AJOL)

    African Journals Online (AJOL)

    African Journals OnLine (AJOL) is the world's largest online library of ... and find other information sources and more resources for researchers and journals. ... Potchefstroom Electronic Law Journal/Potchefstroomse Elektroniese Regsblad.

  2. African Journals Online (AJOL)

    African Journals Online (AJOL)

    African Journals OnLine (AJOL) is the world's largest online library of ... and find other information sources and more resources for researchers and journals. ... Nnamdi Azikiwe University Journal of International Law and Jurisprudence.

  3. Online Data Collection.

    Science.gov (United States)

    Topp, Neal W.; Pawloski, Bob

    2002-01-01

    Describes the eventful history of online data collection and presents a review of current literature following by a list of pros and cons to be considered when stepping into online surveying. (Contains 14 references.) (Author/YDS)

  4. African Journals Online (AJOL)

    African Journals Online (AJOL)

    African Journals OnLine (AJOL) is the world's largest online library of ... AJOL works to change this, so that African-origin research output is available to Africans ... South African Medical Journal ... Global Journal of Pure and Applied Sciences.

  5. Online driver's license renewal.

    Science.gov (United States)

    2015-09-01

    The Kentucky Department of Vehicle Regulation is exploring the possibility of developing and implementing online : drivers license renewal. The objective of this project was to: 1) evaluate online drivers license and REAL ID renewal : programs ...

  6. On-line moisture analysis

    CERN Document Server

    Cutmore, N G

    2002-01-01

    Measurement of the moisture content of iron ore has become a key issue for controlling moisture additions for dust suppression. In most cases moisture content is still determined by manual or automatic sampling of the ore stream, followed by conventional laboratory analysis by oven drying. Although this procedure enables the moisture content to be routinely monitored, it is too slow for control purposes. This has generated renewed interest in on-line techniques for the accurate and rapid measurement of moisture in iron ore on conveyors. Microwave transmission techniques have emerged over the past 40 years as the dominant technology for on-line measurement of moisture in bulk materials, including iron ores. Alternative technologies have their limitations. Infra-red analysers are used in a variety of process industries, but rely on the measurement of absorption by moisture in a very thin surface layer. Consequently such probes may be compromised by particle size effects and biased presentation of the bulk mater...

  7. Evaluating Online Dialogue on "Security" Using a Novel Instructional Design

    Science.gov (United States)

    Arora, Payal

    2008-01-01

    This paper explores evaluation strategies to gauge the impact of a novel instructional design on international community participation online. This is done by conceptualizing and devising indicators for measuring "engagement" online amongst marginalized adult communities worldwide. In doing so, a review of online evaluation literature is…

  8. English Proficiency and Participation in Online Discussion for Learning

    Science.gov (United States)

    Leung, Steve

    2013-01-01

    Does English proficiency affect participation in online discussion? This study polled 14 students from a postgraduate online course that require online discussion. The students are divided into groups according to their home language spoken and self-assessed English proficiency, and measure against their participation level in the required…

  9. Implementing Online Physical Education

    Science.gov (United States)

    Mohnsen, Bonnie

    2012-01-01

    Online physical education, although seemingly an oxymoron, appears to be the wave of the future at least for some students. The purpose of this article is to explore research and options for online learning in physical education and to examine a curriculum, assessment, and instructional model for online learning. The article examines how physical…

  10. Library Online Systems.

    Science.gov (United States)

    Folda, Linda; And Others

    1989-01-01

    Issues related to library online systems are discussed in six articles. Topics covered include staff education through vendor demonstrations, evaluation of online public access catalogs, the impact of integrated online systems on cataloging operations, the merits of smart and dumb barcodes, and points to consider in planning for the next online…

  11. NPS and Online WOM

    Science.gov (United States)

    Raassens, Néomie

    2017-01-01

    The Net Promoter Score (NPS) is, according to Reichheld, the single most reliable indicator of company growth, and many companies use this recommendation-based technique for measuring customer loyalty. Despite its widespread adoption by many companies across multiple industries, the debate about NPS goes on. A major concern is that managers treat NPS as being equivalent across customers, which is often very misleading. By using a unique data set that combines customers’ promoter scores and online word-of-mouth (eWOM) behavior, this research studies how individual customers’ promoter scores are related to eWOM, including its relationship with the three categories of customers that are identified by the NPS paradigm (i.e., promoters, passives, and detractors). Based on a sample of 189 customers, their promoter scores and corresponding eWOM, the results show that there is a positive relationship between customers’ promoter scores and the valence of online messages. Further, while detractors and promoters are homogeneous with respect to the valence of the eWOM messages they spread, passives show message valence heterogeneity. Thus, although passives, the largest group of customers, have no weight in calculating the NPS, our results reveal that companies should flag passives for further attention and action. PMID:29046609

  12. Online weight training.

    Science.gov (United States)

    McNamara, John M; Swalm, Ricky L; Stearne, David J; Covassin, Tracey M

    2008-07-01

    The purpose of this study was to determine how a traditional weight training class compared to nontraditional classes that were heavily laden with technology. Could students learn resistance exercises by watching video demonstrations over the Internet? Three university weight training classes, each lasting 16 weeks, were compared. Each class had the same curriculum and workout requirements but different attendance requirements. The online group made extensive use of the Internet and was allowed to complete the workouts on their own at any gym that was convenient for them. Seventy-nine college-aged students were randomized into 3 groups: traditional (n = 27), hybrid (n = 25), and online (n = 27). They completed pretest and posttest measures on upper-body strength (i.e., bench press), lower-body strength (i.e., back squat), and knowledge (i.e., written exam). The results indicated that all 3 groups showed significant improvement in knowledge (p students to attend class and may have resulted in significantly lower scores on the bench press (p technology can be used in a weight training class. If this limit is exceeded, some type of monitoring system appears necessary to ensure that students are actually completing their workouts.

  13. Comparing Online Algorithms for Bin Packing Problems

    DEFF Research Database (Denmark)

    Epstein, Leah; Favrholdt, Lene Monrad; Kohrt, Jens Svalgaard

    2012-01-01

    The relative worst-order ratio is a measure of the quality of online algorithms. In contrast to the competitive ratio, this measure compares two online algorithms directly instead of using an intermediate comparison with an optimal offline algorithm. In this paper, we apply the relative worst-ord......-order ratio to online algorithms for several common variants of the bin packing problem. We mainly consider pairs of algorithms that are not distinguished by the competitive ratio and show that the relative worst-order ratio prefers the intuitively better algorithm of each pair....

  14. Pressure-assisted electrokinetic injection for on-line enrichment in capillary electrophoresis-mass spectrometry: a sensitive method for measurement of ten haloacetic acids in drinking water.

    Science.gov (United States)

    Zhang, Huijuan; Zhu, Jiping; Aranda-Rodriguez, Rocio; Feng, Yong-Lai

    2011-11-07

    Haloacetic acids (HAAs) are by-products of the chlorination of drinking water containing natural organic matter and bromide. A simple and sensitive method has been developed for determination of ten HAAs in drinking water. The pressure-assisted electrokinetic injection (PAEKI), an on-line enrichment technique, was employed to introduce the sample into a capillary electrophoresis (CE)-electrospray ionization-tandem mass spectrometry system (ESI-MS/MS). HAAs were monitored in selected reaction monitoring mode. With 3 min of PAEKI time, the ten major HAAs (HAA10) in drinking water were enriched up to 20,000-fold into the capillary without compromising resolution. A simple solid phase clean-up method has been developed to eliminate the influence of ionic matrices from drinking water on PAEKI. Under conditions optimized for mass spectrometry, PAEKI and capillary electrophoresis, detection limits defined as three times ratio of signal to noise have been achieved in a range of 0.013-0.12 μg L(-1) for ten HAAs in water sample. The overall recoveries for all ten HAAs in drinking water samples were between 76 and 125%. Six HAAs including monochloro- (MCAA), dichloro- (DCAA), trichloro- (TCAA), monobromo- (MBAA), bromochloro- (BCAA), and bromodichloroacetic acids (BDCAA) were found in tap water samples collected. Crown Copyright © 2011. Published by Elsevier B.V. All rights reserved.

  15. The impact of reliable prebolus T 1 measurements or a fixed T 1 value in the assessment of glioma patients with dynamic contrast enhancing MRI.

    Science.gov (United States)

    Tietze, Anna; Mouridsen, Kim; Mikkelsen, Irene Klærke

    2015-06-01

    Accurate quantification of hemodynamic parameters using dynamic contrast enhanced (DCE) MRI requires a measurement of tissue T 1 prior to contrast injection (T 1). We evaluate (i) T 1 estimation using the variable flip angle (VFA) and the saturation recovery (SR) techniques and (ii) investigate if accurate estimation of DCE parameters outperform a time-saving approach with a predefined T 1 value when differentiating high- from low-grade gliomas. The accuracy and precision of T 1 measurements, acquired by VFA and SR, were investigated by computer simulations and in glioma patients using an equivalence test (p > 0.05 showing significant difference). The permeability measure, K trans, cerebral blood flow (CBF), and - volume, V p, were calculated in 42 glioma patients, using fixed T 1 of 1500 ms or an individual T 1 measurement, using SR. The areas under the receiver operating characteristic curves (AUCs) were used as measures for accuracy to differentiate tumor grade. The T 1 values obtained by VFA showed larger variation compared to those obtained using SR both in the digital phantom and the human data (p > 0.05). Although a fixed T 1 introduced a bias into the DCE calculation, this had only minor impact on the accuracy differentiating high-grade from low-grade gliomas, (AUCfix = 0.906 and AUCind = 0.884 for K trans; AUCfix = 0.863 and AUCind = 0.856 for V p; p for AUC comparison > 0.05). T 1 measurements by VFA were less precise, and the SR method is preferable, when accurate parameter estimation is required. Semiquantitative DCE values, based on predefined T 1 values, were sufficient to perform tumor grading in our study.

  16. Online Display Advertising Causal Attribution and Evaluation

    OpenAIRE

    Barajas Zamora, Joel

    2015-01-01

    The allocation of a given budget to online display advertising as a marketing channel has motivated the development of statistical methods to measure its effectiveness. Recent studies show that display advertising often triggers online users to search for more information on products. Eventually, many of these users convert at the advertiser’s website. A key challenge is to measure the effectiveness of display advertising when users are exposed to multiple unknown advertising channels.We deve...

  17. Online trapping and enrichment ultra performance liquid chromatography–tandem mass spectrometry method for sensitive measurement of “arginine-asymmetric dimethylarginine cycle” biomarkers in human exhaled breath condensate

    International Nuclear Information System (INIS)

    Di Gangi, Iole Maria; Pirillo, Paola; Carraro, Silvia; Gucciardi, Antonina; Naturale, Mauro; Baraldi, Eugenio; Giordano, Giuseppe

    2012-01-01

    Highlights: ► Simultaneous quantification of “arginine-ADMA cycle” metabolites developed in EBC. ► EBC is a non-invasive matrix highly useful in patients with respiratory diseases. ► Method, fast, precise and accurate, is suitable in the pediatric clinical studies. ► Sensitivity is increased using on-line trapping and enrichment-UPLC–MS/MS method. ► EBC measurements in asthmatic adolescents confirm that ADMA is increased in asthma. - Abstract: Background: Exhaled breath condensate (EBC) is a biofluid collected non invasively that, enabling the measurement of several biomarkers, has proven useful in the study of airway inflammatory diseases, including asthma, COPD and cystic fibrosis. To the best of our knowledge, there is no previous report of any analytical method to detect ADMA in EBC. Objectives: Aim of this work was to develop an online sample trapping and enrichment system, coupled with an UPLC–MS/MS method, for simultaneous quantification of seven metabolites related to “Arginine-ADMA cycle”, using the isotopic dilution. Methods: Butylated EBC samples were trapped in an online cartridge, washed before and after each injection with cleanup solution to remove matrix components and switched inline into the high pressure analytical column. Multiple reaction monitoring in positive mode was used for analyte quantification by tandem mass spectrometry. Results: Validation studies were performed in EBC to examine accuracy, precision and robustness of the method. For each compound, the calibration curves showed a coefficient of correlation (r 2 ) greater than 0.992. Accuracy (%Bias) was −1 ), measured in EBC samples of asthmatic adolescents are significantly increased (p < 0.0001) than in normal controls (0.0040 ± 0.0021 vs. 0.0012 ± 0.0005 and 0.0020 ± 0.0015 vs. 0.0002 ± 0.0001, respectively), as well the ADMA/Tyr (0.34 ± 0.09 vs. 0.12 ± 0.02, p < 0.0001) and the SDMA/Tyr ratio (0.10 ± 0.04 vs. 0.015 ± 0.004, p < 0.0001). Conclusions

  18. Perancangan Massively Multiplayer Online Knights Fantasy Online

    OpenAIRE

    Haris, Darius Andana; Mawardi, Viny Christanti; Pratama, Davin

    2017-01-01

    Knights Fantasy Online adalah game online multiplayer dengan genre role-playing. Game ini dibuat menggunakan ActionScript 3.0 dengan Adobe Flash sebagai sisi klien dan Java sebagai servernya. Desain dari game ini dibuat dengan Adobe illustrator. Dalam game ini, pemain memulai petualangannya di dunia bernama Edenia, sebagai ksatria dari kerajaan yang bernama Aurum. Pemain bertugas mengkontrol jumlah populasi monster. Pemain dapat mengambil quest, mengumpulkan equipment dan meningkatkan ability...

  19. Development and evaluation of a self-cleaning custom-built auto sampler controlled by a low-cost RaspberryPi microcomputer for online enzymatic activity measurements.

    Science.gov (United States)

    Stadler, Philipp; Farnleitner, Andreas H; Zessner, Matthias

    2017-01-01

    A fully automated on-site device (SAMP-FIL) that enables water sampling with simultaneous filtration and effective cleaning procedures of the device's components was developed and field-tested. The SAMP-FIL was custom-built using commercially available components and was controlled by a RaspberryPi single-board computer operating open-source software. SAMP-FIL was designed for sample pre-treatment with minimal sample alteration to meet the requirements of on-site measurement devices that cannot handle coarse suspended solids within the measurement procedure or cycle. A highly effective cleaning procedure provides a fresh and minimally altered sample for the connected measurement device. The construction and programmed software facilitates the use of SAMP-FIL for different connected measurement devices. The SAMP-FIL sample pretreatment was tested for over one year for rapid and on-site enzymatic activity (beta-d-glucuronidase, GLUC) determination (BACTcontrol) in sediment-laden stream water. The formerly used proprietary sampling set-up was assumed to lead to significant damping of the measurement signal due to its susceptibility to clogging, debris accumulation and bio-film accumulation. The implementation of SAMP-FIL considerably increased the error-free running time and measurement accuracy of BACTcontrol devices. This paper describes how low-cost microcomputers, such as the RaspberryPi, can be used by operators to substantially improve established measuring systems via effective sampling devices. Furthermore, the results of this study highlight the importance of adequate sample pretreatment for the quality of on-site measurements. Copyright © 2016 The Authors. Published by Elsevier B.V. All rights reserved.

  20. Automated online measurement of N2, N2O, NO, CO2, and CH4 emissions based on a gas-flow-soil-core technique.

    Science.gov (United States)

    Liao, Tingting; Wang, Rui; Zheng, Xunhua; Sun, Yang; Butterbach-Bahl, Klaus; Chen, Nuo

    2013-11-01

    The gas-flow-soil-core (GFSC) technique allows to directly measure emission rates of denitrification gases of incubated soil cores. However, the technique was still suffering some drawbacks such as inadequate accuracy due to asynchronous detection of dinitrogen (N2) and other gases and low measurement frequency. Furthermore, its application was limited due to intensive manual operation. To overcome these drawbacks, we updated the GFSC system as described by Wang et al. (2011) by (a) using both a chemiluminescent detector and a gas chromatograph detector to measure nitric oxide (NO), (b) synchronizing the measurements of N2, NO, nitrous oxide (N2O), carbon dioxide (CO2) and methane (CH4), and (c) fully automating the sampling/analysis of all the gases. These technical modifications significantly reduced labor demands by at least a factor of two, increased the measurement frequency from 3 to 6 times per day and resulted in remarkable improvements in measurement accuracy (with detection limits of 0.5, 0.01, 0.05, 2.3 and 0.2μgN or Ch(-1)kg(-1)ds, or 17, 0.3, 1.8, 82, and 6μgN or Cm(-2)h(-1), for N2, N2O, NO, CO2, and CH4, respectively). In some circumstances, the modified system measured significantly more N2 and CO2 and less N2O and NO because of the enhanced measurement frequency. The modified system distinguished the differences in emissions of the denitrification gases and CO2 due to a 20% change in initial carbon supplies. It also remarkably recovered approximately 90% of consumed nitrate during incubation. These performances validate the technical improvement, and indicate that the improved GFSC system may provide a powerful research tool for obtaining deeper insights into the processes of soil carbon and nitrogen transformation during denitrification. Copyright © 2013. Published by Elsevier Ltd.

  1. Effect of water chemistry on flow accelerated corrosion rate of carbon steel measured by on-line corrosion-monitoring system

    International Nuclear Information System (INIS)

    Fujiwara, K.; Domae, M.; Yoneda, K.; Inada, F.

    2010-01-01

    Flow Accelerated Corrosion (FAC) of carbon steel is one of the most important subjects in coolant systems of power plants. FAC is influenced by material, flow condition, temperature, and water chemistry. Iron and chromium solubility should be the most effective factor to determine the effect of water chemistry on the FAC. It is very important to evaluate the correlation between the solubility and the FAC rate of the carbon steel. In the present study, the effects of pH and Cr concentration of material on the FAC rate of carbon steel were evaluated by using high temperature loop equipment with on-line corrosion-monitoring system. Effect of dissolved oxygen concentration at pH 7 was also evaluated. The experimental FAC rates were compared with the calculation result, which was obtained from a FAC model developed previously by the authors' group. The tube specimens made of STPT 480 carbon steel were used for the FAC tests. The Cr concentration of STPT 480 was specially adjusted to 0.001 and 0.08 %. The inner diameters of the tubes were 1.6, 2.4, and 3.2 mm. The solutions were fed to the specimens with the flow rate of 1.5 l/min. The temperature of the solution at the specimen was controlled at 140 o C. Test solutions were demineralized water or NH 3 solutions of pH 8.0, 9.2, and 10.0. The increase in pH more than 9 decreased the FAC rates of both 0.001 and 0.08 % Cr specimens at 140 o C. Increase of the Cr concentration of the material decreased the FAC rate in the solution of pH 7.0, 8.0, 9.2, and 10.0. The FAC model reproduced well dependence of the experimental FAC behavior on water chemistry. It was confirmed that effect of pH and Cr concentration of material on the FAC rate were closely related to the solubility and diffusion of iron and chromium. (author)

  2. Observation of online communities

    DEFF Research Database (Denmark)

    Nørskov, Sladjana V.; Rask, Morten

    2011-01-01

    This paper addresses the application of observation to online settings with a special focus on observer roles. It draws on a study of online observation of a virtual community, i.e. an open source software (OSS) community. The paper examines general and specific advantages and disadvantages...... of the observer roles in online settings by relating these roles to the same roles assumed in offline settings. The study suggests that under the right circumstances online and offline observation may benefit from being combined as they complement each other well. Quality issues and factors important to elicit...... trustworthy observational data from online study settings, such as OSS communities, are discussed. A proposition is made concerning how threats to credibility and transferability in relation to online observation (i.e. lack of richness and detail, risk of misunderstandings) can be diminished, while...

  3. Measurement

    NARCIS (Netherlands)

    Boumans, M.; Durlauf, S.N.; Blume, L.E.

    2008-01-01

    Measurement theory takes measurement as the assignment of numbers to properties of an empirical system so that a homomorphism between the system and a numerical system is established. To avoid operationalism, two approaches can be distinguished. In the axiomatic approach it is asserted that if the

  4. Calculation of activity concentration and dose rates from online radioactivity measurement in primary coolant channel of TAPS-III and IV

    International Nuclear Information System (INIS)

    Chaudhury, Sanhita; Agarwal, Chhavi; Goswami, A.; Mhatre, Amol; Chaturvedi, T.P.; Tawde, N.; Gathibandhe, Manohar; Dash, S.C.

    2011-05-01

    Radioactivity measurement using CdZnTe detector and dose measurement using teletector were done at several locations of primary heat transport (PHT) system of the Tarapur Atomic Power Station-III and IV reactor during shut down as well as operating condition of the reactors. The detector efficiency for the required counting geometry was simulated using MCNP code. Using this simulated efficiency and the experimental count rate (cps), the activity concentrations (Bq/mL) of different radionuclides in coolant water were calculated. The dose rates for the counted locations were also simulated using Monte Carlo code and it matched well with the experimentally obtained dose rate. (author)

  5. An algorithm for online optimization of accelerators

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Xiaobiao [SLAC National Accelerator Lab., Menlo Park, CA (United States); Corbett, Jeff [SLAC National Accelerator Lab., Menlo Park, CA (United States); Safranek, James [SLAC National Accelerator Lab., Menlo Park, CA (United States); Wu, Juhao [SLAC National Accelerator Lab., Menlo Park, CA (United States)

    2013-10-01

    We developed a general algorithm for online optimization of accelerator performance, i.e., online tuning, using the performance measure as the objective function. This method, named robust conjugate direction search (RCDS), combines the conjugate direction set approach of Powell's method with a robust line optimizer which considers the random noise in bracketing the minimum and uses parabolic fit of data points that uniformly sample the bracketed zone. Moreover, it is much more robust against noise than traditional algorithms and is therefore suitable for online application. Simulation and experimental studies have been carried out to demonstrate the strength of the new algorithm.

  6. Online Shopping Woes

    Institute of Scientific and Technical Information of China (English)

    Hou Weili

    2011-01-01

    AS a frequent online shopper,Zhou Fangjie,a 28-year-old white-collar worker,was annoyed when she could not open Hanyidushe,an online shop selling Korean-style clothing on Taobao Mall.Her experience resulted from the online protest initiated by small vendors on Taobao Mall,China's largest business to consumer online platform.Thousands of small vendors started the protest against larger established vendors by discrediting them through False orders,forming an anti-Taobao Union and setting up a chat room to devise ways to disrupt operations on Taobao Mall.

  7. Online shopping hesitation.

    Science.gov (United States)

    Cho, Chang-Hoan; Kang, Jaewon; Cheon, Hongsik John

    2006-06-01

    This study was designed to understand which factors influence consumer hesitation or delay in online product purchases. The study examined four groups of variables (i.e., consumer characteristics, contextual factors perceived uncertainty factors, and medium/channel innovation factors) that predict three types of online shopping hesitation (i.e., overall hesitation, shopping cart abandonment, and hesitation at the final payment stage). We found that different sets of delay factors are related to different aspects of online shopping hesitation. The study concludes with suggestion for various delay-reduction devices to help consumers close their online decision hesitation.

  8. Optimization of on-line hydrogen stable isotope ratio measurements of halogen- and sulfur-bearing organic compounds using elemental analyzer-chromium/high-temperature conversion isotope ratio mass spectrometry (EA-Cr/HTC-IRMS).

    Science.gov (United States)

    Gehre, Matthias; Renpenning, Julian; Geilmann, Heike; Qi, Haiping; Coplen, Tyler B; Kümmel, Steffen; Ivdra, Natalija; Brand, Willi A; Schimmelmann, Arndt

    2017-03-30

    Accurate hydrogen isotopic analysis of halogen- and sulfur-bearing organics has not been possible with traditional high-temperature conversion (HTC) because the formation of hydrogen-bearing reaction products other than molecular hydrogen (H 2 ) is responsible for non-quantitative H 2 yields and possible hydrogen isotopic fractionation. Our previously introduced, new chromium-based EA-Cr/HTC-IRMS (Elemental Analyzer-Chromium/High-Temperature Conversion Isotope Ratio Mass Spectrometry) technique focused primarily on nitrogen-bearing compounds. Several technical and analytical issues concerning halogen- and sulfur-bearing samples, however, remained unresolved and required further refinement of the reactor systems. The EA-Cr/HTC reactor was substantially modified for the conversion of halogen- and sulfur-bearing samples. The performance of the novel conversion setup for solid and liquid samples was monitored and optimized using a simultaneously operating dual-detection system of IRMS and ion trap MS. The method with several variants in the reactor, including the addition of manganese metal chips, was evaluated in three laboratories using EA-Cr/HTC-IRMS (on-line method) and compared with traditional uranium-reduction-based conversion combined with manual dual-inlet IRMS analysis (off-line method) in one laboratory. The modified EA-Cr/HTC reactor setup showed an overall H 2 -recovery of more than 96% for all halogen- and sulfur-bearing organic compounds. All results were successfully normalized via two-point calibration with VSMOW-SLAP reference waters. Precise and accurate hydrogen isotopic analysis was achieved for a variety of organics containing F-, Cl-, Br-, I-, and S-bearing heteroelements. The robust nature of the on-line EA-Cr/HTC technique was demonstrated by a series of 196 consecutive measurements with a single reactor filling. The optimized EA-Cr/HTC reactor design can be implemented in existing analytical equipment using commercially available material and

  9. SOCIAL INTEGRATION: TESTING ANTECEDENTS OF TIME SPENT ONLINE

    Directory of Open Access Journals (Sweden)

    Lily Suriani Mohd Arif

    2013-07-01

    Full Text Available The literature on the relationship of social integration and time spent onlineprovides conflicting evidence of the relationship of social integration with timespent online. The study identifies and highlightsthe controversy and attempts toclarify the relationship of social integration withtime spent online bydecomposing the construct social integration into its affective and behavioraldimensions . Thestudy tests antecedents and effects of time spent online in arandom sample of senior level undergraduate students at a public university inMalaysia. The findings indicated that while self-report measures of behavioralsocial integration did not predict time spent online, and, the affective socialintegration had an inverse relationship with time spent online.

  10. The impact of reliable pre-bolus T1 measurements or a fixed T1 value in the assessment of glioma patients with Dynamic Contrast Enhancing MRI

    DEFF Research Database (Denmark)

    Tietze, Anna; Mouridsen, Kim; Mikkelsen, Irene Klærke

    2015-01-01

    ) investigate if accurate estimation of DCE parameters outperform a time-saving approach with a pre-defined T1 value when differentiating high- from low-grade gliomas. Methods: (i) The accuracy and precision of T1 measurements, acquired by VFA and SR was investigated by computer simulations and in glioma...... to differentiate tumor grade. Results: The T1 values obtained by VFA showed larger variation compared to those obtained using SR both in the digital phantom and the human data (p > 0.05). Although a fixed T1 introduced a bias into the DCE calculation, this had only minor impact on the accuracy differentiating high......-quantitative DCE values, based on pre-defined T1 values, were sufficient to perform tumor grading in our study....

  11. Development of a minicomputer system for on-line processing of gamma--gamma coincidence events and measurements of E2/M1 mixing ratios in 110Cd and 134Ba

    International Nuclear Information System (INIS)

    Ruhter, W.D.

    1977-12-01

    A megachannel pulse-height analysis system using a 32,000-word PDP-8/E minicomputer and two moving-head disk memories was developed. The system has a storage capacity of 2 18 events at any of 2 20 data locations, is capable of processing 1,040 events/s, and provides on-line sorting and disk storage. An X- or Y- pulse-height spectrum in coincidence with one to four arithmetically combined pulse-height windows can be assembled in core for scope display and spectral analysis within 2 to 20 seconds. The software for the system was written extensively in machine language. Excellent energy and timing resolution were achieved. An energy resolution of 2.3 keV fwhm and a timing resolution of 8.5 ns fwhm were obtained for 60 Co at a singles rate of 10,000 counts/s. The prompt timing peak remained Gaussian down to the fwtm by gating the TAC with SCAs which discriminated against low-energy events. The coincidence electronics also allowed on-line subtraction of accidental coincidence events. Alignment of the detectors and tests of the system's performance were made by measuring solid-angle correction factors for the Ge(Li) detectors through the correlation measurements of the 0 + --2 + --0 + cascade in 106 Pd, and by measuring the angular spread of positron annihilation radiation coincidences. Results were in excellent agreement with theoretical solid-angle correction factors calculated for the detector and source sizes used. Directional correlation data were obtained for gamma-ray cascades in 134 Ba and 110 Cd. Analyses of these data gave E2/M1 mixing ratios which are in excellent agreement with results obtained by other investigators. The improved resolution and data processing capabilities of this system gave new results for the 563-keV transition in 134 Ba and the 1505-keV transition in 110 Cd. E2/M1 mixing ratios of 13.3/sup +2.3/sub -1.8/ for the 563-keV transition and -1.24 +- 0.20 for the 1505-keV transition were measured

  12. The Leipzig Ice Nucleation chamber Comparison (LINC): An overview of ice nucleation measurements observed with four on-line ice nucleation devices

    Science.gov (United States)

    Kohn, Monika; Wex, Heike; Grawe, Sarah; Hartmann, Susan; Hellner, Lisa; Herenz, Paul; Welti, André; Stratmann, Frank; Lohmann, Ulrike; Kanji, Zamin A.

    2016-04-01

    Mixed-phase clouds (MPCs) are found to be the most relevant cloud type leading to precipitation in mid-latitudes. The formation of ice crystals in MPCs is not completely understood. To estimate the effect of aerosol particles on the radiative properties of clouds and to describe ice nucleation in models, the specific properties of aerosol particles acting as ice nucleating particles (INPs) still need to be identified. A number of devices are able to measure INPs in the lab and in the field. However, methods can be very different and need to be tested under controlled conditions with respect to aerosol generation and properties in order to standardize measurement and data analysis approaches for subsequent ambient measurements. Here, we present an overview of the LINC campaign hosted at TROPOS in September 2015. We compare four ice nucleation devices: PINC (Portable Ice Nucleation Chamber, Chou et al., 2011) and SPIN (SPectrometer for Ice Nuclei) are operated in deposition nucleation and condensation freezing mode. LACIS (Leipzig Aerosol Cloud Interaction Simulator, Hartmann et al., 2011) and PIMCA (Portable Immersion Mode Cooling chamber) measure in the immersion freezing mode. PIMCA is used as a vertical extension to PINC and allows activation and droplet growth prior to exposure to the investigated ice nucleation temperature. Size-resolved measurements of multiple aerosol types were performed including pure mineral dust (K-feldspar, kaolinite) and biological particles (Birch pollen washing waters) as well as some of them after treatment with sulfuric or nitric acid prior to experiments. LACIS and PIMCA-PINC operated in the immersion freezing mode showed very good agreement in the measured frozen fraction (FF). For the comparison between PINC and SPIN, which were scanning relative humidity from below to above water vapor saturation, an agreement was found for the obtained INP concentration. However, some differences were observed, which may result from ice

  13. On-line slurry viscosity and concentration measurement as a real-time waste stream characterization tool. 1997 annual progress report

    International Nuclear Information System (INIS)

    Powell, R.L.

    1997-01-01

    'The main scope of this work is to: (1) develop a novel tomographic ultrasonic technique to obtain the real-time distribution of acoustic velocity and flow velocity; (2) use nuclear magnetic resonance imaging (NMRI) to measure velocity profiles and rheological properties of complex fluids and suspensions; (3) establish a facility for making laser Doppler velocimetry (LDV) measurements that can be The overall goal is to obtain real-time rheology and solids concentration within a solid-liquid suspension flowing in a pipeline. To nondestructively obtain the rheology of the fluid flowing in a pipe, accurate measurement of local shear rate distribution is required. This objective was met by using two real-time tomographic techniques: an ultrasonic Doppler velocimetry system and an NMRI system. The first method combines the existing state-of-the-art ultrasonic velocimetry technology base with a novel tomographic concept to non-intrusively obtain high resolution acoustic and flow velocity profile at a section of the flow field. The acoustic velocity profile provides a means of improving the flow velocity measurement accuracy. These data are also, used to yield the profile of solids concentration. In addition, the volumetric flow rate was determined from integration of the velocity profile. From the knowledge of the concentration profile the mass flow rate can also be determined, Similar work was undertaken for the NMNRI system. In this case, single phase Newtonian fluids have been used to model complex rheological behavior. Finally, a LDV system has been purchased and set - up in the laboratory at UC Davis.'

  14. THE AGGREGATE IMPACT OF ONLINE RETAIL

    OpenAIRE

    Allen Tran

    2014-01-01

    To study the impact of online retail on aggregate welfare, I use a spatial model to calculate a new measure of store level retail productivity and each store's equilibrium response to increased competitive pressure from online retailers. The model is estimated on confidential store-level data spanning the universe of US retail stores, detailed local-level demographic data and shortest-route data between locations. From counterfactual exercises mimicking improvements in shipping and increased ...

  15. Online analysis by a fiber-optic diode array spectrophotometer

    International Nuclear Information System (INIS)

    Van Hare, D.R.; Prather, W.S.; O'Rourke, P.E.

    1987-01-01

    An online photometric analyzer has been developed which can make remote measurements over the 350 to 900 nm region at distances of up to 100 feet. The analyzer consists of a commercially available diode array spectrophotometer interfaced to a fiber-optic multiplexer to allow online monitoring of up to ten locations sequentially. The development of the fiber-optic interface is discussed and data from several online applications are presented to demonstrate the capabilities of the measurement system

  16. On-line measurement of 13C/12C and 15N/14N ratios by E/A-diluter-IRMS

    International Nuclear Information System (INIS)

    Foerstel, H.; Boner, M.; Prast, H.

    2001-01-01

    Efficient food control requires rapid procedures for testing source authenticity. Food is produced inside a closed 'isotopic environment' from where it inherits a specific isotopic composition or fingerprint. Isotope ratio mass spectrometry (IRMS) measures isotopic compositions using simple gases like CO 2 or N 2 exclusively. From food samples these gases may be produced by combustion in a commercial CHN analyser (Elemental Analyser, EA). Following GC separation of the combustion gases the elemental content is determined using a thermal conductivity detector (TCD) . The effluent of the EA is coupled to the mass spectrometer via an open split. Because the relative amounts of the bio-elements vary significantly, (often C/N is 25/1 or larger), the amount of analyte gas produced from a single sample must be adjusted e.g. using a diluter. Our diluter configuration can be adjusted to measure repeatedly the 13 C/ 12 C ratio of carbon dioxide in mineral waters, as well as to measure 15 N/ 14 N and 13 C/ 12 C ratios from biological or soil samples simultaneously. In the first application different types of carbon dioxide, produced naturally (well) or technically (process), can be distinguished. The second application offers the possibility to trace the fate of a fertilizer in vineyards by determining the isotopic variation of nitrogen and carbon in soil and vines. (author)

  17. Consumers' Online Brand Endorsements

    NARCIS (Netherlands)

    Bernritter, S.F.; Verlegh, P.W.J.; Smit, E.G.; De Pelsmacker, P.

    2016-01-01

    Purpose and Approach This Chapter has three central goals: First, it aims to introduce the concept of consumers’ online brand endorsements, which we define as consumers’ intentional, public, and positive online affiliations with brands (e.g., liking a brand page on Facebook). Second, it provides an

  18. Framework for online teaching

    DEFF Research Database (Denmark)

    Strobel, Bjarne W.

    2014-01-01

    The following framework for online teaching is a guidance to inspire you on how to to use e-learning in your teaching. Maybe you want to make a whole online course (distance learning) or maybe you want to use e-learning as a part of a course (blended learning). If you want to go further or have...

  19. African Journals Online: Guernsey

    African Journals Online (AJOL)

    African Journals Online: Guernsey. Home > African Journals Online: Guernsey. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Browse By Category · Browse Alphabetically · Browse By Country · List All Titles · Free to read Titles This Journal is Open Access ...

  20. African Journals Online: Grenada

    African Journals Online (AJOL)

    African Journals Online: Grenada. Home > African Journals Online: Grenada. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Browse By Category · Browse Alphabetically · Browse By Country · List All Titles · Free to read Titles This Journal is Open Access ...

  1. African Journals Online: India

    African Journals Online (AJOL)

    African Journals Online: India. Home > African Journals Online: India. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Browse By Category · Browse Alphabetically · Browse By Country · List All Titles · Free to read Titles This Journal is Open Access. Afghanistan ...

  2. African Journals Online: Barbados

    African Journals Online (AJOL)

    African Journals Online: Barbados. Home > African Journals Online: Barbados. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Browse By Category · Browse Alphabetically · Browse By Country · List All Titles · Free to read Titles This Journal is Open Access ...

  3. African Journals Online: Malta

    African Journals Online (AJOL)

    African Journals Online: Malta. Home > African Journals Online: Malta. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Browse By Category · Browse Alphabetically · Browse By Country · List All Titles · Free to read Titles This Journal is Open Access. Afghanistan ...

  4. African Journals Online: Bahamas

    African Journals Online (AJOL)

    African Journals Online: Bahamas. Home > African Journals Online: Bahamas. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Browse By Category · Browse Alphabetically · Browse By Country · List All Titles · Free to read Titles This Journal is Open Access ...

  5. African Journals Online: Liechtenstein

    African Journals Online (AJOL)

    African Journals Online: Liechtenstein. Home > African Journals Online: Liechtenstein. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Browse By Category · Browse Alphabetically · Browse By Country · List All Titles · Free to read Titles This Journal is Open Access ...

  6. African Journals Online: Vanuatu

    African Journals Online (AJOL)

    African Journals Online: Vanuatu. Home > African Journals Online: Vanuatu. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Browse By Category · Browse Alphabetically · Browse By Country · List All Titles · Free to read Titles This Journal is Open Access ...

  7. The online Self

    NARCIS (Netherlands)

    Gloerich, I.; van Dipten, L.; Rasch, M.D.

    2017-01-01

    Following the conference Fear and Loathing of the Online Self and the publication of Culture of the Selfie: Self-Representation in Contemporary Visual Culture in May 2017, this episode of INC’s Zero Infinite podcast zooms in on the online self and selfies, with Ana Peraica, Wendy Chun and Rebecca

  8. Online consumer contracts

    NARCIS (Netherlands)

    Luzak, J.

    2014-01-01

    The new Consumer Rights Directive introduced some changes to the level of consumers’ protection online. However, just like with its predecessor, the Distance Selling Directive, the main focus of the protection that consumers have been granted online is to provide them with transparent and salient

  9. Online Fællesskaber

    DEFF Research Database (Denmark)

    Gotved, Stine

    2017-01-01

    Online fællesskaber er en organiseringsform på internettet, der har mange variationer (kaldes også netfællesskab, online community og virtual community). Grundlæggende handler det om menneskeligt samvær og kommunikation om et fælles formål gennem computerens mediering....

  10. Quality online personalisation

    NARCIS (Netherlands)

    T. Li (Ting); T. Unger (Till)

    2012-01-01

    textabstractWhen done right, personalisation online can be an effective way to enhance the buying or consuming experience, thus stimulating purchasing. However, it can also rely heavily on customers’ private details, a very sensitive and currently hot issue. So, how do online marketeers deal

  11. Problem Based Learning Online

    DEFF Research Database (Denmark)

    Kolbæk, Ditte

    2018-01-01

    “How do two online learning designs affect student engagement in the PBL online modules?” The empirical data were collected and analyzed using a netnographic approach. The study finds that concepts such as self-directed learning and active involvement may be perceived very differently from the students...

  12. African Journals Online: Aruba

    African Journals Online (AJOL)

    African Journals Online: Aruba. Home > African Journals Online: Aruba. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Browse By Category · Browse Alphabetically · Browse By Country · List All Titles · Free to read Titles This Journal is Open Access. Afghanistan ...

  13. African Journals Online: Kazakhstan

    African Journals Online (AJOL)

    African Journals Online: Kazakhstan. Home > African Journals Online: Kazakhstan. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Browse By Category · Browse Alphabetically · Browse By Country · List All Titles · Free to read Titles This Journal is Open Access ...

  14. African Journals Online: Switzerland

    African Journals Online (AJOL)

    African Journals Online: Switzerland. Home > African Journals Online: Switzerland. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Browse By Category · Browse Alphabetically · Browse By Country · List All Titles · Free to read Titles This Journal is Open Access ...

  15. African Journals Online: Andorra

    African Journals Online (AJOL)

    African Journals Online: Andorra. Home > African Journals Online: Andorra. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Browse By Category · Browse Alphabetically · Browse By Country · List All Titles · Free to read Titles This Journal is Open Access ...

  16. African Journals Online: Ireland

    African Journals Online (AJOL)

    African Journals Online: Ireland. Home > African Journals Online: Ireland. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Browse By Category · Browse Alphabetically · Browse By Country · List All Titles · Free to read Titles This Journal is Open Access. Afghanistan ...

  17. African Journals Online: Belgium

    African Journals Online (AJOL)

    African Journals Online: Belgium. Home > African Journals Online: Belgium. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Browse By Category · Browse Alphabetically · Browse By Country · List All Titles · Free to read Titles This Journal is Open Access ...

  18. The Online Catalog Revolution.

    Science.gov (United States)

    Kilgour, Frederick G.

    1984-01-01

    A review of library technological development and card catalog innovations of the past century and a half precedes a discussion of online public access catalog development. Design requirements and purpose of the online catalog, access techniques and provisions, costs, and future integration are highlighted. Twenty-two references are listed. (EJS)

  19. OnlineMin

    DEFF Research Database (Denmark)

    Brodal, Gerth Stølting; Moruz, Gabriel; Negoescu, Andrei

    2015-01-01

    OnlineMin that has optimal competitiveness and allows fast implementations. In fact, if k pages fit in internal memory the best previous solution required O(k2) time per request and O(k) space. We present two implementations of OnlineMin which use O(k) space, but only O(logk) worst case time and O...

  20. StuDIY Online

    DEFF Research Database (Denmark)

    2015-01-01

    StuDIY Online er kurser i akademisk argumentation, problemformulering, analyse og akademisk sprog. Kurserne er frit tilgængelige for alle via Blackboard på AU......StuDIY Online er kurser i akademisk argumentation, problemformulering, analyse og akademisk sprog. Kurserne er frit tilgængelige for alle via Blackboard på AU...

  1. An Architecture for On-Line Measurement of the Tip Clearance and Time of Arrival of a Bladed Disk of an Aircraft Engine

    Directory of Open Access Journals (Sweden)

    José Miguel Gil-García

    2017-09-01

    Full Text Available Safety and performance of the turbo-engine in an aircraft is directly affected by the health of its blades. In recent years, several improvements to the sensors have taken place to monitor the blades in a non-intrusive way. The parameters that are usually measured are the distance between the blade tip and the casing, and the passing time at a given point. Simultaneously, several techniques have been developed that allow for the inference—from those parameters and under certain conditions—of the amplitude and frequency of the blade vibration. These measurements are carried out on engines set on a rig, before being installed in an airplane. In order to incorporate these methods during the regular operation of the engine, signal processing that allows for the monitoring of those parameters at all times should be developed. This article introduces an architecture, based on a trifurcated optic sensor and a hardware processor, that fulfills this need. The proposed architecture is scalable and allows several sensors to be simultaneously monitored at different points around a bladed disk. Furthermore, the results obtained by the electronic system will be compared with the results obtained by the validation of the optic sensor.

  2. Complementary online aerosol mass spectrometry and offline FT-IR spectroscopy measurements: Prospects and challenges for the analysis of anthropogenic aerosol particle emissions

    Science.gov (United States)

    Faber, Peter; Drewnick, Frank; Bierl, Reinhard; Borrmann, Stephan

    2017-10-01

    The aerosol mass spectrometer (AMS) is well established in investigating highly time-resolved dynamics of submicron aerosol chemical composition including organic aerosol (OA). However, interpretation of mass spectra on molecular level is limited due to strong fragmentation of organic substances and potential reactions inside the AMS ion chamber. Results from complementary filter-based FT-IR absorption measurements were used to explain features in high-resolution AMS mass spectra of different types of OA (e.g. cooking OA, cigarette smoking OA, wood burning OA). Using this approach some AMS fragment ions were validated in this study as appropriate and rather specific markers for a certain class of organic compounds for all particle types under investigation. These markers can therefore be used to get deeper insights in the chemical composition of OA based on AMS mass spectra in upcoming studies. However, the specificity of other fragment ions such as C2H4O2+ (m/z 60.02114) remains ambiguous. In such cases, complementary FT-IR measurements allow the interpretation of highly time-resolved AMS mass spectra at the level of molecular functional groups. Furthermore, this study discusses the challenges in reducing inorganic interferences (e.g. from water and ammonium salts) in FT-IR spectra of atmospheric aerosols to decrease spectral uncertainties for better comparisons and, thus, to get more robust results.

  3. On-line, in-core measurement of the thermal conductivity of a BWR fuel rod with a tenacious crud deposit

    International Nuclear Information System (INIS)

    Bennett, Peter

    2012-09-01

    Several corrosion-related fuel failures in US BWRs have been reported where the failed rods had thick, tenacious crud deposits, including events at River Bend and Browns Ferry. Although investigations did not identify the root cause of these failures, it was noted that there was an industry perception that the level of crud on the fuel in a number of plants - including Browns Ferry - particularly those using NMCA, zinc and moderate to high Fe, was too high from a fuel performance perspective. The exact role of the crud was unknown, but there was a suspicion that some unknown water chemistry condition was responsible for the failures at Browns Ferry. Fuel failures have also occurred in Limerick-1, Cycle 2 and in Vermont Yankee, although the direct role of crud in these cases was not clear. While laboratory measurements have shown that the thermal conductivities of the species comprising the crud are not lower than that of ZrO 2 , the effect of the crud in impeding heat transfer has been implicated in the failure mechanisms. It is believed that steam blanketing (formation of a layer of steam between the rod surface and the crud) may be the cause of failure. Hence, to determine whether crud deposits impede heat transfer and thus cause or contribute to rod failure, it is necessary to measure their thermal conductivity during power operation under representative thermal-hydraulic and water chemistry conditions. The purpose of this test, conducted in the Halden Reactor, was to measure the heat transfer through BWR crud at power. Two test rods were manufactured from segments of a fuel rod irradiated in a commercial BWR to a burn-up of 41 GWd/MTU; one test rod had a thin crud layer (< 5 μm) while the other had a thick layer (> 25 μm). The rods were irradiated under representative thermal-hydraulic and water chemistry conditions (25 kW/m, 275 deg. C, outlet void fraction 4 per cent, 300 - 400 ppb H 2 ). Each rod was instrumented with a cladding elongation detector, and

  4. Interpersonal dependency and online gaming addiction.

    Science.gov (United States)

    Škařupová, Kateřina; Blinka, Lukas

    2016-03-01

    Background and aims The present study explores the relationship between social motivations and addiction to online gaming and if that possible connection can be explained by the personality traits responsible for social functioning. Methods We employ Bernstein's concept of interpersonal dependency to distinguish healthy dependency, dysfunctional detachment, and destructive overdependence, and Charlton and Danforth's conceptualisation of online gaming addiction and high engagement. An online questionnaire was administered to a self-nominated sample of 4,074 online gamers. Two regression models were constructed to separately explain gaming addiction and high engagement using social motivations to play, while controlling for age, gender, and time spent online. Results High scores on subscales measuring dysfunctional detachment and destructive overdependence were positively associated with online gaming addiction, while healthy dependency was negatively correlated with addiction scores. In contrast, the overall role of social motivation was negligible. Discussion People with healthy relationship profiles are less likely to develop problematic patterns of online gaming. High in-game engagement, although sharing some factors with addiction, was only poorly explained by the study variables, suggesting the mutual exclusiveness of addiction and engagement.

  5. Dental students' perceptions of an online learning.

    Science.gov (United States)

    Asiry, Moshabab A

    2017-10-01

    To identify the readiness of students for online learning, to investigate their preference and perception, and to measure the quality of online tutorials. A 14-statement questionnaire was administered to fourth year undergraduate dental students in male campus at King Saud University who completed preclinical orthodontic course. The students responded to each statement by using Likert scale. The results reveal a high agreement of students (27.8-31.5% agree and 38.9-50% strongly agree) on a possession of necessary computer skills and access to internet. 59.2% and 64.8% of the students replied that online flash lectures and procedural videos were helpful to their learning, respectively. With respect to students' learning preferences, few students preferred online flash lectures (31.5%) and procedural videos (17.1%). Most students (38.9% agree and 31.5% strongly agree) preferred a combination of traditional teaching methods and online learning. Overall, student attitudes were positive regarding online learning. The students viewed online learning helpful as a supplement to their learning rather than a replacement for traditional teaching methods.

  6. Interpersonal dependency and online gaming addiction

    Science.gov (United States)

    Škařupová, Kateřina; Blinka, Lukas

    2016-01-01

    Background and aims The present study explores the relationship between social motivations and addiction to online gaming and if that possible connection can be explained by the personality traits responsible for social functioning. Methods We employ Bernstein’s concept of interpersonal dependency to distinguish healthy dependency, dysfunctional detachment, and destructive overdependence, and Charlton and Danforth’s conceptualisation of online gaming addiction and high engagement. An online questionnaire was administered to a self-nominated sample of 4,074 online gamers. Two regression models were constructed to separately explain gaming addiction and high engagement using social motivations to play, while controlling for age, gender, and time spent online. Results High scores on subscales measuring dysfunctional detachment and destructive overdependence were positively associated with online gaming addiction, while healthy dependency was negatively correlated with addiction scores. In contrast, the overall role of social motivation was negligible. Discussion People with healthy relationship profiles are less likely to develop problematic patterns of online gaming. High in-game engagement, although sharing some factors with addiction, was only poorly explained by the study variables, suggesting the mutual exclusiveness of addiction and engagement. PMID:26690326

  7. Online Advertising in Social Networks

    Science.gov (United States)

    Bagherjeiran, Abraham; Bhatt, Rushi P.; Parekh, Rajesh; Chaoji, Vineet

    Online social networks offer opportunities to analyze user behavior and social connectivity and leverage resulting insights for effective online advertising. This chapter focuses on the role of social network information in online display advertising.

  8. Market research online; Datenbank Solaratlas: Marktforschung Online

    Energy Technology Data Exchange (ETDEWEB)

    Epp, B.

    2005-09-29

    The online database www.solaratlas.de provides data and facts on local sales, gross investments and local customers. More than 400,000 solar plants were evaluated for the statistics in order to provide experts with detailed market data. (orig.)

  9. Talking Online: Reflecting on Online Communication Tools

    Science.gov (United States)

    Greener, Susan

    2009-01-01

    Purpose: The purpose of this paper is to reflect on the value and constraints of varied online communication tools from web 2.0 to e-mail in a higher education (HE) teaching and learning context, where these tools are used to support or be the main focus of learning. Design/methodology/approach: A structured reflection is produced with the aid of…

  10. Online trapping and enrichment ultra performance liquid chromatography-tandem mass spectrometry method for sensitive measurement of 'arginine-asymmetric dimethylarginine cycle' biomarkers in human exhaled breath condensate

    Energy Technology Data Exchange (ETDEWEB)

    Di Gangi, Iole Maria, E-mail: giordano@pediatria.unipd.it [Chromatography and Mass Spectrometry Laboratory, Department of Women' s and Children' s Health, University of Padova (Italy); Pirillo, Paola [Chromatography and Mass Spectrometry Laboratory, Department of Women' s and Children' s Health, University of Padova (Italy); Carraro, Silvia [Unit of Allergy and Respiratory Diseases, Department of Women' s and Children' s Health, University of Padova (Italy); Gucciardi, Antonina; Naturale, Mauro [Chromatography and Mass Spectrometry Laboratory, Department of Women' s and Children' s Health, University of Padova (Italy); Baraldi, Eugenio [Unit of Allergy and Respiratory Diseases, Department of Women' s and Children' s Health, University of Padova (Italy); Giordano, Giuseppe [Chromatography and Mass Spectrometry Laboratory, Department of Women' s and Children' s Health, University of Padova (Italy)

    2012-11-19

    Highlights: Black-Right-Pointing-Pointer Simultaneous quantification of 'arginine-ADMA cycle' metabolites developed in EBC. Black-Right-Pointing-Pointer EBC is a non-invasive matrix highly useful in patients with respiratory diseases. Black-Right-Pointing-Pointer Method, fast, precise and accurate, is suitable in the pediatric clinical studies. Black-Right-Pointing-Pointer Sensitivity is increased using on-line trapping and enrichment-UPLC-MS/MS method. Black-Right-Pointing-Pointer EBC measurements in asthmatic adolescents confirm that ADMA is increased in asthma. - Abstract: Background: Exhaled breath condensate (EBC) is a biofluid collected non invasively that, enabling the measurement of several biomarkers, has proven useful in the study of airway inflammatory diseases, including asthma, COPD and cystic fibrosis. To the best of our knowledge, there is no previous report of any analytical method to detect ADMA in EBC. Objectives: Aim of this work was to develop an online sample trapping and enrichment system, coupled with an UPLC-MS/MS method, for simultaneous quantification of seven metabolites related to 'Arginine-ADMA cycle', using the isotopic dilution. Methods: Butylated EBC samples were trapped in an online cartridge, washed before and after each injection with cleanup solution to remove matrix components and switched inline into the high pressure analytical column. Multiple reaction monitoring in positive mode was used for analyte quantification by tandem mass spectrometry. Results: Validation studies were performed in EBC to examine accuracy, precision and robustness of the method. For each compound, the calibration curves showed a coefficient of correlation (r{sup 2}) greater than 0.992. Accuracy (%Bias) was <3% except for NMMA and H-Arg (<20%), intra- and inter-assay precision (expressed as CV%) were within {+-}20% and recovery ranged from 97.1 to 102.8% for all analytes. Inter-day variability analysis on 20 EBC of adult subjects did

  11. Health Professionals' Use of Online Information Retrieval Systems and Online Evidence.

    Science.gov (United States)

    Lialiou, Paschalina; Pavlopoulou, Ioanna; Mantas, John

    2016-01-01

    Across-sectional survey was designed to determine health professionals' awareness and usage of online evidence retrieval systems in clinical practice. A questionnaire was used to measure professionals' behavior and utilization of online evidences, as well as, reasons and barriers on information retrieval. 439 nurses and physicians from public and private hospitals in Greece formulate the study's sample. The two most common reasons that individuals are using online information systems were for writing scientific manuscripts or filling a knowledge gap. A positive correlation was found between participants with postgraduate studies and information system usage. The majority of them (90,6%) believe that online information systems improves patient care and 67,6% of them had their own experiences on this. More support is needed to nurses and physicians in order to use the online evidence and as a result to improve the provided care and practices.

  12. Measuring $\

    Energy Technology Data Exchange (ETDEWEB)

    Mitchell, Jessica Sarah [Univ. of Cambridge (United Kingdom)

    2011-01-01

    The MINOS Experiment consists of two steel-scintillator calorimeters, sampling the long baseline NuMI muon neutrino beam. It was designed to make a precise measurement of the ‘atmospheric’ neutrino mixing parameters, Δm2 atm. and sin2 (2 atm.). The Near Detector measures the initial spectrum of the neutrino beam 1km from the production target, and the Far Detector, at a distance of 735 km, measures the impact of oscillations in the neutrino energy spectrum. Work performed to validate the quality of the data collected by the Near Detector is presented as part of this thesis. This thesis primarily details the results of a vμ disappearance analysis, and presents a new sophisticated fitting software framework, which employs a maximum likelihood method to extract the best fit oscillation parameters. The software is entirely decoupled from the extrapolation procedure between the detectors, and is capable of fitting multiple event samples (defined by the selections applied) in parallel, and any combination of energy dependent and independent sources of systematic error. Two techniques to improve the sensitivity of the oscillation measurement were also developed. The inclusion of information on the energy resolution of the neutrino events results in a significant improvement in the allowed region for the oscillation parameters. The degree to which sin2 (2θ )= 1.0 could be disfavoured with the exposure of the current dataset if the true mixing angle was non-maximal, was also investigated, with an improved neutrino energy reconstruction for very low energy events. The best fit oscillation parameters, obtained by the fitting software and incorporating resolution information were: | Δm2| = 2.32+0.12 -0.08×10-3 eV2 and sin2 (2θ ) > 0.90(90% C.L.). The analysis provides the current world best measurement of the atmospheric neutrino mass

  13. Online Sellers’ Website Quality Influencing Online Buyers’ Purchase Intention

    Science.gov (United States)

    Shea Lee, Tan; Ariff, Mohd Shoki Md; Zakuan, Norhayati; Sulaiman, Zuraidah; Zameri Mat Saman, Muhamad

    2016-05-01

    The increase adoption of Internet among young users in Malaysia provides high prospect for online seller. Young users aged between 18 and 25 years old are important to online sellers because they are actively involved in online purchasing and this group of online buyers is expected to dominate future online market. Therefore, examining online sellers’ website quality and online buyers’ purchase intention is crucial. Based on the Theory of planned behavior (TPB), a conceptual model of online sellers’ website quality and purchase intention of online buyers was developed. E-tailQ instrument was adapted in this study which composed of website design, reliability/fulfillment, security, privacy & trust, and customer service. Using online questionnaire and convenience sampling procedure, primary data were obtained from 240 online buyers aged between 18 to 25 years old. It was discovered that website design, website reliability/fulfillment, website security, privacy & trust, and website customer service positively and significantly influence intention of online buyers to continuously purchase via online channels. This study concludes that online sellers’ website quality is important in predicting online buyers’ purchase intention. Recommendation and implication of this study were discussed focusing on how online sellers should improve their website quality to stay competitive in online business.

  14. Study and development of the laser induced breakdown spectroscopy (LIBS) for the realization of field measurements: application to analysis on-line of metals in liquids

    International Nuclear Information System (INIS)

    Rosado, J.C.D.

    2013-01-01

    Metal contamination of water is a major public health issue. Controls and treatments are more drastic and performed on them for human consumption. It is essential for this to possess reliable and sensitive analytical tools adapted to the existing regulations and flexible enough to use. The technique of 'Laser Induced Breakdown Spectroscopy' (LIBS), proven for the analysis of solids, including exo-terrestrial explorations, this very interesting advantages for liquids including, for example, are multi-character elementary and the possibility of in-situ measurements of water contamination by metals. A first part of this study thesis allowed to explore the potential (LIBS) for the analysis of dissolved metals or suspensions in water. Study has found an important effect related to the particle size in the analysis of suspensions. A second prong is to look at the effects of organic matrix represented by humic acid and those natural minerals represented by the bentonite and alumina particles. The matrix effect observed was corrected by normalization by internal standard. (author) [fr

  15. Web-based Factors Affecting Online Purchasing Behaviour

    Science.gov (United States)

    Ariff, Mohd Shoki Md; Sze Yan, Ng; Zakuan, Norhayati; Zaidi Bahari, Ahamad; Jusoh, Ahmad

    2013-06-01

    The growing use of internet and online purchasing among young consumers in Malaysia provides a huge prospect in e-commerce market, specifically for B2C segment. In this market, if E-marketers know the web-based factors affecting online buyers' behaviour, and the effect of these factors on behaviour of online consumers, then they can develop their marketing strategies to convert potential customers into active one, while retaining existing online customers. Review of previous studies related to the online purchasing behaviour in B2C market has point out that the conceptualization and empirical validation of the online purchasing behaviour of Information and Communication Technology (ICT) literate users, or ICT professional, in Malaysia has not been clearly addressed. This paper focuses on (i) web-based factors which online buyers (ICT professional) keep in mind while shopping online; and (ii) the effect of web-based factors on online purchasing behaviour. Based on the extensive literature review, a conceptual framework of 24 items of five factors was constructed to determine web-based factors affecting online purchasing behaviour of ICT professional. Analysis of data was performed based on the 310 questionnaires, which were collected using a stratified random sampling method, from ICT undergraduate students in a public university in Malaysia. The Exploratory factor analysis performed showed that five factors affecting online purchase behaviour are Information Quality, Fulfilment/Reliability/Customer Service, Website Design, Quick and Details, and Privacy/Security. The result of Multiple Regression Analysis indicated that Information Quality, Quick and Details, and Privacy/Security affect positively online purchase behaviour. The results provide a usable model for measuring web-based factors affecting buyers' online purchase behaviour in B2C market, as well as for online shopping companies to focus on the factors that will increase customers' online purchase.

  16. Web-based Factors Affecting Online Purchasing Behaviour

    International Nuclear Information System (INIS)

    Ariff, Mohd Shoki Md; Yan, Ng Sze; Zakuan, Norhayati; Bahari, Ahamad Zaidi; Jusoh, Ahmad

    2013-01-01

    The growing use of internet and online purchasing among young consumers in Malaysia provides a huge prospect in e-commerce market, specifically for B2C segment. In this market, if E-marketers know the web-based factors affecting online buyers' behaviour, and the effect of these factors on behaviour of online consumers, then they can develop their marketing strategies to convert potential customers into active one, while retaining existing online customers. Review of previous studies related to the online purchasing behaviour in B2C market has point out that the conceptualization and empirical validation of the online purchasing behaviour of Information and Communication Technology (ICT) literate users, or ICT professional, in Malaysia has not been clearly addressed. This paper focuses on (i) web-based factors which online buyers (ICT professional) keep in mind while shopping online; and (ii) the effect of web-based factors on online purchasing behaviour. Based on the extensive literature review, a conceptual framework of 24 items of five factors was constructed to determine web-based factors affecting online purchasing behaviour of ICT professional. Analysis of data was performed based on the 310 questionnaires, which were collected using a stratified random sampling method, from ICT undergraduate students in a public university in Malaysia. The Exploratory factor analysis performed showed that five factors affecting online purchase behaviour are Information Quality, Fulfilment/Reliability/Customer Service, Website Design, Quick and Details, and Privacy/Security. The result of Multiple Regression Analysis indicated that Information Quality, Quick and Details, and Privacy/Security affect positively online purchase behaviour. The results provide a usable model for measuring web-based factors affecting buyers' online purchase behaviour in B2C market, as well as for online shopping companies to focus on the factors that will increase customers' online purchase.

  17. Dual-lifetime referencing (DLR: a powerful method for on-line measurement of internal pH in carrier-bound immobilized biocatalysts

    Directory of Open Access Journals (Sweden)

    Boniello Caterina

    2012-03-01

    conditions of continuous measurement. During hydrolysis of cephalosporin C by the immobilizate in a stirred reactor with bulk pH maintained at 8.0, the intraparticle pH dropped initially by about 1 pH unit and gradually returned to the bulk pH, reflecting the depletion of substrate from solution. These results support measurement of intraparticle pH as a potential analytical processing tool for proton-forming/consuming biotransformations catalyzed by carrier-bound immobilized enzymes. Conclusions Fluorescein and Ru(dpp constitute a useful pair of luminophores in by DLR-based intraparticle pH monitoring. The pH range accessible by the chosen DLR system overlaps favorably with the pH ranges at which enzymes are optimally active and stable. DLR removes the restriction of working with static immobilized enzyme particles, enabling suspensions of particles to be characterized also. The pH gradient developed between particle and bulk liquid during reaction steady state is an important carrier selection parameter for enzyme immobilization and optimization of biocatalytic conversion processes. Determination of this parameter was rendered possible by the presented DLR method.

  18. Online Friendship, Romance, and Sex: Properties and Associations of the Online Relationship Initiation Scale.

    Science.gov (United States)

    Harris, Keith M; Aboujaoude, Elias

    2016-08-01

    Online relationships are increasingly central to many people's lives. As a result, there is a growing need to scientifically examine their psychosocial implications. This study developed and tested the Online Relationship Initiation Scale (ORIS) through classical and item response theory analyses to address this need. An anonymous online survey included 713 adults, aged 18-71 years. The ORIS was tested on psychometric properties and examined for associations with gender and several standardized psychosocial measures. Results demonstrated unidimensionality of nine items, strong factor loadings, and high internal consistency (α = 0.90, ωt = 0.94). All items captured significant information on the latent trait and none showed differential item functioning by sex, age group, or ethnicity. General linear modeling confirmed hypotheses that men were more likely than women to initiate online relationships. Online relationship initiation was not strongly associated with perceived social support, but was positively related to financial distress, and willingness to engage in infidelity or unprotected sex. The ORIS was negatively associated with age and satisfaction with life and showed modest interactions with ethnicity and hours online. This study provided empirical evidence for an interpersonal relationship initiation construct. The ORIS was shown to be a psychometrically sound instrument for evaluating online interpersonal behaviors and their associations with psychosocial and demographic factors. Such psychometrically sound instruments can be useful in exploring online interpersonal behaviors and their significance.

  19. Unwanted online sexual solicitation and online sexual risk behavior

    NARCIS (Netherlands)

    Baumgartner, S.E.; Valkenburg, P.M.; Peter, J.; Yan, Z.

    2012-01-01

    In recent years, there have been growing concerns about online sexual solicitations and online sexual risk behaviors. Recent studies suggest that only a minority of adolescents is confronted with online sexual solicitations or engages in online sexual risk behavior. Whereas more girls encounter

  20. Significance of measuring oxidative stress in lifestyle-related diseases from the viewpoint of correlation between d-ROMs and BAP in Japanese subjects

    International Nuclear Information System (INIS)

    Fukui, Toshiki; Yamauchi, Kazuhiro; Maruyama, Mie; Yasuda, Tadashi; Abe, Youichi; Kohno, Masakazu

    2011-01-01

    In recent years, oxidative stress has been postulated to be an important factor in the pathogenesis and development of lifestyle-related diseases. In this study, we investigated the association between the derivatives of reactive oxygen metabolites (d-ROMs), as an index of products of reactive oxygen species (ROS), and biological antioxidant potential (BAP), as an index of antioxidant potential. We also investigated the associations between d-ROMs or BAP and the risk factors for lifestyle-related diseases or metabolic syndrome-associated factors to evaluate their usefulness in preventive medicine. There were 442 subjects who underwent health checkup examination in our facilities. In addition to standard medical checkup items, we analyzed d-ROMs, BAP, brachial-ankle pulse wave velocity, high-sensitivity C-reactive protein level and visceral fat area (VFA) visualized on a computed tomography scan. The mean d-ROM value in females was significantly higher than that in males. There was a positive correlation between the d-ROM and VFA levels. On correlation analysis, there was a negative correlation between the d-ROM and creatinine levels. As factors that influence d-ROMs, the level of VFA was selected, suggesting the significance of oxidative stress measurement with d-ROMs. In addition, there was a positive correlation between d-ROMs and BAP values. Further research is required to resolve whether increased production of ROS or the antioxidant potential that can compensate for such an increase of ROS is more important in vivo. (author)

  1. Dicty_cDB: VFA373 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qlfqeilkkmfnmplkvsngwvy*vlmkkl*irilqsivfalyskr nsltklvnvm*lslnitlssntlivqkkkfhhsfvmvfqmvvlqlhsllvfqlvsqlnss lmvklqlevllvq*llilftnfrei...kixkyxxxklnkk*kikkklifkkn Homology vs CSM-cDNA Score E S

  2. Dicty_cDB: VFA445 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C: teinnvi*lq*dlshstssirkgknrr*ikscr*iwfkeqkrsmespirfsqnqkgc*rt prs**krpktyl*rfss...kr*rrkln**--- ---teinnvi*lq*dlshstssirkgknrr*ikscr*iwfkeqkrsmespirfsqnqkgc *rtprs**krpktyl*rfsspp*tpqirchgri

  3. Dicty_cDB: VFA863 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ore E Sequences producing significant alignments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott...gnificant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-A... 83

  4. Dicty_cDB: VFA628 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8 |pid:none) Methanobrevibacter smithii ATCC ... 42 0.017 CP001390_1265( CP001390 |pid:none) Geobacter sp. F...000678_1111( CP000678 |pid:none) Methanobrevibacter smithii ATCC... 36 0.91 (Q9Z3...otrophomonas maltophilia K27... 36 1.2 CP000678_996( CP000678 |pid:none) Methanobrevibacter smithii ATCC ......:none) Methanobrevibacter smithii ATCC ... 34 3.5 protein update 2009. 6.16 PSORT psg: 0.85 gvh: 0.47 alm: 0

  5. Dicty_cDB: VFA387 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e) Dechloromonas aromatica RCB, comp... 315 3e-84 CU633749_120( CU633749 |pid:none) Cupriavidus taiwanensis ...complet... 313 1e-83 CU633749_1505( CU633749 |pid:none) Cupriavidus taiwanensis str. LM... 313 1e-83 protein

  6. Dicty_cDB: VFA207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.005 1 AB022770 |AB022770.1 Human rotavirus mRNA for NSP2, complete cds. 52 0.005 1 X57944 |X57944.1 Human rotavirus...clone RP11-291E21 from 4, complete sequence. 42 0.011 5 Z21640 |Z21640.1 Bovine rotavirus (Strain RF) mRNA f

  7. BES online calibration system

    International Nuclear Information System (INIS)

    Zhang Bingyun; Li Xiaonan; Zhu Kejun; Zhang Jiawen; Gong Mingyu

    2003-01-01

    We constructed BES (Beijing Spectrometer) online calibration system to ensure the coherence of readout electronic channels due to huge data volume in high energy physics experiment. This paper describes the structure of hardware and software, and its characteristic and function

  8. African Journals Online (AJOL)

    African Journals Online (AJOL)

    African Journals OnLine (AJOL) is the world's largest and pre-eminent ... The competitive advantage of nations: is Porter's Diamond Framework a new ... Advertising practice in Nigeria: Development, new trends, challenges and prospects

  9. African Journals Online (AJOL)

    African Journals Online (AJOL)

    African Journals OnLine (AJOL) is the world's largest and pre-eminent ... Continuing Medical Education; The competitive advantage of nations: is Porter's ... Ethiopian Journal of Education and Sciences; Advertising practice in Nigeria: ...

  10. African Journals Online (AJOL)

    African Journals Online (AJOL)

    African Journals OnLine (AJOL) is the world's largest and pre-eminent collection ... Continuing Medical Education; The competitive advantage of nations: is Porter's ... AFRREV IJAH: An International Journal of Arts and Humanities; Advertising ...

  11. Mapping student online actions

    DEFF Research Database (Denmark)

    Bruun, Jesper; Jensen, Pia; Udby, Linda

    The Virtual Neutrons for Teaching project (vnt.nmi3.org) has converted traditional text book material into a wiki-style online text book that contains the same text and equations as the traditionally styled text book but has added features due to the online nature. Two of these features...... their problem solving strategy. In this study, we use web analytics software to track student online behavior by recording what particular objects on particular web-pages students click on and when each click occurs. For each recorded session, we create networks based on student clicks: A directed link between...... two nodes, 1 and 2, is drawn, if the object represented by node 2 is clicked right af the object represented by node 1. Preliminary analysis of these networks show two general types of behavior: In one type, there is little interaction with the online contents. The student navigates to the page...

  12. Regulating Online Data Privacy

    OpenAIRE

    Paul Reid

    2004-01-01

    With existing data protection laws proving inadequate in the fight to protect online data privacy and with the offline law of privacy in a state of change and uncertainty, the search for an alternative solution to the important problem of online data privacy should commence. With the inherent problem of jurisdiction that the Internet presents, such a solution is best coming from a multi-national body with the power to approximate laws in as many jurisdictions as possible, with a recognised au...

  13. Tools of online Marketing

    OpenAIRE

    Hossain, M. S.; Rahman, M. F.

    2017-01-01

    Abstract Online marketing is the most crucial issue in the modern marketing era but there was no previous research that could identify the tools of internet marketing before this study and it was the first study on the field of online marketing tools. This research was descriptive in nature and it has attempted to identify the major tools of internet marketing from the concepts of traditional marketing tools. Worldwide network is known as Internet that can exchange information between use...

  14. Online Videoconferencing Products: Update

    Directory of Open Access Journals (Sweden)

    Douglas Burton

    2011-02-01

    Full Text Available Software allowing real-time online video connectivity is rapidly evolving. The ability to connect students, staff, and guest speakers instantaneously carries great benefits for the online distance education classroom. This evaluation report compares four software applications at opposite ends of the cost spectrum: DimDim, Elluminate VCS, TokBox, and Vyew. Their benefits and shortcomings are contrasted, and efficient educational scenarios for them are suggested.

  15. Nudging Online Security Behaviour with Warning Messages: Results from an online experiment

    OpenAIRE

    VAN BAVEL RENE; RODRIGUEZ PRIEGO NURIA

    2016-01-01

    This study is part of a larger effort to better understand online behaviour. We tested the effect on people’s security behaviour of different ways of warning them about cybersecurity threats with an online experiment (n=5,065) in Germany, Sweden, Poland, the UK and Spain. Participants had to make a purchase in a mock online store, and their behaviour was observed through four behavioural measures. Results show that making users aware of the steps they can take to minimise their exposure to ri...

  16. Latency reduction in online multiplayer games using detour routing

    OpenAIRE

    Ly, Cong

    2010-01-01

    Long network latency negatively impacts the performance of online multiplayer games. In this thesis, we propose a novel approach to reduce the network latency in online gaming. Our approach employs application level detour routing in which game-state update messages between two players can be forwarded through other intermediate relay nodes in order to reduce network latency. We present results from an extensive measurement study to show the potential benefits of detour routing in online game...

  17. TU Delft en online media

    NARCIS (Netherlands)

    Speekenbrink, R.J.H.

    2013-01-01

    Dit boek behandelt een visie op online media bij Nederlandse universiteiten. Daarbij beperk ik me tot die aspecten waarin online communicatie en/of online marketing een rol speelt. Dit boek behandelt niet de onderwijsgerelateerde aspecten van online media. Elektronische leeromgevingen, sociale media

  18. Suicidality, psychopathology, and the internet: Online time vs. online behaviors.

    Science.gov (United States)

    Harris, Keith M; Starcevic, Vladan; Ma, Jing; Zhang, Wei; Aboujaoude, Elias

    2017-09-01

    This study investigated whether several psychopathology variables, including suicidality, could predict the time people spend using the internet (hours online). Next, we examined a specific at-risk population (suicidal individuals) by their online behaviors, comparing suicidal individuals who went online for suicide-related purposes with suicidal individuals who did not go online for suicide-related purposes. An anonymous online sample of 713 (aged 18-71) reported hours online, psychiatric histories, and completed several standardized scales. After accounting for age and education, hierarchical regression modeling showed that the assessed psychopathology variables, including suicidality, did not explain significant variance in hours online. Hours online were better predicted by younger age, greater willingness to develop online relationships, higher perceived social support, higher curiosity, and lower extraversion. Suicidal participants, who did or did not go online for suicide-related purposes, did not differ on hours online. Multiple regression modeling showed that those who went online for suicide-related purposes were likely to be younger, more suicidal, and more willing to seek help from online mental health professionals. These findings revealed that hours online are not a valid indicator of psychopathology. However, studying online behaviors of specific at-risk groups could be informative and useful, including for suicide prevention efforts. Copyright © 2017. Published by Elsevier B.V.

  19. Online cross-validation-based ensemble learning.

    Science.gov (United States)

    Benkeser, David; Ju, Cheng; Lendle, Sam; van der Laan, Mark

    2018-01-30

    Online estimators update a current estimate with a new incoming batch of data without having to revisit past data thereby providing streaming estimates that are scalable to big data. We develop flexible, ensemble-based online estimators of an infinite-dimensional target parameter, such as a regression function, in the setting where data are generated sequentially by a common conditional data distribution given summary measures of the past. This setting encompasses a wide range of time-series models and, as special case, models for independent and identically distributed data. Our estimator considers a large library of candidate online estimators and uses online cross-validation to identify the algorithm with the best performance. We show that by basing estimates on the cross-validation-selected algorithm, we are asymptotically guaranteed to perform as well as the true, unknown best-performing algorithm. We provide extensions of this approach including online estimation of the optimal ensemble of candidate online estimators. We illustrate excellent performance of our methods using simulations and a real data example where we make streaming predictions of infectious disease incidence using data from a large database. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.

  20. Evaluating Online Dialogue on “Security” Using a Novel Instructional Design

    NARCIS (Netherlands)

    P.A. Arora (Payal)

    2008-01-01

    textabstractAbstract: This paper explores evaluation strategies to gauge the impact of a novel instructional design on international community participation online. This is done by conceptualizing and devising indicators for measuring “engagement” online amongst marginalized adult communities