
Sample records for olkiluoto drillholes onk-pp122

  1. Core drilling of hydco drillholes ONK-PP262 and ONK-PP274 in ONKALO at Olkiluoto 2010

    Energy Technology Data Exchange (ETDEWEB)

    Toropainen, V. [Suomen Malmi Oy, Espoo (Finland)


    Suomen Malmi Oy (Smoy) core drilled two drillholes for HYDCO-program in ONKALO at Eurajoki, Olkiluoto in 2010. The drillhole ONK-PP262 was drilled in May 2010 and the drillhole ONK-PP274 in December 2010. The lengths of the drillholes are 25.02 and 23.88 m respectively. The drillholes are 75.7 mm by diameter. The drillholes were drilled in the investigation niche 4 at the access tunnel chainage 3747. The hydraulic DE 130 drilling rig was used. The drilling water was taken from the ONKALO drilling water pipeline and premixed sodium fluorescein was used as a label agent in the drilling water. The drillholes were measured with EMS deviation survey tool. In addition to drilling the drillcores were logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. The main rock types in the drillholes are veined gneiss and pegmatitic granite. The average fracture frequencies in both drill cores are 1.4 pcs/m. The average RQD values in the drillcores are 97.2 % (ONK-PP262) and 98.6 % (ONK-PP274). (orig.)

  2. Core drilling of hydco drillholes ONK-PP262 and ONK-PP274 in ONKALO at Olkiluoto 2010

    International Nuclear Information System (INIS)

    Toropainen, V.


    Suomen Malmi Oy (Smoy) core drilled two drillholes for HYDCO-program in ONKALO at Eurajoki, Olkiluoto in 2010. The drillhole ONK-PP262 was drilled in May 2010 and the drillhole ONK-PP274 in December 2010. The lengths of the drillholes are 25.02 and 23.88 m respectively. The drillholes are 75.7 mm by diameter. The drillholes were drilled in the investigation niche 4 at the access tunnel chainage 3747. The hydraulic DE 130 drilling rig was used. The drilling water was taken from the ONKALO drilling water pipeline and premixed sodium fluorescein was used as a label agent in the drilling water. The drillholes were measured with EMS deviation survey tool. In addition to drilling the drillcores were logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. The main rock types in the drillholes are veined gneiss and pegmatitic granite. The average fracture frequencies in both drill cores are 1.4 pcs/m. The average RQD values in the drillcores are 97.2 % (ONK-PP262) and 98.6 % (ONK-PP274). (orig.)

  3. Pressure, flow and hydraulic interference measurements in ONKALO at Olkiluoto, drillholes ONK-PP262 and ONK-PP274

    International Nuclear Information System (INIS)

    Hurmerinta, E.; Pekkanen, J.; Komulainen, J.; Rouhiainen, P.


    The general purpose of these studies is to characterize the fracture network and groundwater flow properties in a volume of rock, which is representative of the rock close to deposition holes. As a part of the studies hydraulic tests and flow measurements were applied in two drillholes in hydraulically poorly conductive bedrock. This report presents the principles of the methods as well as the results of the measurements carried out in the underground facilities of ONKALO. The measurements were conducted in drillholes ONK-PP262 and ONK-PP274 between May 9, 2010 and June 9, 2011. The aim of the measurements was to obtain pressure in the closed drillholes, to detect water yielding fractures by flow measurements, to obtain transmissivity with overpressure and drawdown tests and to study hydraulic interference between the drillholes by cross-hole hydraulic tests. The PFL DIFF probe was used to detect flow within single fractures in the drillhole. Transmissive water yielding fractures were found at depths 17.9 m, 16.9 m and 16.4 m in ONK-PP262 and at depths 19.8 m and 19.5 m in ONK-PP274. The cross-hole hydraulic tests included three basic phases. Flow was measured in one drillhole when the other drillhole was open, closed or overpressurized. The cross-hole hydraulic tests were carried out to both directions in the two drillholes. (orig.)

  4. ONKALO POSE experiment. Determination of in situ thermal properties of rocks in drillholes ONK-PP340, ONK-PP346, ONK-PP398, ONK-PP399, ONK-PP405, ONK-PP411

    International Nuclear Information System (INIS)

    Korpisalo, A.; Suppala, I.; Kukkonen, I.; Koskinen, T.


    The thermal drillhole device TERO76 (for diameter 76 mm drillholes) used in this study for determining thermal properties of rocks in situ was developed at the Geological Survey of Finland for Posiva in the early 2000's. The measurement method is based on monitoring the temperature variation of a cylindrical heating source in a drillhole. The measured data can be interpreted with full numerical 3D codes as well as with an analytical infinite line source method, a 'rapid interpretation tool', which makes it possible to calculate the first estimates of thermal properties already in the field. Both methods were applied in this study. Because of the unique measurement geometry, only the thermal conductivities can accurately be estimated using the late times of heating periods (accuracy ± 2%). The cylindrical source method cannot directly give the thermal diffusivity or volumetric heat capacity at a sufficient accuracy. Thermal diffusivities are estimated by using the average specific heat capacities and densities of the rock type at the measurement point, or the laboratory results on the general diffusivity-conductivity relationship for different Olkiluoto rock types. The latter technique was applied in this study. Thermal properties were determined in four shallow drillholes (ONK-PP398, ONK-PP399, ONK-PP405, ONK-PP411) located in the ONKALO investigation niche 3 (ONK-TKU-3620) at the access tunnel chainage of 3620 m. The measurement positions (17) were strictly selected on the grounds that approximately an equal number of in situ results would be available in both veined gneiss (VGN) and pegmatitic granite (PGR). The results from the drillholes ONK-PP340 and ONK-PP346 measured in a previous project are also presented in this report. In veined gneiss, the average conductivity determined with numerical model of the present measurements is 3.49 (2.83) Wm -1 K -1 and diffusivity 1.89 x 10 -6 (1.3 10 -6 ) m 2 s -1 . The laboratory values of Olkiluoto rocks

  5. Core drilling of drillholes ONK-KR13, ONK-KR14 and ONK-KR15 in ONKALO at Olkiluoto 2010 - 2011

    International Nuclear Information System (INIS)

    Toropainen, V.


    As a part of the confirming site investigations at Olkiluoto, Suomen Malmi Oy (Smoy) core drilled three drillholes ONK-KR13 (120.45 m), ONK-KR14 (75.27 m) and ONK-KR15 (79.96 m) in ONKALO, at Olkiluoto in June 2010 - March 2011. The diameter of the drillholes is 75.7 mm. Sodium fluorescein was used as a label agent in the drilling water, and the drillholes were washed and flushed after the drilling. The deviations of the drillholes were measured with the deviation measuring instruments EMS and Gyro. The core samples were logged according to Posiva's normal procedure for drillholes. The main rock types are veined and diatexitic gneisses and pegmatitic granite. The average natural fracture frequencies and RQDs of the core samples are 1.6 pcs/m and 97.0 % (ONK-KR13), 0.5 pcs/m and 99.3 % (ONK-KR14) and 1.6 pcs/m and 97.3 % (ONK-KR15). In drillhole ONK-KR13 one, and in drillhole ONK-KR15 three fractured zones were intersected. There was no fractured zones in drillhole ONK-KR14. Rock mechanical tests were performed to core samples. The average uniaxial compressive strength was 143.2 MPa, the average Young's Modulus was 57.3 GPa and the average Poisson's ratio was 0.25. (orig.)

  6. Geophysical logging and imaging of shallow drillholes ONK-PP262 and ONK-274 at Olkiluoto in 2010

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.


    Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of shallow drillholes ONK-PP262 and ONK-PP274 at ONKALO in the investigation niche ONK-TKU-4 (Hydco) in May and in December 2010. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

  7. ONKALO pose experiment. Geophysical logging and imaging of drillholes ONK-PP223, ONK-PP226, ONK-PP254 and ONK-PP259...261

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.


    Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of shallow drillholes ONK-PP223, ONK-PP226, ONK-PP254, ONKPP259, ONK-PP260 and ONK-PP261 at ONKALO in the investigation niche ONKTKU- 3 (POSE) between December 2009 and June 2010. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

  8. Core drilling of drillholes ONK-PVA9 and ONK-PVA10 in ONKALO at Olkiluoto 2011

    Energy Technology Data Exchange (ETDEWEB)

    Toropainen, V. [Suomen Malmi Oy, Espoo (Finland)


    Suomen Malmi Oy (Smoy) core drilled two drillholes for groundwater monitoring stations in ONKALO at Eurajoki, Olkiluoto in 2011. The groundwater monitoring stations are used for monitoring changes in groundwater conditions. The drillhole ONK-PVA9 was drilled in March 2011 and the drillhole ONK-PVA10 in June 2011. The lengths of the drillholes are 15.95 and 20.10 m respectively. The drillholes are 75.7 mm by diameter. The drillhole ONK-PVA9 was drilled in a niche of the access tunnel at chainage 4366 and the ONK-PVA10 in the access tunnel wall at chainage 3851. The hydraulic DE 130 drilling rig was used. The drilling water was taken from the ONKALO drilling water pipeline and premixed sodium fluorescein was used as a label agent in the drilling water. The drillholes were measured with EMS deviation survey tool. In addition to drilling the drillcores were logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. The main rock types in the drillholes are veined gneiss and pegmatitic granite. The average fracture frequencies in drill cores are 2.9 pcs/m (ONK-PVA9) and 2.3 pcs/m (ONK-PVA10) and the average RQD values 81.6 % and 96.2 % respectively. (orig.)

  9. Bentonite buffer pre-test. Core drilling of drillholes ONK-PP264...267 in ONKALO at Olkiluoto 2010

    International Nuclear Information System (INIS)

    Toropainen, V.


    Suomen Malmi Oy (Smoy) core drilled four drillholes for bentonite buffer pre-test in ONKALO at Eurajoki, Olkiluoto in July 2010. The identification numbers of the holes are ONK-PP264..267, and the lengths of the drillholes are approximately 4.30 metres each. The drillholes are 75.7 mm by diameter. The drillholes were drilled in a niche at access tunnel chainage 1475. The hydraulic DE 130 drilling rig was used for the work. The drilling water was taken from the ONKALO drilling water pipeline and premixed sodium fluorescein was used as a label agent in the drilling water. In addition to drilling, the drillcores were logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. The main rock type in the drillholes is pegmatitic granite. The average fracture frequency in the drill cores is 4.0 pcs / m and the average RQD value 94.2 %. (orig.)

  10. Core drilling of drillhole ONK-PVA11 in ONKALO at Olkiluoto 2014

    Energy Technology Data Exchange (ETDEWEB)

    Toropainen, V. [Drillcon SMOY, Espoo (Finland)


    Suomen Malmi Oy (Smoy) core drilled a drillhole for groundwater monitoring station in ONKALO at Eurajoki, Olkiluoto in 2014. The groundwater monitoring stations are used for monitoring changes in groundwater conditions. The drillhole ONK-PVA11 was drilled in February 2014. The length of the drillhole is 30.05 metres. The drillhole is 75.7 mm by diameter. The drillhole ONK-PVA11 was drilled in the left wall of the ONK-TT-4399 (tunnel chainage 50) between the demonstration tunnel ONK-TDT-4399-44 and 56 openings. The hydraulic DE 130 drilling rig was used. The drilling water was taken from the ONKALO drilling water pipeline and premixed sodium fluorescein was used as a label agent in the drilling water. The drillhole was measured with EMS deviation survey tool. In addition to drilling the drillcore was logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. The main rock types in the drillcore are veined gneiss, diatexitic gneiss and pegmatitic granite. The average fracture frequency in drill core is 2.3 pcs/m and the average RQD value 95.2 %. (orig.)

  11. Core drilling of drillhole ONK-PVA11 in ONKALO at Olkiluoto 2014

    International Nuclear Information System (INIS)

    Toropainen, V.


    Suomen Malmi Oy (Smoy) core drilled a drillhole for groundwater monitoring station in ONKALO at Eurajoki, Olkiluoto in 2014. The groundwater monitoring stations are used for monitoring changes in groundwater conditions. The drillhole ONK-PVA11 was drilled in February 2014. The length of the drillhole is 30.05 metres. The drillhole is 75.7 mm by diameter. The drillhole ONK-PVA11 was drilled in the left wall of the ONK-TT-4399 (tunnel chainage 50) between the demonstration tunnel ONK-TDT-4399-44 and 56 openings. The hydraulic DE 130 drilling rig was used. The drilling water was taken from the ONKALO drilling water pipeline and premixed sodium fluorescein was used as a label agent in the drilling water. The drillhole was measured with EMS deviation survey tool. In addition to drilling the drillcore was logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. The main rock types in the drillcore are veined gneiss, diatexitic gneiss and pegmatitic granite. The average fracture frequency in drill core is 2.3 pcs/m and the average RQD value 95.2 %. (orig.)

  12. Overcoring rock stress measurements in drillholes ONK-PP169 and ONK-PP170 Olkiluoto

    International Nuclear Information System (INIS)

    Berg, S.; Sjoeberg, J.


    Three-dimensional overcoring rock stress measurements were conducted in drillholes ONK-PP169 and ONK-PP170 at the 230 m depth level in the ONKALO site ramp. The measurements were performed during the spring of 2008. The objective of the measurements was to obtain better understanding of the in situ stress field for the measured depth levels. Another objective was to increase the confidence and reliability and to diminish the uncertainties concerning the state of stress at shallow depth of ONKALO. Due to problems with bonding of strain gauges, which may have been caused by a thin layer/coating of unknown material on the pilot hole wall, stress measurements results were only achieved in drillhole ONK-PP170 at -230 m level. The initial plan was to conduct measurements at three depth levels, -120 m, -180 m and -220 m levels, in the ONKALO ramp. Two (2) of the conducted measurements could be rated as successful (rating a) two (2) measurement were partly successful (rating b). The results from the measurements assuming isotropic condition, the major principal stress is plunging between 18deg and 35deg and trending between S and WSW. Stress magnitudes (for σ 1 ) varied between 12 and 16 MPa except for test 2:3:3 where a much higher value (47 MPa) was obtained. The orientation of the major principal stress are similar for test 2:3:3 and 2:4:3 (WSW), but are different from the orientation of the major principal stress for test 2:5:1 and 2:6:1 (S). Likewise, the horizontal stresses have the highest values for test 2:3:3 but in this case the orientation is similar to test 2:5:1 and 2:4:3. The horizontal stress magnitudes of test 2:4:3, 2:5:1 and 2:6:1 are similar but the orientation for test 2:6:1 are different from the other three tests. The results from two of the measurements assuming transversely isotropic conditions, the major principal stress is 12.3 MPa and 12.7 MPa, trending WSW and S, plunging 30 deg. (orig.)

  13. Core drilling of drillhole ONK-PVA8 in ONKALO at Olkiluoto 2010

    International Nuclear Information System (INIS)

    Toropainen, V.


    Suomen Malmi Oy (Smoy) core drilled a drillhole for groundwater monitoring station in ONKALO at Eurajoki, Olkiluoto in July 2010. The groundwater monitoring stations are used for monitoring changes in groundwater conditions. The identification number of the hole is ONK-PVA8, and the length of the drillhole is 17.74 m. The drillhole is 75.7 mm by diameter. The drillhole was drilled in a niche of the access tunnel at chainage 2935. The hydraulic DE 130 drilling rig was used. The drilling water was taken from the ONKALO drilling water pipeline and premixed sodium fluorescein was used as a label agent in the drilling water. In addition to drilling the drillcores were logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. The main rock types in the drillholes are diatexitic gneiss and pegmatitic granite. The average fracture frequency in drill core ONK-PVA8 is 1.7 pcs / m and the average RQD value 96.0 %. (orig.)

  14. Difference flow measurements and hydraulic interference test in ONKALO at Olkiluoto drillholes ONK-PH16 and ONK-PH17

    Energy Technology Data Exchange (ETDEWEB)

    Komulainen, J.; Pekkanen, J. [Poyry Finland Oy, Espoo (Finland)


    The Posiva Flow Log, Difference Flow Method (PFL DIFF) uses a flowmeter that incorporates a flow guide and can be used for relatively quick determinations of hydraulic conductivity and hydraulic head in fractures/fractured zones in cored drillholes. This report presents the principles of the method as well as the results of the measurements carried out in the underground facilities of ONKALO. The measurements were conducted in pilot holes ONK-PH16 and ONK-PH17 between October 12 and December 29, 2010. The aim of the measurements was to detect water conducting fractures and hydraulic interference between pilot holes ONK-PH16 and ONK-PH17. The flow rate into a 0.5 m long test section was measured using 0.1 m point intervals. The flowing fractures in both pilot holes were obtained between 50 m - 80 m. For hydraulic interference test one drillhole was closed with packers to increase its pressure. Flow response to the increased pressure was measured in the other drillhole. The flow guide of the PFL DIFF probe encloses an electrode for single point resistance measurement, which was carried out with 0.01 m point intervals during the automatic flow measurements. The flow measurement and the single point resistance measurement were used to locate flowing fractures and evaluate their transmissivity. Electrical conductivity (EC) and temperature of water were registered during automatic flow logging. The conductivity values are temperature corrected to 25 deg C. The distance between the drillholes is about 14 m. Flow response in fractures of open ONK-PH16 could be detected when pressure was changed in ONK-PH17. (orig.)

  15. Summary of investigations in personnel shaft pre-grouting drillholes ONK-PP131, -PP134 and -PP137 in Olkiluoto, 2008

    International Nuclear Information System (INIS)

    Heikkinen, E.; Ahokas, T.; Heikkinen, P.; Kristiansson, S.; Tiensuu, K.; Pere, T.


    Posiva Oy is preparing for disposal of spent nuclear fuel in the bedrock at Olkiluoto, Eurajoki. This act is in accordance with the application filed in 1999, the Decision-in- Principle of the State Council in 2000, and the ratification by Parliament in 2001. The ONKALO underground characterisation facility has been under construction since 2004. Construction work has included excavation of an access tunnel (currently at a depth of c. 350 m) and driving of three vertical shafts using raise-boring. In 2008, geological, hydrological and geophysical measurements were carried out in three vertical drillholes intended for pre-grouting of personnel shaft ONK-KU1 at depth level -177 to -280 m. The drillholes are 76 mm in diameter, 104.5 m long and located 3.2 m apart within the perimeter of vertical shaft to be constructed. The shaft also contains geological and geophysical information from deep drillhole OL-KR24. Goal of survey and integrating interpretation was to investigate variation in bedrock properties and their predictability in small scale. Goal was also to demonstrate appropriate survey techniques. These techniques can be applied for characterization of bedrock in disposal tunnel and specifically in the near field of disposal holes. Information is gained from fracturing with orientations and continuity as well as hydraulic conductivity, and position and continuity of electrically conductive layers and fractures. Surveys included flow logging, crosshole mise-a-la-masse measurements, optical imaging and drillhole radar surveys. Data sets were adjusted to common depth level with core logging according to geological reference points. Results were interpreted for hydraulically conductive fractures and their orientations, fracture orientations, and electrical conductivity features from mise-a-la-masse and radar. Geophysical results were compared with geological information. The drillholes are located in a sparsely fractured rock mass. Rock quality is very good and

  16. Core drilling of REPRO drillholes in ONKALO at Olkiluoto 2010-2011

    International Nuclear Information System (INIS)

    Toropainen, V.


    Suomen Malmi Oy (Smoy) core drilled ten drillholes for the Posiva's Experiments to investigate Rock Matrix Retention Properties (REPRO) in ONKALO at Eurajoki, 2010 - 2011. The drillholes are used for geological characterization, hydrological and geophysical studies and instrumenting in research for retention of radionuclides to rock matrix. The drillhole ONK-PP240 was drilled in March 2010 and the drillholes ONKPP318... 324 and ONK-PP326...327 in October - December 2011. The lengths of the drillholes range from 4.90 to 21.65 metres. The drillholes are 56.5 mm by diameter. The drillhole ONK-PP240 was drilled for pretesting in the investigation niche 4 at access tunnel chainage 3747 and the rest of the drillholes in the investigation niche 5 at access tunnel chainage 4219. The hydraulic DE 130 drilling rig was used. The starting directions of the close spaced drillholes were controlled with an aligner assembly to be as parallel as possible. The drilling water was taken from the ONKALO drilling water pipeline and premixed sodium fluorescein was used as a label agent in the drilling water. The drillholes were measured with EMS deviation survey tool. In addition to drilling the drillcores were logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. The main rock types in the drillholes are veined gneiss, pegmatitic granite and quartz gneiss (skarn rock). The average fracture frequency in drill cores is 1.2 pcs/m and the average RQD value 98.6 %. (orig.)

  17. Core drilling of REPRO drillholes in ONKALO at Olkiluoto 2010-2011

    Energy Technology Data Exchange (ETDEWEB)

    Toropainen, V. [Suomen Malmi Oy, Espoo (Finland)


    Suomen Malmi Oy (Smoy) core drilled ten drillholes for the Posiva's Experiments to investigate Rock Matrix Retention Properties (REPRO) in ONKALO at Eurajoki, 2010 - 2011. The drillholes are used for geological characterization, hydrological and geophysical studies and instrumenting in research for retention of radionuclides to rock matrix. The drillhole ONK-PP240 was drilled in March 2010 and the drillholes ONKPP318... 324 and ONK-PP326...327 in October - December 2011. The lengths of the drillholes range from 4.90 to 21.65 metres. The drillholes are 56.5 mm by diameter. The drillhole ONK-PP240 was drilled for pretesting in the investigation niche 4 at access tunnel chainage 3747 and the rest of the drillholes in the investigation niche 5 at access tunnel chainage 4219. The hydraulic DE 130 drilling rig was used. The starting directions of the close spaced drillholes were controlled with an aligner assembly to be as parallel as possible. The drilling water was taken from the ONKALO drilling water pipeline and premixed sodium fluorescein was used as a label agent in the drilling water. The drillholes were measured with EMS deviation survey tool. In addition to drilling the drillcores were logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. The main rock types in the drillholes are veined gneiss, pegmatitic granite and quartz gneiss (skarn rock). The average fracture frequency in drill cores is 1.2 pcs/m and the average RQD value 98.6 %. (orig.)

  18. Core drilling of drillholes OL-PP66-69 at Olkiluoto 2008

    International Nuclear Information System (INIS)

    Kuusirati, J.; Tarvainen, A.-M.


    Suomen Malmi Oy (Smoy) core drilled four 24.88 - 25.39 m long investigation drillholes at Olkiluoto in June 2008. The identification numbers of the holes are OL-PP66, OL-PP67, OL-PP68 and OL-PP69. The drillholes are 75.7 mm by diameter. Drillholes were core drilled with the diamond drill rig Diamec 1000. The drilling water was taken from the ONKALO drilling water pipeline and premixed sodium fluorescein was used as a label agent in the drilling water. The labelled drilling water was driven to the drilling places in a tank. In addition to drilling the drill cores were logged and reported by geologist. During geological investigation the following parameters were logged: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. The main rock types in the drillholes are diatexitic and veined gneisses and pegmatitic granite. The average fracture frequency in holes varied from 3.9 pcs/m to 5.8 pcs/m. The average RQD values varied from 84 % to 93 %. In the drillhole OL-PP66 two fractured zones were penetrated and in OL-PP69 one fractured zone. The drill cores OL-PP67 and OL-PP68 showed no fractured zones. Smoy also carried out optical imaging of the drillholes. The assignment included the field work and the data processing. This report describes the field operation, the equipment as well as the processing procedures and shows the obtained results and their quality. The raw and processed data are delivered digitally in WellCAD and PDF format. (orig.)

  19. Core Drilling of shallow drillholes OL-PP72...OL-PP89 at Olkiluoto, Eurajoki 2011

    Energy Technology Data Exchange (ETDEWEB)

    Toropainen, V. [Suomen Malmi Oy, Espoo (Finland)


    Suomen Malmi Oy (Smoy) core drilled eighteen drillholes to survey the ground and bedrock conditions in the encapsulation plant building site at Olkiluoto, Eurajoki 2011. Soil quality, bedrock depth and quality of near surface bedrock were investigated in this project. The drillholes were drilled between 19th of October and 8th of November 2011. The lengths of the drillholes are mostly between 7 to 9 metres, except for the drillhole OL-PP79, which is 15 metres by length. The drillholes are 76 mm by diameter, and the core diameter is 60.2 mm. The lightweight GM75 drilling rig with rubber tracks was used. The drilling water was taken from the ONKALO area research building freshwater pipeline and sodium fluorescein was added as a label agent in the drilling water. The drillholes were not left open. In addition to drilling the drillcores were logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. The average natural fracture frequencies of the drillcores range from 2.5 pc/m (OL-PP77) to 11.8 pc/m (OL-PP86). The average RQD ranges from 55.1 % (OL-PP86) to 96.4 % (OL-PP77). The penetrated soils are mostly ground fill (blast rock), but some clays and sands are lying below the fill layer. (orig.)

  20. Core Drilling of shallow drillholes OL-PP72...OL-PP89 at Olkiluoto, Eurajoki 2011

    International Nuclear Information System (INIS)

    Toropainen, V.


    Suomen Malmi Oy (Smoy) core drilled eighteen drillholes to survey the ground and bedrock conditions in the encapsulation plant building site at Olkiluoto, Eurajoki 2011. Soil quality, bedrock depth and quality of near surface bedrock were investigated in this project. The drillholes were drilled between 19th of October and 8th of November 2011. The lengths of the drillholes are mostly between 7 to 9 metres, except for the drillhole OL-PP79, which is 15 metres by length. The drillholes are 76 mm by diameter, and the core diameter is 60.2 mm. The lightweight GM75 drilling rig with rubber tracks was used. The drilling water was taken from the ONKALO area research building freshwater pipeline and sodium fluorescein was added as a label agent in the drilling water. The drillholes were not left open. In addition to drilling the drillcores were logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. The average natural fracture frequencies of the drillcores range from 2.5 pc/m (OL-PP77) to 11.8 pc/m (OL-PP86). The average RQD ranges from 55.1 % (OL-PP86) to 96.4 % (OL-PP77). The penetrated soils are mostly ground fill (blast rock), but some clays and sands are lying below the fill layer. (orig.)

  1. Laboratory measurements of the coefficient of thermal expansion of Olkiluoto drill core samples

    International Nuclear Information System (INIS)

    Aakesson, U.


    The coefficient of thermal expansion and the wet density has been determined on 22 specimens from the ONKALO drillholes ONK-PP167, ONK-PP199, ONK-PP224, ONK-PP225 and ONK-PP226, Olkiluoto, Finland. The coefficient of thermal expansion has been determined in the temperature interval 20-60 deg C. The results indicated that the thermal expansion was almost linear, and the coefficient of thermal expansion for the investigated specimens range between 3.2 and 14.4 x 10 -6 mm/mm deg C, and the wet density between 2,610 and 2,820 kg/m 3 . The granite pegmatite has slightly lower coefficient of thermal expansion and wet density than gneissic rocks. (orig.)

  2. Geophysical logging and imaging of characterisation drillholes ONK-KR13, ONK-KR14 and ONK-KR15

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.


    Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of drillholes ONK-KR13, ONK-KR14 and ONK-KR15 at ONKALO in June-July 2010 and in March 2011. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

  3. Difference flow and electrical conductivity measurements at the Olkiluoto site in Eurajoki, drillholes OL-PP66 - OL-PP69

    International Nuclear Information System (INIS)

    Poellaenen, J.


    The Posiva Flow Log, Difference Flow Method (PFL DIFF) uses a flowmeter that incorporates a flow guide and can be used for relatively quick determinations of hydraulic conductivity and hydraulic head in fractures/fractured zones in cored drillholes. This report presents the principles of the method and the results of measurements carried out in drillholes OL-PP66, OL-PP67, OL-PP68 and OL-PP69 at the Olkiluoto investigation site in August 2008. All the drillholes discussed in this report are ground holes. The same measuring programme was employed in all four drillholes. The section length of the flow guide was either 2 m or 0.5 m. Flow into the drillhole or from the drillhole to the bedrock was measured within the section lengths and carried out in both pumped and natural (i.e. un-pumped) conditions. Calculations of the transmissivity (T) and the hydraulic head (h) of the zones are shown in the results. The device used includes a sensor for single point resistance (SPR). SPR was measured in connection with flow measurements. The electrical conductivity (EC) of fracture-specific water was measured in chosen fractures in some of the drillholes. Fractures were selected on the basis of the measured flow from fracture to drillhole. The EC of the drillhole water was also measured. (orig.)

  4. Flow measurements and hydraulic interference tests at the Olkiluoto site in Eurajoki, drillholes OL-KR14, OL-KR30, OL-PP66, OL-PP67, OL-PP68 and OL-PP69

    Energy Technology Data Exchange (ETDEWEB)

    Komulainen, J. [Poeyry Finland Oy, Vantaa (Finland)


    The measurements described in this report are part of the infiltration experiment carried out at Olkiluoto. The emphasis of these measurements is on obtaining more detailed data on hydraulically significant fractures in the infiltration experiment area. The selected fractures or sections were pumped in turn and flow responses were observed in the other holes by the PFL DIFF-tool. The flow measurements were carried out in drillholes OL-KR14, OL-KR30, OL-PP66, OL-PP67, OL-PP68 and OL-PP69 on the Olkiluoto investigation site between January 2013 and July 2013. Two different flowmeters were used for the measurements. Posiva Flow Log, Difference flow method (PFL DIFF) was used for the determination of hydraulic conductivity and hydraulic head in fractures/fractured zones in the drillholes. PFL DIFF flow logging was conducted in all the drillholes mentioned above. Posiva Flow Log, Transverse flow method (PFL TRANS) was used to determine groundwater flow direction and flow rate across a drillhole. The transverse flow method was used in drillholes OL-KR14 and OL-PP69. PFL DIFF and PFL TRANS measurements had been carried out earlier in drillholes OL-PP66, OL-PP67, OL-PP68 and OL-PP69. The most recent measurements were conducted in 2011. Those measurements were carried out when drillhole OL-KR14 was pumped at packed-off section 13 m - 18 m. Both PFL DIFF and PFL TRANS flowmeters include an electrode for measuring single point resistance (SPR). The device has a high depth resolution and the results were used for depth synchronisation between consecutive DIFF and TRANS measurements. (orig.)

  5. Core drilling of short drillholes at Olkiluoto in Eurajoki 2006

    International Nuclear Information System (INIS)

    Rautio, T.


    Posiva Oy submitted an application to the Finnish Government in May 1999 for the Decision in Principle to choose Olkiluoto in the municipality of Eurajoki as the site of the final disposal facility for spent nuclear fuel. A positive decision was made at the end of 2000 by the Government. The Finnish Parliament ratified the decision in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, ONKALO, will be constructed. As a part of the investigations Suomen Malmi Oy (Smoy) core drilled six short drillholes with a diameter of 75.7 mm at Olkiluoto in July - August 2006. The identification numbers of the drillholes are OL-PP51 - OL-PP56. The deviation of the drillholes was measured with the deviation measuring instruments Reflex EMS. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. The volume of the drilling water was recorded. Sodium fluorescein was used as a label agent in the drilling water. The total volume of the used drilling and flushing water were 37 m 3 . (orig.)

  6. Drilling and associated Drillhole measurements of the Pilot Hole ONK-PH14

    International Nuclear Information System (INIS)

    Aalto, P.; Toropainen, V.; Tarvainen, A.-M.; Pekkanen, J.; Poellaenen, J.; Lamminmaeki, T.


    The construction of ONKALO access tunnel started in September 2004 at Olkiluoto. During the construction, investigations serving both research and construction purposes need to be done. Investigations can be done for example in so called pilot holes. Pilot holes are cored drillholes to be drilled to the tunnel profile. The length of the holes varies from some tens of metres to some hundreds of metres. The purpose of the holes is to confirm the quality of the rock mass for tunnel construction, especially to identify water conductive fractures/fractured zones and to provide information that could result in modifications of the existing construction plans. The pilot hole ONK-PH14 was drilled in June 2010. Drilling was started in chainage 4313.6. The length of the hole was 150.80 metres. The deviation of the drillhole was measured during and after the drilling. Additionally, oriented core samples were collected from the drill core and the electric conductivity of returning water was measured. Logging of the core samples included following parameters: lithology, foliation, fracturing, fracture frequency, RQD, fractured zones, core loss and weathering. The rock mechanical logging was based on Q-classification. The strength and deformation properties of the rock were defined by using Rock-Tester equipment. Hydraulic measurements were made by using the PFL DIFF (Posiva Flow log, Difference Flow Method). PFL DIFF measurements were performed with a 0.5 m section length and with 0.1 m length increments. With PFL DIFF tool the locations of transmissive fractures were detected. Simultaneously, the electric conductivity (EC) of the drillhole water and fracture specific water, temperature of the drillhole water, single point resistance (SPR) of the drillhole wall and the prevailing water pressure were measured. Water loss measurements were done after the drilling by the tool developed by Posiva. The tool was in test use during the measurements. The groundwater sample was

  7. Drilling and associated Drillhole measurements of the Pilot Hole ONK-PH14

    Energy Technology Data Exchange (ETDEWEB)

    Aalto, P. (ed.); Lahti, M.; Kosunen, P.; Pere, T. [Posiva Oy, Helsinki (Finland); Toropainen, V.; Tarvainen, A.-M. [Suomen Malmi Oy, Espoo (Finland); Pekkanen, J.; Poellaenen, J. [Poeyry Finland Oy, Espoo (Finland); Lamminmaeki, T. [Teollisuuden Voima Oyj, Helsinki (Finland)


    The construction of ONKALO access tunnel started in September 2004 at Olkiluoto. During the construction, investigations serving both research and construction purposes need to be done. Investigations can be done for example in so called pilot holes. Pilot holes are cored drillholes to be drilled to the tunnel profile. The length of the holes varies from some tens of metres to some hundreds of metres. The purpose of the holes is to confirm the quality of the rock mass for tunnel construction, especially to identify water conductive fractures/fractured zones and to provide information that could result in modifications of the existing construction plans. The pilot hole ONK-PH14 was drilled in June 2010. Drilling was started in chainage 4313.6. The length of the hole was 150.80 metres. The deviation of the drillhole was measured during and after the drilling. Additionally, oriented core samples were collected from the drill core and the electric conductivity of returning water was measured. Logging of the core samples included following parameters: lithology, foliation, fracturing, fracture frequency, RQD, fractured zones, core loss and weathering. The rock mechanical logging was based on Q-classification. The strength and deformation properties of the rock were defined by using Rock-Tester equipment. Hydraulic measurements were made by using the PFL DIFF (Posiva Flow log, Difference Flow Method). PFL DIFF measurements were performed with a 0.5 m section length and with 0.1 m length increments. With PFL DIFF tool the locations of transmissive fractures were detected. Simultaneously, the electric conductivity (EC) of the drillhole water and fracture specific water, temperature of the drillhole water, single point resistance (SPR) of the drillhole wall and the prevailing water pressure were measured. Water loss measurements were done after the drilling by the tool developed by Posiva. The tool was in test use during the measurements. The groundwater sample was

  8. Drilling and associated drillhole measurements of the pilot hole ONK-PH13

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.; Toropainen, V.; Pekkanen, J.; Poellaenen, J.; Kosunen, P.; Lahti, M.; Pere, T.; Aalto, P.


    The construction of ONKALO access tunnel started in September 2004 at Olkiluoto. During the construction, investigations serving both research and construction purposes need to be done. Investigations can be done for example in so called pilot holes. Pilot holes are cored drillholes to be drilled to the tunnel profile. The length of the holes varies from some tens of meters to some hundreds of meters. The purpose of the holes is to confirm the quality of the rock mass for tunnel construction, especially to identify water conductive fractures/fracture zones and provide information that could result in modifications of the existing construction plans. The pilot hole ONK-KR13 was drilled in March 2010. Drilling was started from chainage 4201. The final length of the hole was 140.05 meters. The deviation of the drillhole was measured during and after the drilling. Additionally, oriented core samples were collected and electric conductivity of returning water from the drill hole was measured. Logging of the core samples included following parameters: lithology, foliation, fracturing, fracture frequency, RQD, fractured zones, core loss and weathering. The rock mechanical logging was based on Q-classification. The strength and deformation properties of the rock were defined by using Rock-Tester equipment. Hydraulic measurements were made by using the PFL DIFF (Posiva Flow Log, Difference Flow method). PFL DIFF measurements were performed with a 0.5 m section length and with 0.1 m length increments. With PFL DIFF tool the locations of flowing fractures and their transmissivities were detected. Simultaneously, the electric conductivity (EC) of the drillhole water and fracture-specific water, temperature of the drillhole water, single point resistance (SPR) of the drillhole wall and the prevailing water pressure profile were measured. Water loss measurements were done after the drilling by the tool developed by Posiva. The equipment was in test use during the measurements

  9. Drilling and associated drillhole measurements of the pilot hole ONK-PH12

    International Nuclear Information System (INIS)

    Toropainen, V.; Tarvainen, A.-M.; Poellaenen, J.; Pekkanen, J.; Pere, T.; Kaepyaho, E.; Lahti, M.


    The construction of the ONKALO access tunnel started in September 2004 at Olkiluoto. Most of the investigations related to the construction of the access tunnel aim to ensure successful excavations, reinforcement and sealing. Pilot holes are drillholes, which are core drilled along the tunnel profile. The length of the pilot holes typically varies from several tens of metres to a couple of hundred metres. The pilot holes are aimed to confirm the quality of the rock mass for tunnel construction, and in particular to identify water conductive fractured zones and to provide information that could result in modifications of the existing construction plans. The pilot hole ONK-PH12 was drilled from ONKALO chainage 4092 to chainage 4215 in January 2010. The length of the hole is 123.96 metres. The drilling method was orientated core drilling. The deviation of the drillhole was measured during and after the drilling phase. Electric conductivity was measured from the collected returning water samples. Logging of the core samples included the following parameters: lithology, foliation, fracturing, fracture frequency, RQD, fractured zones, core loss, and weathering. The rock mechanical logging was based on Q-classification. The test to determine rock strength and deformation were made with Rock Tester -equipment. Water conductivity of the fractures or fractured zones was measured by Posiva Flow Log equipment. The measurements were done in two phases. During flow measurements also grounding resistance electric conductivity and temperature were measured. In flow logging test, sections of 0.5 m with increments of 0.1 m were used. Water loss measurements were conducted in the drillhole section 5.0-123.85 m dhd. Geophysical logging as well as optical and acoustic imaging of the pilot hole included the fieldwork of all surveys, the integration of the data as well as interpretation of the acoustic and drillhole radar data. Groundwater sampling was not applicable because no

  10. Thermal conductivities and diffusivities of rocks in four shallow ONKALO holes and drillholes OL-KR46 and OL-KR56

    International Nuclear Information System (INIS)

    Korpisalo, A.; Suppala, I.; Kukkonen, I.; Koskinen, T.


    The thermal drillhole device (76 mm drillholes) used in this study for determining thermal properties of rocks in situ was developed and constructed under TERO projects in Geological Survey of Finland with Posiva in early 2000's. After the renovation of the device in 2010, the new TERO76 device has now been taken into the productive use. In addition to the numerical inversion technique a rapid interpretation tool makes it possible to calculate the first estimates of thermal properties of the measurements already in the field. The thermal properties of the measurements are estimated by using both a numerical optimization and a simple solution of infinite line model. Because of the unique measurement geometry only the thermal conductivities can directly be estimated accurately (5 %) using the late times of heating periods. The methods can't directly give the thermal diffusivities or heat capacities at a necessary accuracy. However, thermal diffusivities can be estimated by using the specific heat capacities and densities of the known rock types or the laboratory results on diffusivity-conductivity relationship of different Olkiluoto rock types. The latter technique is applied in this study. Thermal properties were measured in four shallow ONKALO drillholes (ONK-PP379, ONK-PP380, ONK-PP381, ONK-PP382) in the Demonstration tunnel 2 (ONK-TDT-4399-30) at +420 m level and in deep drillholes OL-KR46 and OL-KR56 from the surface. In the drillholes in tunnel, the average numerical values fall within 3.31 and 4.19 Wm - 1 K- 1 for the conductivities and 1.75-2.26 x 10 -6 m 2 s -1 for the diffusivities. The corresponding analytical values are within 3.19-3.99 Wm -1 K -1 and 1.68-2.15 x 10 -6 m 2 s -1 . In drillholes OL-KR46 and OL-KR56, the average numerical values fall within 3.42-4.06 and 3.30-3.77 Wm -1 K -1 for the conductivities and 1.81-2.18 and 1.75-2.02 x 10 -6 m 2 s -1 for the diffusivities. The corresponding average analytical conductivities fall within 3.22-3.81 and

  11. Posiva microseismic network. Core drilling of drillholes ONK-PP348...351 in ONKALO at Olkiluoto 2012

    Energy Technology Data Exchange (ETDEWEB)

    Toropainen, V. [Suomen Malmi Oy, Espoo (Finland)


    Suomen Malmi Oy (Smoy) core drilled four drillholes for the Posiva's ONKALO microseismic network in ONKALO at Eurajoki, 2012. The drillholes are used for geophone instrumentation and geological characterization. The drillholes ONKPP348... 351 were core drilled in February 2012. All the drillholes are ∼ 9.40 m by length. The drillholes are 56.5 mm by diameter. The drillholes were drilled in deep angles to the floors of the access tunnel and three niches near each other at access tunnel chainages 3019 - 3080. The hydraulic DE 130 drilling rig was used. The drilling water was taken from the ONKALO drilling water pipeline and premixed sodium fluorescein was used as a label agent in the drilling water. The drillholes were measured with EMS deviation survey tool. In addition to drilling the drillcores were logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. The main rock types in the drillcores are diatexitic gneiss and pegmatitic granite. The average fracture frequency of the drillcores range from 1.2 to 2.4 pc/m and the average RQD value from 96.6 % to 98.6 %. Two fractured zones were intersected. (orig.)

  12. Posiva microseismic network. Core drilling of drillholes ONK-PP348...351 in ONKALO at Olkiluoto 2012

    International Nuclear Information System (INIS)

    Toropainen, V.


    Suomen Malmi Oy (Smoy) core drilled four drillholes for the Posiva's ONKALO microseismic network in ONKALO at Eurajoki, 2012. The drillholes are used for geophone instrumentation and geological characterization. The drillholes ONKPP348... 351 were core drilled in February 2012. All the drillholes are ∼ 9.40 m by length. The drillholes are 56.5 mm by diameter. The drillholes were drilled in deep angles to the floors of the access tunnel and three niches near each other at access tunnel chainages 3019 - 3080. The hydraulic DE 130 drilling rig was used. The drilling water was taken from the ONKALO drilling water pipeline and premixed sodium fluorescein was used as a label agent in the drilling water. The drillholes were measured with EMS deviation survey tool. In addition to drilling the drillcores were logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. The main rock types in the drillcores are diatexitic gneiss and pegmatitic granite. The average fracture frequency of the drillcores range from 1.2 to 2.4 pc/m and the average RQD value from 96.6 % to 98.6 %. Two fractured zones were intersected. (orig.)

  13. Drilling and the associated drillhole measurements of the pilot hole ONK-PH7

    International Nuclear Information System (INIS)

    Oehberg, A.; Kemppainen, K.; Lampinen, H.; Niemonen, J.; Poelloenen, J.; Rouhiainen, P.; Rautio, T.; Tarvainen, A.-M.


    The construction of the ONKALO access tunnel started in September 2004 at Olkiluoto. Most of the investigations related to the construction of the access tunnel aim to ensure successful excavations, reinforcement and sealing. Pilot holes are drillholes, which are core drilled along the tunnel profile. The length of the pilot holes typically varies from several tens of metres to a couple of hundred metres. The pilot holes are aimed to confirm the quality of the rock mass for tunnel construction, and in particular to identify water conductive fractured zones and to provide information that could result in modifications of the existing construction plans. The pilot hole ONK-PH7 was drilled from chainage 1880 to chainage 1980.31 in February 2007. The length of the hole is 100.31 m. The aim during the drilling work was to orient core samples as much as possible. The deviation of the drillhole was measured during and after the drilling phase. Electric conductivity was measured from the collected returning water samples. Logging of the core samples included the following parameters: lithology, foliation, fracturing, fracture frequency, RQD, fractured zones, core loss and weathering. The rock mechanical logging was based on Q-classification. The tests to determine rock strength and deformation properties were made with a Rock Tester-equipment. Difference Flow method was used for the determination of hydraulic conductivity in fractures and fractured zones in the drillhole. The overlapping i.e. the detailed flow logging mode was used. Besides flow logging Single Point Resistance (SPR), Electric Conductivity (EC) and temperature of the drillhole water were also measured. The flow logging was performed with 0.5 m section length and with 0.1 m depth increment. Water loss measurements were conducted between the hole depth of 1.18 m and the hole bottom. Geophysical logging and optical imaging of the pilot hole included the fieldwork of all surveys, the integration of the data as

  14. Core drilling of boreholes ONK-KR1, ONK-KR2, ONK-KR3, ONK-KR4 and ONK-PVA1 in ONKALO at Olkiluoto 2005

    Energy Technology Data Exchange (ETDEWEB)

    Rautio, T. [Suomen Malmi Oy, Espoo (Finland)


    Posiva Oy submitted am application for the Decision in Principle (the final disposal facility for spent nuclear fuel at Olkiluoto, Eurajoki) to the Finnish Government in May 1999. A positive decision was made at the end of 2000 by the Government The Finnish Parliament ratified the Decision in Principle in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, ONKALO, will be constructed. The investigation programme on the influence of grouting in ground-water chemistry will be started by Posiva. The programme consists of long-term and short-term effects of grouting and the influence of grouting at different distances from the tunnel on groundwater conditions. As a part of this Suomen Malmi oy (Smoy) core drilled four boreholes in ONKALO. The identification numbers of thee boreholes are ONK-KR1, ONK-KR2, ONK-KR3 and ONK-KR4. An additional borehole ONK-PVA1 was core drilled for long-term monitoring purposes in a place where no grouting is planned to be done.The diameter of the borehole sis 75.7 mm A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. The volume of the drilling water and the returning water were recorded as well as the pressure of the drilling water. The objective of these measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The volume of the used drilling water was about 16 m{sup 3} and the measured volume of the returning water was about 11 dm{sup 3} in boreholes. The deviation of the boreholes was measured with the deviation measuring instrument EMS. The main rock types are migmatitic mica gneiss and granite. Filled fractures are most common type of fractures. The average fracture frequency of the boreholes varies from 0.6 to 3.1 pcs/m. The average RQD

  15. Core drilling of boreholes ONK-KR1, ONK-KR2, ONK-KR3, ONK-KR4 and ONK-PVA1 in ONKALO at Olkiluoto 2005

    International Nuclear Information System (INIS)

    Rautio, T.


    Posiva Oy submitted am application for the Decision in Principle (the final disposal facility for spent nuclear fuel at Olkiluoto, Eurajoki) to the Finnish Government in May 1999. A positive decision was made at the end of 2000 by the Government The Finnish Parliament ratified the Decision in Principle in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, ONKALO, will be constructed. The investigation programme on the influence of grouting in ground-water chemistry will be started by Posiva. The programme consists of long-term and short-term effects of grouting and the influence of grouting at different distances from the tunnel on groundwater conditions. As a part of this Suomen Malmi oy (Smoy) core drilled four boreholes in ONKALO. The identification numbers of thee boreholes are ONK-KR1, ONK-KR2, ONK-KR3 and ONK-KR4. An additional borehole ONK-PVA1 was core drilled for long-term monitoring purposes in a place where no grouting is planned to be done.The diameter of the borehole sis 75.7 mm A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. The volume of the drilling water and the returning water were recorded as well as the pressure of the drilling water. The objective of these measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The volume of the used drilling water was about 16 m 3 and the measured volume of the returning water was about 11 dm 3 in boreholes. The deviation of the boreholes was measured with the deviation measuring instrument EMS. The main rock types are migmatitic mica gneiss and granite. Filled fractures are most common type of fractures. The average fracture frequency of the boreholes varies from 0.6 to 3.1 pcs/m. The average RQD value of

  16. Drillings and associated drillhole measurements of the investigation holes in the EDZ tunnel at Chainage 3620

    International Nuclear Information System (INIS)

    Sacklen, N.; Hurmerinta, E.; Pekkanen, J.; Tarvainen, A.-M.; Toropainen, V.; Kosunen, P.


    for repeat investigations after excavation to recognise the excavation induced changes in the parameters measured. In addition to the two pilot holes, seven shorter, 5 - 8 m long investigation drillholes (ONK-PP202 -PP205 and ONK-PP207 -PP209) were drilled for the purpose of defining hydrological baseline conditions under the tunnel floor before excavation inside the EDZ tunnel. Logging of the core samples included the following parameters: lithology, foliation, fracturing, fracture frequency, RQD, fractured zones, core loss, and weathering. The rock mechanical logging was based on Q-classification. Core logging follows the normal Posiva's core logging procedures. Hydraulic conductivity of the fractures or fractured zones was measured with Posiva Flow Log / Difference flow method in drillholes ONK-PP200, ONK-PP204, ONK-PP205 and ONK-PP207 - PP209. The measurements were done in three phases. During flow measurements also electric conductivity, the single point resistance and temperature were measured. The drillholes were measured with a 0.5 m section length using a 0.1 m and/or 0.02 m point interval. The measured drillholes were open. The surrounding drillholes were open or in overpressure by using packers. Geophysical logging and optical imaging of the pilot hole included the fieldwork of all surveys, the integration of the data as well as interpretation of the acoustic and drillhole radar data. (orig.)

  17. Drilling and associated drillhole measurements of the pilot hole ONK-PH11

    International Nuclear Information System (INIS)

    Karttunen, P.; Mancini, P.; Pekkanen, J.; Poellaenen, J.; Tarvainen, A.-M.; Toropainen, V.; Pere, T.


    The construction of the ONKALO access tunnel started in September 2004 at Olkiluoto. Most of the investigations related to the construction of the access tunnel aim to ensure successful excavations, reinforcement and sealing. Pilot holes are drillholes, which are core drilled along the tunnel profile. The length of the pilot holes typically varies from several tens of metres to a couple of hundred metres. The pilot holes are aimed to confirm the quality of the rock mass for tunnel construction, and in particular to identify water conductive fractured zones and to provide information that could result in modifications of the existing construction plans. The pilot hole ONK-PH11 was drilled from chainage 3922 to chainage 4053 in October 2009. The length of the hole is 131.21 metres. The aim during the drilling work was to orient core samples as much as possible. The deviation of the drillhole was measured during and after the drilling phase. Electric conductivity was measured from the collected returning water samples. Hydraulic conductivity of the fractures or fractured zones was measured by Posiva Flow Log equipment. During flow measurements also electric conductivity and temperature were measured. In flow logging test sections of 0.5 m and increments of 0.1 m were used. The water loss measurements were performed after drilling was completed by the drilling company. Logging of the core samples included the following parameters: lithology, foliation, fracturing, RQD, fractured zones, weathering and possible intersections. The rock mechanical logging was based on Q-classification. The rock strength and deformation were determined with Rock Tester -equipment. Geophysical logging and optical imaging of the pilot hole included the fieldwork of all surveys, the integration of the data as well as interpretation of the acoustic and drillhole radar data. The groundwater samples were collected from the open hole without any packers. The collected groundwater samples were

  18. Results of monitoring at Olkiluoto in 2011. Hydrogeochemistry

    International Nuclear Information System (INIS)

    Penttinen, T.; Partamies, S.; Lahdenperae, A.-M.; Ahokas, T.; Lamminmaeki, T.; Lehtinen, A.


    The construction work of underground research facility ONKALO started in the June 2004. Possible changes caused by the construction of the disposal facility in the chemical environment in shallow and deep groundwaters are monitored on a regular basis. This report presents the hydrogeochemical monitoring measurements and observations made in 2011. A total of 56 shallow groundwater monitoring samples were taken in 2011 (36 monitoring and 56 infiltration area). The pH values varied from acidic (5.7) to slightly alkaline (7.9). In OL-PVP18A, TDS remained still at the high level as well as the sulphate concentration. In OL-PVP17, OL-PVP4A and OL-PP2 is still observed slightly increased sulphate concentrations. Seasonal fluctuation has been observed in OL-PVP18A, OL-PVP20, OL-PVP31A and OL-PP39. A slightly upward trend in TDS has been observed near the Olkiluoto Natura area (and the old forests preservation area) in OL-PVP4A and OL-PP2. Twenty-two deep groundwater samplings were carried out in 13 different drillholes and altogether 43 groundwater samples from ONKALO during the year 2011. The results from ground surface showed some indications of changes in groundwater compositions, which can be connected to high hydraulic gradient of ONKALO or to joint effect of the ONKALO and an open drillhole. The results in sampling sections of OL-KR25 showed dilution due to the leak in packering systems in OL-KR28. The results in two monitoring sections OL-KR25 T 91 and OL-KR25 T 337 3 showed also heavy stable isotopic composition, which indicate some input of Korvensuo water. The sample from OL-KR37 T 165 continued dilution trend, which is significant and supports the earlier observations. Salinity of section OL-KR9 T 468 has recovered from previous sampling in 2009. The results of samples of fractures with low transmissivity are rather similar to the baseline data. However, slightly less saline characteristics were observed in very low transmissive fractures of ONK-PP262 and ONK-PP

  19. Drilling and associated drillhole measurements of the pilot hole ONK-PH9

    International Nuclear Information System (INIS)

    Karttunen, P.; Pekkanen, J.; Poellaenen, J.; Tarvainen, A.-M.; Toropainen, V.; Lamminmaeki, T.; Kosunen, P.


    The construction of the ONKALO access tunnel started in September 2004 at Olkiluoto. Most of the investigations related to the construction of the access tunnel aim to ensure successful excavations, reinforcement and sealing. Pilot holes are drillholes, which are core drilled along the tunnel profile. The length of the pilot holes typically varies from several tens of metres to a couple of hundred metres. The pilot holes are aimed to confirm the quality of the rock mass for tunnel construction, and in particular to identify water conductive fractured zones and to provide information that could result in modifications of the existing construction plans. The pilot hole ONK-PH9 was drilled from chainage 3263 to chainage 3413.27 in November 2008. The length of the hole is 150.3 metres. The aim during the drilling work was to orient core samples as much as possible. The deviation of the drillhole was measured during and after the drilling phase. Electric conductivity was measured from the collected returning water samples. Hydraulic conductivity of the fractures or fractured zones was measured by Posiva Flow Log equipment. The measurements were done in two phases. During flow measurements also electric conductivity, grounding resistance and temperature were measured. In flow logging test sections of 0.5 m and increments of 0.1 m were used. The water loss measurements were performed after drilling was completed by the drilling company. Logging of the core samples included the following parameters: lithology, foliation, fracturing, fracture frequency, RQD, fractured zones, core loss, and weathering. The rock mechanical logging was based on Q-classification. The rock strength and deformation were determined with Rock Tester equipment. Geophysical logging and optical imaging of the pilot hole included the fieldwork of all surveys, the integration of the data as well as interpretation of the acoustic and drillhole radar data. One of the objectives of the geochemical study

  20. Drilling and associated drillhole measurements of the pilot hole ONK-PH10

    International Nuclear Information System (INIS)

    Mancini, P.; Karttunen, P.; Lokkila, M.; Pekkanen, J.; Poellaenen, J.; Tarvainen, A.-M.; Toropainen, V.; Kosunen, P.; Pere, T.


    The construction of the ONKALO access tunnel started in September 2004 at Olkiluoto. Most of the investigations related to the construction of the access tunnel aim to ensure successful excavations, reinforcement and sealing. Pilot holes are drillholes, which are core drilled along the tunnel profile. The length of the pilot holes typically varies from several tens of metres to a couple of hundred metres. The pilot holes are aimed to confirm the quality of the rock mass for tunnel construction, and in particular to identify water conductive fractured zones and to provide information that could result in modifications of the existing construction plans. The pilot hole ONK-PH10 was drilled from chainage 3459 to chainage 3639 in March 2009. The length of the hole is 180.00 metres. The drilling was done as orientated core drilling. The deviation of the drillhole was measured during and after the drilling phase. Electric conductivity was measured from the collected returning water samples. Logging of the core samples included the following parameters: lithology, foliation, fracturing, fracture frequency, RQD, fractured zones, core loss, and weathering. The rock mechanical logging was based on Q-classification. The test to determine rock strength and deformation were made with Rock Tester -equipment. Water conductivity of the fractures or fractured zones was measured by Posiva Flow Log equipment. The measurements were done in two phases. During flow measurements also grounding resistance electric conductivity and temperature were measured. In flow logging test, sections of 0.5 m with increments of 0.1 m were used. Water loss measurements were conducted in the hole section 3.70-180.00 m dhd. Geophysical logging and optical imaging of the pilot hole included the fieldwork of all surveys, the integration of the data as well as interpretation of the acoustic and drillhole radar data. One of the objectives of the geochemical study was to get information of the composition of

  1. Installation of groundwater observation tubes OL-PVP36-38 and drilling of shallow drillholes OL-PP70-71 at Olkiluoto in Eurajoki 2011

    International Nuclear Information System (INIS)

    Toropainen, V.


    In order to widen the groundwater monitoring network at Olkiluoto, Posiva Oy contracted Suomen Malmi Oy (Smoy) to install new groundwater observation tubes to three locations and to drill two shallow drillholes with standpipes. The identification numbers of the groundwater observation tubes are OL-PVP36, OL-PVP37A, 37B, 37C, OL-PVP38A, 38B, 38C and 38D, and the shallow drillholes are named OL-PP70 and OL-PP71. The observation tubes were installed and the shallow holes drilled between September 22nd and October 12th in 2011. The drilling rig used in the installation work was a GM-200 rig. Drilling equipment consisted of casing tubes (90/77 mm) with drilling bit, 55 mm geo rods and 64 mm drilling bits and T76-equipment for drilling the shallow holes. Monitoring pipes (PVC, 60/52 mm) were lowered into the holes inside the casings. The monitoring pipes consist of a lower section of riser pipe, a middle section of screen pipe and an upper section of riser pipe. The screen pipe slot size is 0.3 mm and the length of the screen section is two metres. Protective stainless steel covers with lock-up caps were installed around the monitoring tubes and the shallow drillholes. In addition to the installation of the tubes, the work included water level measurements after installation. The core samples of the shallow drillholes were logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. (orig.)

  2. Installation of groundwater observation tubes OL-PVP36-38 and drilling of shallow drillholes OL-PP70-71 at Olkiluoto in Eurajoki 2011

    Energy Technology Data Exchange (ETDEWEB)

    Toropainen, V. [Suomen Malmi Oy, Espoo (Finland)


    In order to widen the groundwater monitoring network at Olkiluoto, Posiva Oy contracted Suomen Malmi Oy (Smoy) to install new groundwater observation tubes to three locations and to drill two shallow drillholes with standpipes. The identification numbers of the groundwater observation tubes are OL-PVP36, OL-PVP37A, 37B, 37C, OL-PVP38A, 38B, 38C and 38D, and the shallow drillholes are named OL-PP70 and OL-PP71. The observation tubes were installed and the shallow holes drilled between September 22nd and October 12th in 2011. The drilling rig used in the installation work was a GM-200 rig. Drilling equipment consisted of casing tubes (90/77 mm) with drilling bit, 55 mm geo rods and 64 mm drilling bits and T76-equipment for drilling the shallow holes. Monitoring pipes (PVC, 60/52 mm) were lowered into the holes inside the casings. The monitoring pipes consist of a lower section of riser pipe, a middle section of screen pipe and an upper section of riser pipe. The screen pipe slot size is 0.3 mm and the length of the screen section is two metres. Protective stainless steel covers with lock-up caps were installed around the monitoring tubes and the shallow drillholes. In addition to the installation of the tubes, the work included water level measurements after installation. The core samples of the shallow drillholes were logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. (orig.)

  3. Drilling and the associated drillhole measurements of the pilot hole ONK-PH8

    International Nuclear Information System (INIS)

    Karttunen, P.; Poellaenen, J.; Rautio, T.; Tarvainen, A.-M.; Lamminmaeki, T.; Kemppainen, K.; Kosunen, P.; Lampinen, H.


    The construction of the ONKALO access tunnel started in September 2004 at Olkiluoto. Most of the investigations related to the construction of the access tunnel aim to ensure successful excavations, reinforcement and sealing. Pilot holes are drillholes, which are core drilled along the tunnel profile. The length of the pilot holes typically varies from several tens of metres to a couple of hundred metres. The pilot holes are aimed to confirm the quality of the rock mass for tunnel construction, and in particular to identify water conductive fractured zones and to provide information that could result in modifications of the existing construction plans. The pilot hole ONK-PH8 was drilled from chainage 3116 to chainage 3266.29 in June- July 2008. The length of the hole is 150.29 metres. The aim during the drilling work was to orient core samples as much as possible. The deviation of the drillhole was measured during and after the drilling phase. Electric conductivity was measured from the collected returning water samples. Water conductivity of the fractures or fractured zones was measured by Posiva Flow Log equipment. The measurements were done in two phases. During flow measurements also grounding resistance, electric conductivity and temperature were measured. In flow logging test sections of 0.5 m and increments of 0.1 m were used. The water loss measurements failed. Logging of the core samples included the following parameters: lithology, foliation, fracturing, fracture frequency, RQD, fractured zones, core loss, and weathering. The rock mechanical logging was based on Q-classification. The test to determine rock strength and deformation were made with Rock Tester-equipment. Geophysical logging and optical imaging of the pilot hole included the fieldwork of all surveys, the integration of the data as well as interpretation of the acoustic and drillhole radar data. One of the objectives of the geochemical study was to get information of the composition of ONKALO

  4. Drilling and the associated drillhole measurements of the pilot hole ONK-PH6

    International Nuclear Information System (INIS)

    Oehberg, A.; Hirvonen, H.; Kemppainen, K.; Niemonen, J.; Nordbaeck, N.; Poellaenen, J.; Rouhiainen, P.; Rautio, T.; Tarvainen, A.-M.


    The construction of the ONKALO access tunnel started in September 2004 at Olkiluoto. Most of the investigations related to the construction of the access tunnel aim to ensure successful excavations, reinforcement and sealing. Pilot holes are drillholes, which are core drilled along the tunnel profile. The length of the pilot holes typically varies from several tens of metres to a couple of hundred metres. The pilot holes are aimed to confirm the quality of the rock mass for tunnel construction, and in particular to identify water conductive fractured zones and to provide information that could result in modifications of the existing construction plans. The pilot hole ONK-PH6 was drilled from chainage 1404 to chainage 1559 in September 2006. The length of the hole is 155.04 m. The aim during the drilling work was to orient core samples as much as possible. The deviation of the drillhole was measured during and after the drilling phase. One steering operation by wedging was made at the hole depth of 94.05 metres (top of the wedge). Electric conductivity was measured from the collected returning water samples. Logging of the core samples included the following parameters: lithology, foliation, fracturing, fracture frequency, RQD, fractured zones, core loss and weathering. The rock mechanical logging was based on Q-classification. The tests to determine rock strength and deformation properties were made with a Rock Tester-equipment. Difference Flow method was used for the determination of hydraulic conductivity in fractures and fractured zones in the drillhole. The overlapping i.e. the detailed flow logging mode was used. Besides flow logging Single Point Resistance (SPR), Electric Conductivity (EC) and temperature of the drillhole water were also measured. The flow logging was performed with 0.5 m section length and with 0.1 m depth increment. Water loss tests were conducted in the hole excluding the section 89.04 - 101.04 metres due to the wedge. Geophysical logging

  5. Installation of groundwater observation tubes OL-PVP39 - 40 and drilling of shallow drillhole OL-PP90 at Olkiluoto in Eurajoki 2013

    Energy Technology Data Exchange (ETDEWEB)

    Toropainen, V. [Suomen Malmi Oy, Espoo (Finland)


    In order to extend the groundwater monitoring network at Olkiluoto, Posiva Oy contracted Suomen Malmi Oy (Smoy) to install new groundwater observation tubes to two locations and to drill one shallow drillhole with a standpipe. The identification numbers of the groundwater observation tubes are OL-PVP39, OL-PVP40A and 40B, and the shallow drillhole is named OL-PP90. The observation tubes were installed and the shallow hole drilled between July 29th and August 6th in 2013. The drilling rig used in the installation work was a GM-200 rig. Drilling equipment consisted of casing tubes (v 90/77 mm) with drilling bit, 55 mm geo rods and 64 mm drilling bits and T76-equipment for drilling the shallow hole. Monitoring pipes (PVC, v 60/52 mm) were lowered into the holes inside the casings. The monitoring pipes consist of a lower section of riser pipe, a middle section of screen pipe and an upper section of riser pipe. The screen pipe slot size is 0.3 mm and the length of the screen section is two or three metres. Protective stainless steel covers with lock-up caps were installed around the monitoring tubes and the shallow drillholes. In addition to the installation of the tubes, the work included water level measurements after installation. The core samples of the shallow drillhole were logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. (orig.)

  6. Core drilling of deep drillhole OL-KR45 at Olkiluoto in Eurajoki 2007

    International Nuclear Information System (INIS)

    Toropainen, V.


    Posiva Oy submitted an application to the Finnish Government in May 1999 for the Decision in Principle to choose Olkiluoto in the municipality of Eurajoki as the site of the final disposal facility for spent nuclear fuel. A positive decision was made at the end of 2000 by the Government. The Finnish Parliament ratified the decision in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, ONKALO, will be constructed. As a part of the investigations Suomen Malmi Oy (Smoy) core drilled 1023.30 m and 44.75 m deep drillholes with a diameter of 75.7 mm at Olkiluoto in June - September 2007. The identification numbers of the drillholes are OL-KR45 and OL-KR45B, respectively. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. Both the volume and the electric conductivity of the returning and drilling waters were recorded. The drill rig was computer controlled and during drilling the computer recorded drilling parameters. The objective of all these measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The total volumes of the used drilling and washing water were 1186 m 3 and 19 m 3 in drillholes OL-KR45 and OL-KR45B, respectively. Measured volumes of the returning water were 962 m 3 in drillhole OL-KR45 and 15 m 3 in drillhole OL-KR45B. The deviation of the drillholes was measured with the deviation measuring instruments EMS and Maxibor II. Uniaxial compressive strength, Young's Modulus and Poisson's ratio were measured from the core samples. The average uniaxial compressive strength is 126.2 MPa, the average Young's Modulus is 42.5 GPa and the average Poisson's ratio is 0.21. The main rock types are veined and diatexitic gneisses, pegmatitic granite and tonalitic

  7. Mise-a-la-masse survey in the HYDCO Niche 2011

    International Nuclear Information System (INIS)

    Ahokas, T.; Heikkinen, E.; Hurmerinta, E.


    Posiva Oy carries out a programme for spent nuclear fuel disposal. Subsurface characterization work is underway at the ONKALO tunnel, in Olkiluoto. Detailed hydrological conductivity properties in an averagely fractured rock mass are studied in the HYDCO niche. Crosshole mise-a-la-masse survey was carried out between the two 23-24 m long horizontal drillholes, ONK-PP262 and ONK-PP274 that are 3 m apart from each other, and between the drillhole and the access tunnel. The field work was carried out in April- May 2011. The survey was aimed to define continuity of the fractures between the drillholes. Nine current earthing stations in drillhole ONK-PP262 and 13 stations in ONK-PP274 were used. Earthings were placed at fractures or conductive layers detected in core logging, assessed with geophysical logging and imaging, and with Posiva flow log measurement. Earthing used a 0.5 m long electrode assembly operated with a wireline. The potential profile was measured in the adjacent drillhole at 0.1 m spacing, using a similar electrode assembly and wireline. Potential was measured also on 130 m long profile along the tunnel wall from the earthings in drillhole ONK-PP262. The remote voltage reference and the current earthing were placed offset from the survey area. The equipment used in survey consists of ABEM Terrameter resistivity tool, as well as software, cable winch and downhole probes belonging to Posiva Flow Log tool. The high resistivity bedrock, and electrically fairly weakly conductive fractures residing in the rock mass provide rather small conductivity contrast. Nevertheless there are connections between several fractures or groups of fractures between the drillholes. Several fractures merge together in the electrical potential response. Interpretation defined six zones between the drillholes where fractures indicate continuity, and may serve as hydraulic interference pathway. One of the zones is extending also to the tunnel wall. Measurements and interpretation

  8. Drilling and the associated drillhole measurements of the pilot hole ONK-PH5

    International Nuclear Information System (INIS)

    Oehberg, A.; Hirvonen, H.; Jurvanen, T.; Kemppainen, K.; Mustonen, A.; Niemonen, J.; Poellaenen, J.; Rouhiainen, P.; Rautio, T.


    The construction of the ONKALO access tunnel started in September 2004 at Olkiluoto. Most of the investigations related to the construction of the access tunnel aim to ensure successful excavations, reinforcement and sealing. Pilot holes are drillholes, which are core drilled along the tunnel profile. The length of the pilot holes typically varies from several tens of metres to a couple of hundred metres. The pilot holes are aimed to confirm the quality of the rock mass for tunnel construction, and in particular to identify water conductive fractured zones and to provide information that could result in modifications of the existing construction plans. The pilot hole ONK-PH5 was drilled from chainage 991.4 to chainage 1194 in January 2006. The length of the hole is 202.64 m and the vertical depth of the hole from zero level is about 88.2-107.5 m. The aim during the drilling work was to orient core samples as much as possible. The deviation of the drillhole was measured during and after the drilling phase. One steering operation by wedging was made at the hole depth of 128.58 metres. Electric conductivity was measured from the collected returning water samples. Logging of the core samples included the following parameters: lithology, foliation, fracturing, fracture frequency, RQD, fractured zones, core loss and weathering. The rock mechanical logging was based on Q-classification. The tests to determine rock strength and deformation properties were made with a Rock Tester-equipment. Due to high inflow (c. 200 L/min) mainly from the depth section 56-58 metres no geophysical surveys were carried out in the hole. Flow logging was carried out only from 58 metres to the bottom of the hole. Difference Flow method was used for the determination of hydraulic conductivity in fractures and fractured zones in the drillhole. The overlapping i.e. the detailed flow logging mode was used. The flow logging was performed with 0.5 m section length and with 0.1 m depth increment. Flow

  9. Core drilling of deep drillhole OL-KR50 at Olkiluoto in Eurajoki 2008

    International Nuclear Information System (INIS)

    Toropainen, V.


    As a part of the confirming site investigations at Olkiluoto, Suomen Malmi Oy (Smoy) core drilled 939.33 m and 45.44 m deep drillholes with a diameter of 75.7 mm at Olkiluoto in September - November 2008. The identification numbers of the drillholes are OL-KR50 and OL-KR50B, respectively. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. Both the volume and the electric conductivity of the returning and drilling water were recorded. The drill rig was computer controlled and the computer recorded drilling parameters during drilling. The objective of the measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The total volumes of the used drilling and washing water were 1135 m 3 and 20 m 3 in the drillholes OL-KR50 and OL-KR50B, respectively. The measured volume of the returning water in the drillhole OL-KR50 was 954 m 3 . The deviation of the drillholes was measured with the deviation measuring instruments EMS and Maxibor II. Uniaxial compressive strength, Young's Modulus and Poisson's ratio were measured from the core samples. The average uniaxial compressive strength was 129.7 MPa, the average Young's Modulus was 45.8 GPa and the average Poisson's ratio was 0.15. The main rock types were veined and diatexitic gneisses, pegmatitic granite and tonaliticgranodioritic-granitic gneiss. The average fracture frequency is 2.0 pcs/m in drillhole OL KR50 and 3.6 pcs/m in the drillhole OL-KR50B. The average RQD values are 96.1 % and 94.3 %, respectively. 39 fractured zones were penetrated by drillhole OL-KR50 and four by drillhole OL-KR50B. (orig.)

  10. Core drilling of deep drillhole OL-KR48 at Olkiluoto in Eurajoki 2007

    International Nuclear Information System (INIS)

    Toropainen, V.


    Posiva Oy submitted an application for the Decision in Principle to the Finnish Government in May 1999. A positive decision was made at the end of 2000 by the Government. The Finnish Parliament ratified the Decision in Principle on the final disposal facility for spent nuclear fuel at Olkiluoto, Eurajoki in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, ONKALO, will be constructed. As a part of the investigations Suomen Malmi Oy (Smoy) core drilled 530.11 m deep drillhole (identification number OL-KR48) with a diameter of 75.7 mm at Olkiluoto in summer 2007. This drillhole was aimed to get additional information of the quality of bedrock in the area, where a new shaft with a diameter of 3.5 m is planned. The drillhole is nearly vertical, and its deviation was minimized with directional drilling. The drillhole requires cleaning and stabilization for down the hole measurements. To obtain more information about bedrock and groundwater properties, a set of monitoring measurements and samplings from the drilling and returning water was carried out during. Both the volume and the electric conductivity of the returning and drilling waters were recorded. The drill rig was computer controlled and recorded drilling parameters. Sodium fluorescein was used as a label agent in the drilling water. The total volume of the used drilling and washing water was 438 m 3 . Measured volume of the returning water was 123 m 3 . The deviation of the drillhole was measured with the deviation measuring instruments DeviTool and EMS. The results of the EMS measurements indicate that the drillhole deviates 2.51 m north and 0.51 m west from the target point at the drillhole depth of 528 m. Results of DeviTool indicate deviation of 1.44 m north and 0.40 m west at depth of 530 m. Uniaxial compressive strength (113.0 Mpa), Young's Modulus (36.2 GPa) and

  11. Core drilling of deep drillhole OL-KR54 at Olkiluoto in Eurajoki 2010

    International Nuclear Information System (INIS)

    Toropainen, V.


    As a part of the confirming site investigations at Olkiluoto, Suomen Malmi Oy (Smoy) core drilled a 500.18 m deep drillhole with a diameter of 75.7 mm at Olkiluoto in July - August 2010. The identification number of the drillhole is OL-KR54. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. Both the volume and the electric conductivity of the returning and drilling water were recorded. The drill rig was computer controlled and the computer recorded drilling parameters during drilling. The objective of the measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The total volume of the used drilling, washing and flushing water was 382 m 3 . The measured volume of the returning water in the drillhole was 334 m 3 . The deviation of the drillhole was measured with the deviation measuring instruments EMS and Gyro. Uniaxial compressive strength, Young's Modulus and Poisson's ratio were measured from the core samples. The average uniaxial compressive strength was 111.5 MPa, the average Young's Modulus was 43.7 GPa and the average Poisson's ratio was 0.17. The main rock types are diatexitic and veined gneisses, pegmatitic granite and mafic gneiss. The average fracture frequency is 1.6 pcs/m and the average RQD value is 97.6 %. Nine fractured zones were penetrated by the drillhole. (orig.)

  12. Drilling and the associated drillhole measurements of the pilot hole ONK-PH4

    International Nuclear Information System (INIS)

    Oehberg, A.; Heikkinen, E.; Hirvonen, H.; Kemppainen, K.; Majapuro, J.; Niemonen, J.; Poellaenen, J.; Rouhiainen, P.; Rautio, T.


    The construction of the ONKALO access tunnel started in September 2004 at Olkiluoto. Most of the investigations related to the construction of the access tunnel aim to ensure successful excavations, reinforcement and sealing. Pilot holes are drillholes, which are core drilled along the tunnel profile. The length of the pilot holes typically varies from several tens of metres to a couple of hundred metres. The pilot holes are mostly aimed to confirm the quality of the rock mass for tunnel construction, and in particular to identify water conductive fractured zones and to provide information that could result in modifications of the existing construction plans. The pilot hole ONK-PH4 was drilled in October 2005. The length of the hole is 96.01 metres. During the drilling work core samples were oriented as much as possible. The deviation of the hole was measured during and after the drilling phase. Electric conductivity was measured from the collected returning water samples. Geological logging of the core samples included the following parameters: lithology, foliation, fracturing, fracture frequency, RQD, fractured zones, core loss and weathering. The rock mechanical logging was based on Q-classification. The tests to determine rock strength and deformation properties were made with a Rock Tester-equipment. Difference Flow method was used for the determination of hydraulic conductivity in fractures and fractured zones in the hole. The overlapping i.e. the detailed flow logging mode was used. The flow logging was performed with 0.5 m section length and with 0.1 m depth increment. Water loss tests (Lugeon tests) were used to give background information for the grouting design. Geophysical logging and optical imaging of the pilot hole PH4 included the field work of all surveys, the integration of the data as well as interpretation of the acoustic and drillhole radar data. One of the objectives of the geochemical study was to get information of composition of ONKALO

  13. Core drilling of deep drillhole OL-KR57 at Olkiluoto in Eurajoki 2011-2012

    International Nuclear Information System (INIS)

    Toropainen, V.


    As a part of the confirming site investigations at Olkiluoto, Suomen Malmi Oy (Smoy) core drilled 401.71 m and 45.01 m deep drillholes, OL-KR57 and OL-KR57B, at Olkiluoto in September 2011 - January 2012. The diameter of the drillholes is 75.7 mm. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. Both the volume and the electric conductivity of the returning and drilling water were recorded. The drill rig was computer controlled and the computer recorded drilling parameters during drilling. The objective of the measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The total volumes of the used drilling, flushing and washing water were 350 m3 and 30 m3 in the drillholes OL-KR57 and OL-KR57B, respectively. The measured volumes of the returning water in the drillholes were 328 m 3 and 16.8 m 3 , respectively. The deviations of the drillholes were measured with the deviation measuring instruments EMS and Gyro. Uniaxial compressive strength, Young's Modulus and Poisson's ratio were measured from the core samples. The average uniaxial compressive strength was 123.9 MPa, the average Young's Modulus was 42.6 GPa and the average Poisson's ratio was 0.23. The main rock types are veined and diatexitic gneisses, mica gneiss and tonaliticgranodioritic- granitic gneiss. The average fracture frequency is 2.5 pcs/m in drillhole OL-KR57 and 3.3 pcs/m in the drillhole OL-KR57B. The average RQD values are 95.0 % and 93.0 %. Seven separate fractured zones were interpreted from OL-KR57 and three fractured zones from OL-KR57B. (orig.)

  14. Core drilling of deep drillhole OL-KR57 at Olkiluoto in Eurajoki 2011-2012

    Energy Technology Data Exchange (ETDEWEB)

    Toropainen, V. [Suomen Malmi Oy, Espoo (Finland)


    As a part of the confirming site investigations at Olkiluoto, Suomen Malmi Oy (Smoy) core drilled 401.71 m and 45.01 m deep drillholes, OL-KR57 and OL-KR57B, at Olkiluoto in September 2011 - January 2012. The diameter of the drillholes is 75.7 mm. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. Both the volume and the electric conductivity of the returning and drilling water were recorded. The drill rig was computer controlled and the computer recorded drilling parameters during drilling. The objective of the measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The total volumes of the used drilling, flushing and washing water were 350 m3 and 30 m3 in the drillholes OL-KR57 and OL-KR57B, respectively. The measured volumes of the returning water in the drillholes were 328 m{sup 3} and 16.8 m{sup 3}, respectively. The deviations of the drillholes were measured with the deviation measuring instruments EMS and Gyro. Uniaxial compressive strength, Young's Modulus and Poisson's ratio were measured from the core samples. The average uniaxial compressive strength was 123.9 MPa, the average Young's Modulus was 42.6 GPa and the average Poisson's ratio was 0.23. The main rock types are veined and diatexitic gneisses, mica gneiss and tonaliticgranodioritic- granitic gneiss. The average fracture frequency is 2.5 pcs/m in drillhole OL-KR57 and 3.3 pcs/m in the drillhole OL-KR57B. The average RQD values are 95.0 % and 93.0 %. Seven separate fractured zones were interpreted from OL-KR57 and three fractured zones from OL-KR57B. (orig.)

  15. Core drilling of deep drillhole OL-KR56 at Olkiluoto in Eurajoki 2011 - 2012

    Energy Technology Data Exchange (ETDEWEB)

    Toropainen, V. [Suomen Malmi Oy, Espoo (Finland)


    As a part of the confirming site investigations at Olkiluoto, Suomen Malmi Oy (Smoy) core drilled a 1201.65 m deep drillhole with a diameter of 75.7 mm at Olkiluoto in October 2011 - January 2012. The identification number of the drillhole is OL-KR56. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. Both the volume and the electric conductivity of the returning and drilling water were recorded. The drill rig was computer controlled and the computer recorded drilling parameters during drilling. The objective of the measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The total volume of the used drilling, washing and flushing water was 1628 m{sup 3}. The measured volume of the returning water in the drillhole was 1142 m{sup 3}. The deviation of the drillhole was measured with the deviation measuring instruments Reflex EMS and Reflex Gyro. The main rock types are veined and diatexitic gneisses, pegmatitic granite and mica gneiss. The average fracture frequency is 2.4 pcs/m and the average RQD value is 96.2 %. Fifty fractured zones were penetrated by the drillhole. Uniaxial compressive strength, Young's Modulus and Poisson's ratio were measured from the core samples. The average uniaxial compressive strength was 120.0 MPa, the average Young's Modulus was 38.3 GPa and the average Poisson's ratio was 0.22. (orig.)

  16. Fracture-specific pressure measurements at the Olkiluoto site in Eurajoki drillhole OL-KR39

    International Nuclear Information System (INIS)

    Ripatti, K.; Poellaenen, J.; Hurmerinta, E.; Rouhiainen, P.


    An option was built to the Posiva Flow Log, Difference flow method (PFL DIFF). A double packer device was combined together with a PFL DIFF probe. The new tool was needed for measurements of the very low hydraulic head. Indications of these were detected earlier in some fractures of drillhole OL-KR39. The target fractures could be measured with the accurate absolute pressure sensor in the PFL DIFF probe. Principles of the methods and the results of measurements are presented in this report. The measurements were carried out in drillhole OL-KR39 at the Olkiluoto investigation site between April 2011 and May 2011. The device used includes a sensor for single point resistance (SPR). SPR measurement is used to place the device accurately on the chosen fracture. The section length limited by the packers is about 1 m. The measurements were carried out in natural (i.e. un-pumped) conditions. The same measuring program was employed in all chosen fractures. Electrical conductivity (EC) of drillhole water and flow rate along the drillhole were also measured in conjunction with the pressure measurements. (orig.)

  17. Core drilling of deep drillhole OL-KR47 at Olkiluoto in Eurajoki 2007-2008

    International Nuclear Information System (INIS)

    Toropainen, V.


    As a part of the confirming site investigations for ONKALO rock characterisation facility, Suomen Malmi Oy (Smoy) core drilled 1008.76 m and 44.31 m deep drillholes with a diameter of 75.7 mm at Olkiluoto in October 2007 - January 2008. The identification numbers of the drillholes are OL-KR47 and OL-KR47B, respectively. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. Both the volume and the electric conductivity of the returning and drilling waters were recorded. The drill rig was computer controlled and during drilling the computer recorded drilling parameters. The objective of all these measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The total volumes of the used drilling and flushing water were 1229 m 3 and 13.6 m 3 in drillholes OL-KR47 and OL-KR47B, respectively. Measured volume of the returning water in drillhole OL-KR47 was 1125 m 3 , water did not return in drillhole OL-KR47B. The deviation of the drillholes was measured with the deviation measuring instruments EMS and Maxibor II. Uniaxial compressive strength, Young's Modulus and Poisson's ratio were measured from the core samples. The average uniaxial compressive strength is 92.1 MPa, the average Young's Modulus is 32.5 GPa and the average Poisson's ratio is 0.33. The main rock types are diatexitic and veined gneisses, pegmatitic granite and tonaliticgranodioritic- granitic gneiss. The average fracture frequency is 2.2 pcs / m in drillhole OL-KR47 and 3.4 pcs / m in drillhole OL-KR47B. The average RQD values were 95.3 % and 94.1 %. In drillhole OL-KR47 46 fractured zones and in drillhole OL-KR47B two fractured zones were penetrated during drilling work. (orig.)

  18. Mise-a-la-masse measurements in drillholes OL-KR4, OL-KR30 and OL-KR14 - OL-KR18 in Olkiluoto

    International Nuclear Information System (INIS)

    Kristiansson, S.; Heikkinen, P.


    Mise-a-la-masse measurements were conducted in the Olkiluoto investigation site in the time period from May to November 2007. Measurements were carried out in drillholes OL-KR4, OL-KR30 and OL-KR14 - OL-KR18. The purpose of the study was to collect data for geological modelling. The aim is to evaluate the continuity of fractures and other geological structures from a drillhole to another drillhole and from a drillhole to the ground surface. Posiva has developed electrodes for mise-a-la-masse method measurements, where the location of the electrode is between rubber disks similar to the flow guide. Rubber disks prevent leakage of current along the drillhole and focus current directly to a specific fracture. (orig.)

  19. Geophysical drillhole logging and imaging of drillholes OL-KR54, OL-KR55 and OL-KR55B at Olkiluoto in 2010 and 2011

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.; Heikkinen, E.


    Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of the drillholes OL-KR54, OL-KR55 and OL-KR55B at the Olkiluoto site in Eurajoki between August 2010 and January 2011. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. New focused resistivity, susceptibility, natural gamma and density probes were tested and compared with old probes. This report describes the major features of new probes and the comparison with old probes. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

  20. Cross-Borehole research with EMRE-system. Radiofrequency measurements in drillhole section OL-KR40 - OL-KR45 at Olkiluoto, 2009

    International Nuclear Information System (INIS)

    Korpisalo, A.; Niemelae, M.


    Posiva Oy carries out research and development work for the spent nuclear fuel disposal in Finland. The repository will be constructed deep in the crystalline bedrock at Olkiluoto island in Eurajoki. Construction of the underground characterization facility ONKALO started in 2004. Posiva Oy has been actively reviewing the methods for examining granitic i.e. crystalline bedrock properties. One of the considered methods was electromagnetic cross-borehole survey. This report describes the field work carried out in 2009 and the interpretation of the continuous wave device in one drillhole panel at 100-750 m depth level. Panel was conic in shape thus the collars were in close vicinity (about 10 m) at the earth surface and diverged in deeper parts being several hundreds of meters from each others. The works were carried out by Geological Survey of Finland. After the pioneering work in 2005 the device was repaired thoroughly and the proper functioning of the device was ensured after several tests. Geological-geophysical characterization of Olkiluoto site has been run since 1989, and more than 40 drillholes have been prepared

  1. Geophysical drillhole logging and imaging of drillholes OL-KR51, OL-KR52, OL-KR52B, OL-KR53 and OL-KR53B at Olkiluoto in 2009 and 2010

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.


    Suomen Malmi Oy conducted geophysical drillhole logging and optical imaging of the drillholes OL-KR51, OL-KR52, OL-KR52B, OL-KR53 and OL-KR53B at the Olkiluoto site in Eurajoki between November 2009 and February 2010. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

  2. Correlation of transmissive fractures in holes OL-PH1, ONK-PH2 .. ONK-PH7 and ONKALO tunnel fractures

    International Nuclear Information System (INIS)

    Palmen, J; Nummela, J.; Ahokas, H.


    In a preceding study Posiva flow logging (PFL) with a 0.5 m test interval and 10 cm steps has been used together with optical drillhole images and core logging fracture data for the exact determination of the depth of hydraulically conductive fractures in pilot holes. The fracture traces has been mapped from the ONKALO tunnel walls as a part of the systematic mapping. The mapping results has been digitized to a 3D tunnel layout in Surpac Vision programme. The data integrity and fracture trace uniqueness has been verified by Datactica Oy and further collected to a database (Rakokanta D atactica P osiva20091119.mdb). Water leakage of the mapped fractures exists as an attribute field for each fracture, but the value of the attribute has not been assessed conclusively. Those fractures mapped with leakage attribute have been defined as flowing, dripping, wet, or damp where the attribute is recorded. The fractures with no leakage attribute value appear to be dry (not leaking) or the information is not available (assessment was not performed). The water leaking surfaces on ONKALO tunnel wall have been mapped sequentially and conclusively (twice a year) as a part of the Olkiluoto monitoring program (OMO) using an equal five step measure as used with fracture traces in systematic mapping. The PFL results correlated with core logging fracture data from pilot holes OL-PH1 and ONK-PH2 .. ONK-PH7 were in this work further correlated with the fractures mapped from the ONKALO tunnel walls. Each hydraulically conductive fracture of OL-PH1 and ONK-PH2 - ONK-PH7 was investigated and linked to ONKALO fracture of a coherent orientation and matching location, where such fracture trace was available. The main objective of the work was to identify the ONKALO fractures which correspond to the flow from fracture(s) identified with the PFL method in pilot holes and to collect basic information about the occurrence, frequency and orientation of water bearing fractures along ONKALO tunnel

  3. Unification of acoustic drillhole logging data

    International Nuclear Information System (INIS)

    Oehman, I.; Palmen, J.; Heikkinen, E.


    Posiva Oy prepares for disposal of spent nuclear fuel in bedrock in Olkiluoto, Eurajoki. This is in accordance of the application filed in 1999, the Decision-in-Principle of the State Council in 2000, and ratification by the Parliament in 2001. The site characterization at Olkiluoto has included comprehensive geological, hydrological, geochemical and geophysical investigations airborne, on ground and in drillholes since 1988. One of key techniques in geophysical drillhole surveys has been acoustic full waveform logging, which has been implemented since 1994. Various tools have been used in acquisition of acoustic data and several processing techniques have been applied. The logging work and processing to P and S wave velocities has been previously carried out on single drillhole basis. Comparisons to actual values and levels have not been made, and the results have not been calibrated. Therefore results for different drillholes have not been comparable. Resolution of the P and S wave velocity has been rather coarse, and depth correlation to the core data has been on tentative level. As the investigation data has been accumulating, it has become possible to correlate the results to geological and laboratory control data and to calibrate the results of separate measurement campaigns and different drillholes together onto same reference level and resolution. The presented technique has been applied for drillhole OL-KR29 onwards and has set the processing standard, settings and reference levels for later surveys. This approach will further assist the application of the method for mapping and numerical description of lithology variation and possible effect of alteration and deformation on it. Further on, the P and S wave velocity data together with density can be used in computing of dynamic in situ rock mechanical parameters, and possibly in correlating rock strength laboratory data to P and S wave velocity logging data. The acoustic logging data from drillholes OL-KR1

  4. Difference flow and electrical conductivity measurements at the Olkiluoto site in Eurajoki, drillholes OL-KR54, OL-KR55, OL-KR55B and OL-KR47B

    Energy Technology Data Exchange (ETDEWEB)

    Komulainen, J.; Poellaenen, J.; Hurmerinta, E.; Ripatti, K. [Poeyry Finland Oy, Espoo (Finland)


    The Posiva Flow Log, Difference flow method (PFL DIFF) uses a flowmeter that incorporates a flow guide and can be used for relatively quick determinations of hydraulic conductivity and hydraulic head of fractures/fractured zones in drillholes. This report presents the principles of the method and the results of measurements carried out in drillholes OL-KR54, OL-KR55, OL-KR55B and OL-KR47B at the Olkiluoto investigation site between January 2011 and September 2011. The measuring programme employed was the same in all drillholes. The applied section lengths of the flow guide were either 2 m and 0.5 m. Flow into the drillhole or from the drillhole to the bedrock was measured within the section length. The measurements were carried out in both pumped and natural (i.e. un-pumped) conditions. The transmissivity and hydraulic head of zones were calculated from the flow and pressure results. The device used includes a sensor for single point resistance (SPR). SPR was measured in connection with the flow measurements. The electrical conductivity (EC) of fracture-specific water was measured in chosen fractures. Fractures were selected on the basis of the measured flow from fractures into the drillhole. The drillhole flow (flow along the drillhole) was measured in conjunction with drillhole EC measurements. (orig.)

  5. Drillhole gamma-ray spectrum logging in drillholes OL-KR11, OL-KR44, OL-KR44B, OL-KR45B, OL-KR46, OL-KR47, OL-KR47B, OL-KR48 and ground survey at Olkiluoto in Eurajoki, 2007 and 2008

    Energy Technology Data Exchange (ETDEWEB)

    Julkunen, A.; Kallio, L.; Kuusisto, M. (Astrock Oy, Sodankylae (Finland))


    The aim of the detailed drillhole surveys is to increase the knowledge of the bedrock on the study area and to supplement the investigations made earlier. As a part of the detailed investigations Astrock Oy carried out drillhole spectrometer logging in drillholes OL-KR11, OL-KR44, OL-KR44B, OL-KR45B, OL-KR46, OL-KR47, OL-KR47B, OL-KR48 and ground survey at Olkiluoto site in Eurajoki during 2007 and 2008. This report describes the logging, data processing and the results. For the first time the results contains moving standard deviation calculations of Th/K ratio, because the variability of Th/K ratio is a reasonably good indicator of alteration zones. This report includes also moving standard deviation calculations of Th/K ratio from earlier measured and reported drillholes OL-KR40-43 and OL-KR40B-43B. (orig.)

  6. Correlation of transmissive fractures in pilot holes ONK-PH8 - PH12 and fracture traces mapped in ONKALO

    International Nuclear Information System (INIS)

    Palmen, J.; Nummela, J.; Ahokas, H.


    In a preceding study Posiva flow logging (PFL) with a 0.5 m test interval and 0.1 m steps has been used together with optical drillhole images and core logging fracture data for the exact determination of the depth of hydraulically conductive fractures in pilot holes. The fracture traces have been mapped from the ONKALO tunnel walls as a part of the systematic mapping. The mapping results has been digitized to a 3D tunnel layout in Surpac programme. The data integrity and fracture trace uniqueness has been verified by Datactica Oy and further collected to a database (RakokantaDatacticaPosiva20100607.mdb). Fractures mapped with leakage attribute have been defined as flowing, dripping, wet, or damp where the attribute is recorded. The fractures with no leakage attribute value appear to be non leaking. The water leaking surfaces on the ONKALO tunnel walls have been mapped sequentially and conclusively (once or twice a year) as a part of the Olkiluoto monitoring program (OMO) using an equal five step measure as used with fracture traces in systematic mapping. The PFL results correlated with core logging fracture data from the pilot holes ONK-PH8 - ONK-PH12 were in this work further correlated with the fractures mapped from the ONKALO tunnel walls. Each hydraulically conductive fracture of ONK-PH8 - ONK-PH12 was investigated and linked to ONKALO fracture of a coherent orientation and matching location, where such fracture trace was available. Also tunnel crosscutting fracture (TCF) data was used in combining, since the systematic mapping data was not yet available for the pilot holes ONK-PH11 and ONK-PH12 at the time of the evaluation. The main objective of the work was to identify the ONKALO fractures which correspond to the flow from fracture(s) identified with the PFL method in pilot holes and to collect basic information about the occurrence, frequency and orientation of water bearing fractures along the ONKALO tunnel. The correlated hydraulically conductive

  7. Correlation of transmissive fractures in pilot holes ONK-PH8 - PH12 and fracture traces mapped in ONKALO

    Energy Technology Data Exchange (ETDEWEB)

    Palmen, J.; Nummela, J.; Ahokas, H. [Poeyry Finland Oy, Vantaa (Finland)


    In a preceding study Posiva flow logging (PFL) with a 0.5 m test interval and 0.1 m steps has been used together with optical drillhole images and core logging fracture data for the exact determination of the depth of hydraulically conductive fractures in pilot holes. The fracture traces have been mapped from the ONKALO tunnel walls as a part of the systematic mapping. The mapping results has been digitized to a 3D tunnel layout in Surpac programme. The data integrity and fracture trace uniqueness has been verified by Datactica Oy and further collected to a database (RakokantaDatacticaPosiva20100607.mdb). Fractures mapped with leakage attribute have been defined as flowing, dripping, wet, or damp where the attribute is recorded. The fractures with no leakage attribute value appear to be non leaking. The water leaking surfaces on the ONKALO tunnel walls have been mapped sequentially and conclusively (once or twice a year) as a part of the Olkiluoto monitoring program (OMO) using an equal five step measure as used with fracture traces in systematic mapping. The PFL results correlated with core logging fracture data from the pilot holes ONK-PH8 - ONK-PH12 were in this work further correlated with the fractures mapped from the ONKALO tunnel walls. Each hydraulically conductive fracture of ONK-PH8 - ONK-PH12 was investigated and linked to ONKALO fracture of a coherent orientation and matching location, where such fracture trace was available. Also tunnel crosscutting fracture (TCF) data was used in combining, since the systematic mapping data was not yet available for the pilot holes ONK-PH11 and ONK-PH12 at the time of the evaluation. The main objective of the work was to identify the ONKALO fractures which correspond to the flow from fracture(s) identified with the PFL method in pilot holes and to collect basic information about the occurrence, frequency and orientation of water bearing fractures along the ONKALO tunnel. The correlated hydraulically conductive

  8. Geophysical logging and imaging of drillholes OL-KR45, OL-KR49, OL-KR50 and OL-KR50B at Olkiluoto in 2009

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.


    Suomen Malmi Oy conducted geophysical drillhole logging, acoustic imaging and optical imaging of the drillholes OL-KR45 (re-measurements), OL-KR49, OL-KR50 and OL-KR50B at the Olkiluoto site in Eurajoki during January-November 2009. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. The missing density logging of drillhole OL-KR45 was carried out successfully. Dynamic rock mechanical parameters and natural gamma data were re-processed and this report includes updated WellCAD and Excel files. Acoustic imaging was also carried out in OL-KR45 after 700 meters depth. Acoustic imaging was used instead of optical imaging after 350 meters in OL-KR49 and 700 meters in OL-KR50. (orig.)

  9. Electrical model of Olkiluoto

    Energy Technology Data Exchange (ETDEWEB)

    Paananen, M.; Lehtonen, T.; Korhonen, K. (Geological Survey of Finland, Espoo (FI))


    The goal of this work is to construct a composite electrical model of Olkiluoto, focussing on integration of four separate geophysical methods: mise-a-la-masse (MAM), SAMPO EM soundings, Slingram (HLEM) and single-hole electrical soundings. The electrical structure of Olkiluoto is rather complex, dominated by mineral electrical conductors such as sulphide minerals and graphite. The basic idea of this work is the fact that the sulphide-rich zones and fracturing appear to coincide frequently. Accordingly, knowing the geometry of the major electric conductors would facilitate the interpretation of brittle deformation zones. The work consists of three separate phases: method-specific interpretation, integration and block modelling. In the single-hole interpretation, locations of electric conductors (resistivity < 1000 ohmm), based on long normal survey have been determined in 42 drillholes. Since MAM survey does not cover all the conductive sections and drillholes and SAMPO EM has its own limitations in sensitivity and resolution, a proportion of the conductive sections have been combined between the drillholes using only the single-hole data and the geological idea of features dipping gently to SE - S. The MAM survey has been done in numerous drillholes in order to find galvanic connections between the drillholes. Based on MAM, geometry of numerous electric conductors has been determined. Generally the results indicate continuous, gently dipping semiplanar features intersected by several drillholes. The Slingram survey and interpretation have been done on the ground surface to map electric conductors located at shallow depths (some tens of meters at maximum). A number of conductive zones have been delineated, trending mainly from ENE to WSW. The conductors have also been classified according to their in-phase/quadrature-ratio, and in some cases, also numerical modelling has been done. The SAMPO EM soundings and interpretations have been done to map subsurface electric

  10. Electrical model of Olkiluoto

    International Nuclear Information System (INIS)

    Paananen, M.; Lehtonen, T.; Korhonen, K.


    The goal of this work is to construct a composite electrical model of Olkiluoto, focussing on integration of four separate geophysical methods: mise-a-la-masse (MAM), SAMPO EM soundings, Slingram (HLEM) and single-hole electrical soundings. The electrical structure of Olkiluoto is rather complex, dominated by mineral electrical conductors such as sulphide minerals and graphite. The basic idea of this work is the fact that the sulphide-rich zones and fracturing appear to coincide frequently. Accordingly, knowing the geometry of the major electric conductors would facilitate the interpretation of brittle deformation zones. The work consists of three separate phases: method-specific interpretation, integration and block modelling. In the single-hole interpretation, locations of electric conductors (resistivity < 1000 ohmm), based on long normal survey have been determined in 42 drillholes. Since MAM survey does not cover all the conductive sections and drillholes and SAMPO EM has its own limitations in sensitivity and resolution, a proportion of the conductive sections have been combined between the drillholes using only the single-hole data and the geological idea of features dipping gently to SE - S. The MAM survey has been done in numerous drillholes in order to find galvanic connections between the drillholes. Based on MAM, geometry of numerous electric conductors has been determined. Generally the results indicate continuous, gently dipping semiplanar features intersected by several drillholes. The Slingram survey and interpretation have been done on the ground surface to map electric conductors located at shallow depths (some tens of meters at maximum). A number of conductive zones have been delineated, trending mainly from ENE to WSW. The conductors have also been classified according to their in-phase/quadrature-ratio, and in some cases, also numerical modelling has been done. The SAMPO EM soundings and interpretations have been done to map subsurface electric

  11. Rock stress measurements in ONKALO underground characterisation facility at Olkiluoto at depth of 120 m

    International Nuclear Information System (INIS)

    Fecker, E.


    In November and December 2006 overcoring stress measurements have been conducted in the boreholes ONK-PP74, ONK-PP75 and ONK-PP77 in a niche of the access tunnel of the ONKALO underground characterisation facility at the Olkiluoto site. Measurements have been done using the CSIRO 3D stress measuring cell. This cell is one of the mostly used cells in the whole world for estimation of the state of stress in rock when doing the borehole measurements. The boreholes are at a depth of about 120 m under the ground surface. The rock where the measurements have been conducted is a foliated migmatitic gneiss (subtypes veined and diatexitic gneiss). Parallel to the overcoring measurements a glue test has been conducted in the laboratory to check the quality of the bonding of the stress cells to the rock. The result showed that the glue makes a good contact between the rock and the stress cell, but air bubbles, which have normally been observed within the glue and at the edges, proved this time to be disadvantageous. Normally such air bubbles have dimensions of about one millimetre, but sometimes certain bubbles may become notably bigger. In the ONKALO overcored probes sawn apart such air bubbles were found both in wet and dry probe conditions. In the test series eight stress measurements have been provided, three of them failed for technical reasons. At one of these three tests the glue has extruded too early, at the other two tests the overcoring was not conducted deep enough. At the remaining five tests in spite of the glue test results a calculation of the stress tensor could be made. Four of these five measurements can be seen as relatively successful. The results of these measurements show a major principal stress of 14.8 MPa in average, trending northwest - southeast, and with a dipping of 11 degrees in average. (orig.)

  12. Monitoring measurements by the difference flow method during the year 2008. Drillholes OL-KR4 and OL-KR27

    International Nuclear Information System (INIS)

    Vaeisaesvaara, J.; Kristiansson, S.; Poellaenen, J.


    The Posiva Flow Log, Difference Flow Method (PFL DIFF) uses a flowmeter that incorporates a flow guide and can be used for relatively quick determinations of hydraulic conductivity and fresh water head in fractures/fractured zones in cored drillholes. This report presents the principles of the method and the results of measurements carried out in drillholes OL-KR4 and OL-KR27 at the Olkiluoto investigation site during the year 2008. These measurements are a part of the Olkiluoto monitoring programme. The section length of the flow guide in the flow logging measurements was either 2 m or 0.5 m. Flow into the drillhole or from the drillhole to the bedrock was measured within the section lengths and carried out in both pumped and natural (i.e. un-pumped) conditions. Calculations of the transmissivity (T) and the fresh water head (hfw) of the zones are shown in the results. The device used includes a sensor for single point resistance (SPR). SPR was measured in connection with flow measurements. The electrical conductivity (EC) of fracture-specific water was measured in chosen fractures in most of the drillholes. Fractures were selected on the basis of the measured flow from fracture to drillhole. In addition, some previously selected fractures were measured. The EC of the drillhole water was also measured. (orig.)

  13. Results of Monitoring at Olkiluoto in 2007. Hydrogeochemistry

    Energy Technology Data Exchange (ETDEWEB)

    Pitkaenen, P.; Partamies, S. (VTT, Espoo (Finland)); Lahdenperae, A.-M.; Ahokas, T.; Penttinen, T. (Poeyry Environment Oy, Vantaa (Finland)); Lehtinen, A. (Posiva Oy, Helsinki (Finland)); Pedersen, K. (Microbial Analytics Sweden AB (Sweden)); Lamminmaeki, T. (Teollisuuden Voima Oy, Olkiluoto (Finland)); Hatanpaeae, E. (Ramboll Analytics Oy, Lahti (Finland))


    . Hydrogeochemical development in them requires close monitoring in the future. The gas results also correspond very well to the baseline data suggesting no influence of ONKALO on the groundwater conditions, although gases are not considered to be as sensitive indicators of changes as dissolved solids. Groundwater sampling from ONKALO has so far not revealed notably high SO{sub 4} contents, which are relatively common in surface based sampling at 100 to 300 m depth. The number of groundwater samples and the potential sampling locations are small after excavation passed through HZ19 at about 100 m depth due to low permeability of the host rock. The 2H- and 18O- compositions in samples taken from ONK-KR3 and particularly ONK-KR4 show a tendency towards isotopic composition of Korvensuo water, suggesting that water from the reservoir may discharge in these drillholes. Earlier shallow groundwater data from bedrock between ONKALO and Korvensuo are lacking, making it impossible to evaluate if this is caused by ONKALO or if water from the reservoir has already earlier infiltrated and mixed in the shallow depths. Microbiological data obtained during the 2007 monitoring programme with three independent methods support the results that suggest the 300 m depth level in Olkiluoto to be more active with respect to microbiological processes than the depth interval between 20 and 250 m. Starting at a depth of approximately 300 m, there are steep gradients of decreasing sulphate and increasing methane concentrations with depth; together with the peaks in biomass and sulphide concentration at this depth (Pedersen 2008) these suggest that anaerobic methane oxidation may be a significant process at 300 m depth in Olkiluoto. Gefinex S400 sounding curves show slight changes in comparison with the 2004 - 2006 ARD curves. The differences may mostly be caused by the new earthwork structures or the alteration of the moisture of soil and bedrock. According to the monitoring results, decreasing resistivity

  14. Geophysical drillhole logging and optical imaging of the drillholes OL-KR43, OL-KR44, OL-KR44B, OL-KR45, OL-KR45B, OL-KR46, OL-KR46B, OL-KR47, OL-KR47B and OL-KR48, at Olkiluoto 2007 and 2008

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.; Heikkinen, E.


    Suomen Malmi Oy conducted geophysical drillhole logging and optical imaging of the drillholes OL-KR43, OL-KR44, OL-KR44B, OL-KR45, OL-KR45B, OL-KR46, OL-KR46B, OL-KR47, OL-KR47B and OL-KR48 at the Olkiluoto site in Eurajoki during December 2007, May 2008. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

  15. Updated and integrated modelling of the 1995 - 2008 Mise-a-la-masse survey data in Olkiluoto

    International Nuclear Information System (INIS)

    Ahokas, T.; Paananen, M.


    Posiva Oy prepares for disposal of spent nuclear fuel into bedrock focusing in Olkiluoto, Eurajoki. This is in accordance of the Decision-in-Principle of the State Council in 2000, and ratification by the Parliament in 2001. The ONKALO underground characterization premises have been constructed since 2004. Posiva Oy is aiming for submitting the construction licence application in 2012. To support the compilation of the safety case and repository and ONKALO design and construction, an integrated Olkiluoto site Description including geological, rock mechanics, hydrogeological and hydrogeochemical models will be depicted. Mise-a-la-masse (MAM) surveys have been carried out in the Olkiluoto area since 1995 to follow electric conductors from drillhole to drillhole, from drillhole to the ground surface and also between the ONKALO access tunnel and drillholes or the ground surface. The data and some visualisation of the data have been presented as part of reporting of the 1995 and 2008 surveys. The work presented in this paper includes modelling of all the measured data and combining single conductors modelled from different surveys to conductive zones. The results from this work will be used in updating the geological and hydrogeological models of the Olkiluoto site area. Several electrically conductive zones were modelled from the examined data, many of them coincide with the known brittle deformation zones but also indications of many so far unknown zones were detected. During the modelling Comsol Multiphysics software for calculating theoretical potential field anomalies of different models was tested. The test calculations showed that this software is useful in confirming the modelling results, especially in complicated cases. (orig.)

  16. Geophysical drillhole logging of the drillholes OL-KR40, OL-KR41, OL-KR41B, OL-KR42, OLKR42B, OL-KR43 and OL-KR43B, at Olkiluoto 2006 and 2007

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.


    Suomen Malmi Oy conducted geophysical borehole logging of the boreholes drillholes OL-KR40, OL-KR41, OL-KR41B, OL-KR42, OL-KR42B, OL-KR43 and OL-KR43B at the Olkiluoto site in Eurajoki during August, September, December 2006 and January 2007. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and processing of the acoustic data. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

  17. Mise-a-la-Masse Measurements at Olkiluoto in 2010

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.


    Suomen Malmi Oy carried out Mise-a-la-Masse measurements at Olkiluoto site in Eurajoki during March-June 2010. The survey consisted of measurements in 9 drillholes and on 76 surface profiles. The measured drillholes were OL-KR11, OL-KR40, OLKR44, OL-KR45 and OL-KR49..OL-KR53. Surface measurements were carried out at 4 different areas. Current electrodes were placed in drillholes OL-KR49 - OL-KR53. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work. This report describes the field operation, the equipment and shows the obtained results and their quality. The raw and processed data are delivered digitally in Microsoft Ecxel format. (orig.)

  18. Illite K-Ar dating of fault breccia samples from ONKALO underground research facility, Olkiluoto, Eurajoki, SW Finland

    International Nuclear Information System (INIS)

    Maenttaeri, I.; Mattila, J.; Zwingmann, H.; Todd, A.J.


    Illite K-Ar age determinations were done on five fault breccia samples from the ONKALO underground research facility, Olkiluoto, Eurajoki, S-W Finland. The XRD, SEM, and TEM studies and K-Ar analyses were done in John deLaeter Center in Mass Spectrometry at Curtin University, Perth, Western Australia. The <2 micron grain size fractions contain illite, chlorite, dickite, and quartz. All fractions had minor contamination phases comprising mainly of quartz but traces of K-feldspar contamination could be identified in all samples. The authigenic illite shows variable K concentrations. The illite contents of the ONK-PL68 and ONK-PL87 samples are the smallest. The K-Ar ages for the <2 micron fractions vary from ∼0.55 Ga to 1.38 Ga. The sample ONKPL68 yields a K-Ar age of 912 ± 18 Ma corresponding to a Neoproterozoic-Tonian age. This age can be roughly temporally linked with late events related to Sveconorwegian orogeny. Sample ONK-PL87 has a K-Ar age of 550 ± 11 Ma corresponding to a Neoproterozoic - Lower Cambrian age. The samples ONK-PL522 and ONK-PL901 sampled from the storage hall fault show identical K-Ar ages of 1385 ± 27 Ma and 1373 ± 27 Ma, respectively. These correspond to a Mesoproterozoic-Ectasian age related to Subjotnian or Postjotnian events. ONK-PL960 yields a K-Ar age of 1225 ± 24 Ma corresponding to a Mesoproterozoic-Ectasian age. This age agrees well with the ages from Postjotnian diabase dykes in W Finland. The 2-3 % detrital K-feldspar contamination in clay fractions increases the age. Especially for the youngest sample ONK-PL87, the effect may be geologically meaningful as after the correction the age clearly indicates Caledonian events. Moreover, the age for the low K sample ONKPL901 shifts to indicate Postjotnian diabase age. (orig.)

  19. Seismic VSP Investigations at Olkiluoto, 2005

    Energy Technology Data Exchange (ETDEWEB)

    Enescu, N.; Cosma, C.; Balu, L. (Vibrometric, Vantaa (Finland))


    Posiva Oy carries out R and D related tasks for spent nuclear fuel disposal in Finland. The site characterization has been conducted since 1987 in Olkiluoto in western Finland. The ONKALO underground characterization facility has been under construction since 2004. Vibrometric Oy has been contracted to carry out seismic VSP survey in four drillholes in the immediate vicinity of ONKALO, for the characterization of the seismically responsive structures. Four drillholes, KR8, KR27, KR29 and KR38 were included to the project. Seven seismic source locations on ground surface were used for each drillhole. The source locations were optimized with respect to the drillhole and ONKALO and were configured as linear arrays to produce optimum imaging focused on the ONKALO volume. A mechanical Vibsist source, using a hydraulic rock breaker mounted on a 22 t excavator, was used as source of seismic signal. The signal was recorded with downhole 3-component geophones. The recording array was 8-level long, with 5 m spacing between levels. Acquisition was run throughout the drillholes. Processing of the VSP profiles consisted of time decoding of the impact sequences, filtering and image point (IP) transform. The interpretation was carried out interactively, seeking for best match of orientation of each reflection according to different borehole profiles where the features were seen. The interpretations were built as an add-on to a previous seismic model of the site. The most distinct reflectors were interpreted, compiled to as a part of a terrain model composed of 3D surfaces, and transferred digitally together with other results (3D elements of reflector locations) into Posiva's 3D modeling system. Some of the reflectors have already received direct confirmation from ONKALO observations. (orig.)

  20. Seismic VSP Investigations at Olkiluoto, 2005

    International Nuclear Information System (INIS)

    Enescu, N.; Cosma, C.; Balu, L.


    Posiva Oy carries out R and D related tasks for spent nuclear fuel disposal in Finland. The site characterization has been conducted since 1987 in Olkiluoto in western Finland. The ONKALO underground characterization facility has been under construction since 2004. Vibrometric Oy has been contracted to carry out seismic VSP survey in four drillholes in the immediate vicinity of ONKALO, for the characterization of the seismically responsive structures. Four drillholes, KR8, KR27, KR29 and KR38 were included to the project. Seven seismic source locations on ground surface were used for each drillhole. The source locations were optimized with respect to the drillhole and ONKALO and were configured as linear arrays to produce optimum imaging focused on the ONKALO volume. A mechanical Vibsist source, using a hydraulic rock breaker mounted on a 22 t excavator, was used as source of seismic signal. The signal was recorded with downhole 3-component geophones. The recording array was 8-level long, with 5 m spacing between levels. Acquisition was run throughout the drillholes. Processing of the VSP profiles consisted of time decoding of the impact sequences, filtering and image point (IP) transform. The interpretation was carried out interactively, seeking for best match of orientation of each reflection according to different borehole profiles where the features were seen. The interpretations were built as an add-on to a previous seismic model of the site. The most distinct reflectors were interpreted, compiled to as a part of a terrain model composed of 3D surfaces, and transferred digitally together with other results (3D elements of reflector locations) into Posiva's 3D modeling system. Some of the reflectors have already received direct confirmation from ONKALO observations. (orig.)

  1. Monitoring measurements by difference flow method during the year 2006, drillholes OL-KR1, KR2, KR4, KR7, KR8, KR10, KR14, KR22, KR22B, KR27 and KR28

    International Nuclear Information System (INIS)

    Vaeisaesvaara, J.; Poellaenen, J.; Sokolnicki, M.


    The Posiva Flow Log/Difference Flow Method can be used for a relatively fast determination of water conductivity and hydraulic head in fractures/fractured zones in cored drillholes. In this method, a flow meter with a flow guide is used. This report presents the principles and results of the measurements carried out in drillholes OL-KR1, -KR2, -KR4, -KR7, -KR8, -KR10, -KR14, -KR22, -KR22B, -KR27 and -KR28 at the Olkiluoto investigation site during the year 2006. These measurements are a part of the Olkiluoto monitoring programme. Two different section lengths (2 m and 0.5 m) were used in the flow logging measurements. The flow into the drillhole or from the drillhole into the bedrock was measured within the section. Measurements were carried out both in natural conditions and when the drillhole was pumped. The transmissivity (T) and hydraulic head (h) of zones were calculated and are presented in the results. The measurement device also includes a sensor for single-point resistance (SPR) measurements. SPR was always measured in connection with flow measurements. SPR is measured when the tool is moving. The electric conductivity of fracture-specific water (EC) was measured in selected fractures in some of the drillholes. The fractures were chosen on the basis of the measured flow from the fracture to the drillhole. In addition to this some previously selected fractures were measured. The EC of the drillhole water was measured separately. (orig.)

  2. Geophysical borehole logging and optical imaging of the pilot hole ONK-PH2

    International Nuclear Information System (INIS)

    Lahti, M.; Heikkinen, E.


    Suomen Malmi Oy conducted geophysical borehole logging and optical imaging surveys of pilot hole ONK-PH2 in ONKALO tunnel at the Olkiluoto site in December 2004. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The methods applied are magnetic susceptibility, natural gamma radiation, gamma-gamma density, single point resistance, Wenner-resistivity, borehole radar, full waveform sonic and optical imaging. The assignment included the field work of all the surveys, integration of the data as well as interpretation of the acoustic and borehole radar data. The report describes the field operation, equipment, processing procedures, interpretation results and shows the obtained geophysical and image data. The data as well as the interpretation results are delivered digitally in WellCAD and Excel format. (orig.)

  3. Geophysical borehole logging and optical imaging of the pilot hole ONK-PH2

    Energy Technology Data Exchange (ETDEWEB)

    Lahti, M. [Suomen Malmi Oy, Espoo (Finland); Heikkinen, E. [JP-Fintact Oy, Vantaa (Finland)


    Suomen Malmi Oy conducted geophysical borehole logging and optical imaging surveys of pilot hole ONK-PH2 in ONKALO tunnel at the Olkiluoto site in December 2004. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The methods applied are magnetic susceptibility, natural gamma radiation, gamma-gamma density, single point resistance, Wenner-resistivity, borehole radar, full waveform sonic and optical imaging. The assignment included the field work of all the surveys, integration of the data as well as interpretation of the acoustic and borehole radar data. The report describes the field operation, equipment, processing procedures, interpretation results and shows the obtained geophysical and image data. The data as well as the interpretation results are delivered digitally in WellCAD and Excel format. (orig.)

  4. Increasing the reliability of the Olkiluoto surface and near-surface hydrological model

    International Nuclear Information System (INIS)

    Karvonen, T.


    The aim of the study was to improve the reliability of the Olkiluoto surface hydrological model that calculates the overall water balance components of Olkiluoto Island. ONKALO and Korvensuo reservoir were added as explicit structures to the model. The model links the unsaturated and saturated soil water in the overburden and groundwater in bedrock to a continuous pressure system. With the model it is possible to evaluate the influence of water leaking to ONKALO on groundwater level in overburden soils and pressure head in shallow bedrock drillholes. Anisotropy was added to the surface hydrological model and several model runs were carried out using anisotropy factors 1, 5 and 10. Anisotropy factor of 10 is used in the 2008 version of the deep hydrogeological model and the same anisotropy will be used in future calculations of the surface hydrological model to ensure consistency of the parameter values in the two models. The correspondence between measured and computed groundwater levels has been improved due to new soil type delineation and the calibration of the soil water retention curve parameters. Computed groundwater level variation can be characterized by a measure ΔH COMP , which is difference between maximum and minimum value during the calibration period. Average ΔH COMP in groundwater tubes was 1.98 m and the corresponding measured value ΔH MEAS was 2.08 m, i.e. the difference between measured and computed value was around 0.1 m (0.16 m in the 2007 version). Temporal variation (difference between maximum and minimum pressure head) was simulated well also in most of the shallow bedrock drillholes. ONKALO was added to the 2008 version of the Olkiluoto surface hydrological model. Influence of ONKALO is taken into account by giving the total discharge as input data from existing measurements or from calculations of the deep hydrogeological model of the Olkiluoto Island. The computed results show that ONKALO has a temporal effect on groundwater level in

  5. Compilation and analysis of hydrogeological responses to field activities in Olkiluoto

    International Nuclear Information System (INIS)

    Vaittinen, T.; Nummela, J.; Ahokas, H.


    Groundwater flow characteristics provide essential input for the construction and safety assessment of a disposal facility for spent nuclear fuel. On the Olkiluoto site flow connections have been studied in deep drillholes by means of long-term pumping tests, varying interference tests, and by interpreting the measured hydraulic heads. This report focuses on the assessment of measured hydraulic heads. Hydraulic heads have been measured both in open and in packed-off drillholes since 1991. The interpretation of the hydraulic connections is based on observed changes in hydraulic head distribution caused by certain investigation activities on the site. Field activities may increase the head, e.g. drilling, or more typically decrease the head, e.g. flush pumping after drilling, difference flow logging with pumping, and groundwater sampling. All the measured head observations have been gathered to binary files and a code has been developed to enable inquiries of head values for selected field activities. The main improvement has been the possibility for easy comparison of head observations in several drillholes. This report contains a short description of the pumping and the over-pressure tests, hydraulic head observations in packed-off drillholes until the end of 2005, and an interpretation of the selected representative cases. The presented cases highlight both the advantages and the difficulties related to the interpretation of the available hydraulic head data. Based on the head observations in packed-off drillholes, sub-horizontal hydraulic zones seem to form a layered system and indicate weak sub-vertical connections. The results of the pumping tests carried out between 1991 and 1998 are the most valuable, because the drillholes were mostly packed-off during the tests. Later, observations have suffered from open drillholes, which spread the head changes to all intersected hydrogeological zones. Due to the open drillholes, the existence of sub-vertical hydraulic

  6. Slug-tests in PP- and PVP-holes at Olkiluoto in 2006

    International Nuclear Information System (INIS)

    Keskitalo, K.; Lindgren, S.


    As part of the program for the final disposal of the nuclear fuel waste, Posiva Oy investigates the hydrological conditions at the Olkiluoto island. The hydraulic conductivity in the shallow holes OL-PP5, OL-PP9, OL-PP36, OL-PP39, OL-PVP4A, OL-PVP4B, OL-PVP6A, OL-PVP6B and OL-PVP14 was measured in summer 2006. The length of PP-holes varies between 12 and 15 m, and the test sections (1 m) are located in the bedrock. PVP-tubes have a length up to 10 m, and the test sections (2 m) are located in the overburden. The measurements were done using the slug-test technique. In the slug-test, the hydraulic head in the borehole is abruptly changed either by pouring water into the borehole or by lowering the pressure sensor. The conductivity is interpreted based on the recovery of the water level. This report presents the field measurements and their interpretation. The interpretation has been done using the Hvorslev's method, and for reference, conductivity has also been calculated according to Thiem's equation. According to the results, hydraulic conductivity in PP-holes ranges from 10 -9 m/s to 10 -6 m/s and in PVP-tubes from 10 -8 m/s to 10 -5 m/s. The range is similar as observed in measurements of years 2002, 2004 and 2005. In general the results are consistent with the results obtained in earlier measurements. Some exceptions exist in OL-PP9, where the conductivity is lower than in the 2005 measurements, but still at the same level as in the 2002 measurements. Also, the results agree with hydraulic conductivity interpreted from the pre-pumping done in connection with the groundwater sampling. (orig.)

  7. Hydraulic conductivity measurements with HTU at Eurajoki, Olkiluoto, drillholes OL-KR28 and OL-KR39 in 2006

    International Nuclear Information System (INIS)

    Haemaelaeinen, H.


    As a part of the site investigations for the disposal of spent nuclear fuel, hydraulic conductivity measurements were carried out in drillholes OL-KR28 and OL-KR39 at Eurajoki, Olkiluoto. The objective was to investigate the distribution of the hydraulic conductivity in the surrounding bedrock volume. Measurements were carried out during summer 2006. The total length of the borehole OL-KR28 is 656,33 m, 352 m of which was covered by 176 standard tests with 2 m packer separation as specified in the measurement plan. Respectively, OL-KR39 is 502,97 m deep and 101 similar tests were made in it covering 202 m of the hole. The measured sections are around the depths of the planned repository. Double-packer constant-head method was used throughout with nominal 200 kPa overpressure. Injection stage lasted normally 20 minutes and fall-off stage 10 minutes. The tests were often shortened if there were clear indications that the hydraulic conductivity is below the measuring range of the system. The pressure in the test section was let to stabilise at least 5 min before injection. In some test sections the test stage times were extended. Two transient (Horner and 1/Q) interpretations and one stationary-state (Moye) interpretation were made in-situ immediately after the test. The Hydraulic Testing Unit (HTU-system) is owned by Posiva Oy and it was operated by Geopros Oy. (orig.)

  8. Optical imaging of drillholes OL-KR40, OL-KR41, OL-KR41B, OL-KR42, OL-KR42B, OL-KR43 and OL-KR43B at Olkiluoto, 2006 and 2007

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.


    Suomen Malmi Oy carried out optical imaging of drillholes OL-KR40, OL-KR41, OL-KR41B, OL-KR42, OL-KR42B, OL-KR43 and OL-KR43B at Olkiluoto site in Eurajoki during July, August, November and December 2006 as well as January 2007. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and the data processing. This report describes the field operation, the equipment as well as the processing procedures and shows the obtained results and their quality. The raw and processed data are delivered digitally in WellCAD and PDF format. (orig.)

  9. Geological model of the Olkiluoto site Version O

    International Nuclear Information System (INIS)

    Paulamaeki, S.; Paananen, M.; Gehoer, S.


    The geological model of the Olkiluoto site consists of four submodels: the lithological model, the ductile deformation model, the brittle deformation model and the alteration model. The lithological model gives properties of definite rock units that can be defined on the basis the migmatite structures, textures and modal compositions. The ductile deformation model describes and models the products of polyphase ductile deformation, which enables to define the dimensions and geometrical properties of individual lithological units determined in the lithological model. The brittle deformation model describes the products of multiple phases of brittle deformation. The alteration model describes the types, occurrence and the effects of the hydrothermal alteration. The rocks of Olkiluoto can be divided into two major classes: (1) supracrustal high-grade metamorphic rocks including various migmatitic gneisses, tonalitic-granodioriticgranitic gneisses, mica gneisses, quartz gneisses and mafic gneisses, and (2) igneous rocks including pegmatitic granites and diabase dykes. The migmatitic gneisses can further be divided into three subgroups in terms of the type of migmatite structure: veined gneisses, stromatic gneisses and diatexitic gneisses. On the basis of refolding and crosscutting relationships, the metamorphic supracrustal rocks have been subject to polyphased ductile deformation, including five stages. In 3D modelling of the lithological units, an assumption has been made, on the basis of measurements in outcrops, investigation trenches and drill cores, that the pervasive, composite foliation produced as a result a polyphase ductile deformation has a rather constant attitude in the ONKALO area. Consequently, the strike and dip of the foliation has been used as a tool, through which the lithologies have been correlated between the drillholes and from the surface to the drillholes. The bedrock in the Olkiluoto site has been subject to extensive hydrothermal alteration

  10. Microbiology of Olkiluoto and ONKALO groundwater results and interpretations, 2008-2009

    Energy Technology Data Exchange (ETDEWEB)

    Pedersen, K.; Arlinger, J.; Edlund, J.; Eriksson, L.; Lydmark, S.; Johansson, J.; Jaegevall, S.; Rabe, L. (Microbial Analytics Sweden AB, Moelnlycke (Sweden))


    Microbiology cultivation, DNA, and RNA data were assembled from 18 groundwater samples from Olkiluoto, from deep drillholes ranging in depth from 62 to 708 m, and from groundwater from eight ONKALO drillholes ranging in depth from 7.1 to 318 m. Biomass was determined by counting total numbers of microbial cells (TNC) and determining adenosine triphosphate (ATP) concentrations. The aerobic cultivation method used comprised aerobic plate counts. Anaerobic most probable number (MPN) methods were used to determine counts of nitrate-, iron-, manganese-, and sulphatereducing bacteria, acetogenic bacteria, and methanogens. Molecular methods for analysing the diversity and abundance of microorganisms have been continuously developed and applied to groundwater samples. These methods included the sampling of DNA and RNA, extraction of nucleic acids, cloning and sequencing of environmental nucleic acids, and real-time quantitative polymerase chain reaction (qPCR) for analysing amounts of DNA and RNA. The results of these analyses have been merged and interpreted, and the outcomes are reported here. The four methods for biomassrelated analysis correlated well. These methods focus on different characteristics of microbial cells: TNC analyses whole cells using a microscope, ATP analyses a cell component using a biochemical method, MPN is based on cultivation and qPCR analyses DNA (genes) and RNA (gene expression). The range of analytical focus encompassed by the methods ensures that the biomass-related information in this and previous reports from Olkiluoto and ONKALO is reliable and reflects a diverse range of the biomass-related characteristics of the analysed microorganisms. The distribution of the MPN data over depth from 2008 to 2009 followed the distribution found earlier. There were generally more cultivable microorganisms between depths of 200 and 400 m than in the shallower 50-200-m depth range. These new results agree with previous results, suggesting that

  11. Microbiology of Olkiluoto and ONKALO groundwater results and interpretations, 2008-2009

    International Nuclear Information System (INIS)

    Pedersen, K.; Arlinger, J.; Edlund, J.; Eriksson, L.; Lydmark, S.; Johansson, J.; Jaegevall, S.; Rabe, L.


    Microbiology cultivation, DNA, and RNA data were assembled from 18 groundwater samples from Olkiluoto, from deep drillholes ranging in depth from 62 to 708 m, and from groundwater from eight ONKALO drillholes ranging in depth from 7.1 to 318 m. Biomass was determined by counting total numbers of microbial cells (TNC) and determining adenosine triphosphate (ATP) concentrations. The aerobic cultivation method used comprised aerobic plate counts. Anaerobic most probable number (MPN) methods were used to determine counts of nitrate-, iron-, manganese-, and sulphatereducing bacteria, acetogenic bacteria, and methanogens. Molecular methods for analysing the diversity and abundance of microorganisms have been continuously developed and applied to groundwater samples. These methods included the sampling of DNA and RNA, extraction of nucleic acids, cloning and sequencing of environmental nucleic acids, and real-time quantitative polymerase chain reaction (qPCR) for analysing amounts of DNA and RNA. The results of these analyses have been merged and interpreted, and the outcomes are reported here. The four methods for biomassrelated analysis correlated well. These methods focus on different characteristics of microbial cells: TNC analyses whole cells using a microscope, ATP analyses a cell component using a biochemical method, MPN is based on cultivation and qPCR analyses DNA (genes) and RNA (gene expression). The range of analytical focus encompassed by the methods ensures that the biomass-related information in this and previous reports from Olkiluoto and ONKALO is reliable and reflects a diverse range of the biomass-related characteristics of the analysed microorganisms. The distribution of the MPN data over depth from 2008 to 2009 followed the distribution found earlier. There were generally more cultivable microorganisms between depths of 200 and 400 m than in the shallower 50-200-m depth range. These new results agree with previous results, suggesting that

  12. Geological Model of the Olkiluoto Site. Version 2.0

    International Nuclear Information System (INIS)

    Aaltonen, I.


    The rocks of Olkiluoto can be divided into two major classes: 1) supracrustal high-grade metamorphic rocks including various migmatitic gneisses, tonalitic-granodioriticgranitic gneisses, mica gneisses, quartz gneisses and mafic gneisses, and 2) igneous rocks including pegmatitic granites and diabase dykes. The migmatitic gneisses can further be divided into three subgroups in terms of the type of migmatite structure: veined gneisses, stromatic gneisses and diatexitic gneisses. On the basis of refolding and crosscutting relationships, the metamorphic supracrustal rocks have been subjected to polyphased ductile deformation, consisting of five stages, the D2 being locally the most intensive phase, producing thrust-related folding, strong migmatisation and pervasive foliation. In 3D modelling of the lithological units, an assumption has been made, on the basis of measurements in the outcrops, investigation trenches and drill cores, that the pervasive, composite foliation produced as a result of polyphase ductile deformation has a rather constant attitude in the ONKALO area. Consequently, the strike and dip of the foliation has been used as a tool, through which the lithologies have been correlated between the drillholes and from the surface to the drillholes. In addition, the largest ductile deformation zones and tectonic units are described in 3D model. The bedrock at the Olkiluoto site has been subjected to extensive hydrothermal alteration, which has taken place at reasonably low temperature conditions, the estimated temperature interval being from slightly over 300 deg C to less than 100 deg C. Two types of alteration can be observed: firstly, pervasive alteration and secondly fracturecontrolled alteration. Clay mineralisation and sulphidisation are the most prominent alteration events in the site area. Sulphides are located in the uppermost part of the model volume following roughly the foliation and lithological trend. Kaolinite is also mainly located in the

  13. Geological model of the Olkiluoto site. Version 1.0

    International Nuclear Information System (INIS)

    Mattila, J.; Aaltonen, I.; Kemppainen, K.


    The rocks of Olkiluoto can be divided into two major classes: (1) supracrustal high-grade metamorphic rocks including various migmatitic gneisses, tonalitic-granodioriticgranitic gneisses, mica gneisses, quartz gneisses and mafic gneisses, and (2) igneous rocks including pegmatitic granites and diabase dykes. The migmatitic gneisses can further be divided into three subgroups in terms of the type of migmatite structure: veined gneisses, stromatic gneisses and diatexitic gneisses. On the basis of refolding and crosscutting relationships, the metamorphic supracrustal rocks have been subjected to polyphased ductile deformation, consisting of five stages, the D2 being locally the most intensive phase, producing thrust-related folding, strong migmatisation and pervasive foliation. In 3D modelling of the lithological units, an assumption has been made, on the basis of measurements in the outcrops, investigation trenches and drill cores, that the pervasive, composite foliation produced as a result of polyphase ductile deformation has a rather constant attitude in the ONKALO area. Consequently, the strike and dip of the foliation has been used as a tool, through which the lithologies have been correlated between the drillholes and from the surface to the drillholes. The bedrock at the Olkiluoto site has been subjected to extensive hydrothermal alteration, which has taken place at reasonably low temperature conditions, the estimated temperature interval being from slightly over 300 deg C to less than 100 deg C. Two types of alteration can be observed: (1) pervasive (disseminated) alteration and (2) fracture-controlled (veinlet) alteration. Kaolinisation and sulphidisation are the most prominent alteration events in the site area. Sulphides are located in the uppermost part of the model volume following roughly the lithological trend (slightly dipping to the SE). Kaolinite is also located in the uppermost part, but the orientation is opposite to the main lithological trend

  14. Microbiology of Olkiluoto groundwater. Results and interpretations 2007

    International Nuclear Information System (INIS)

    Pedersen, K.; Arlinger, J.; Eriksson, S.; Hallbeck, M.; Johansson, J.; Jaegevall, S.; Karlsson, L.


    Research in 2007 continued the general program of analysing microorganisms and gas in deep groundwater. New tasks examined the presence of anaerobic methane oxidation, the growth of slime on the tunnel walls of ONKALO, and the possible presence of microorganisms that produce complexing agents in groundwater and the slime. Microbiology, chemistry, and dissolved gas data were assembled in 2007 from three deep drillholes in Olkiluoto, Finland, ranging in depth from 39.5 to 294.0 m and in 2005-2007 from six drillholes in ONKALO ranging in depth from 7.1 to 78.5 m. In addition, 24 analyses of gas from nine deep drillholes ranging in depth from 16 to 490 m and one analysis of gas from an ONKALO drillhole of a depth of 14.6 m were executed. The microbiology of shallow and deep groundwater from Olkiluoto had previously been analysed for almost three years from 2004 to 2006. Microbiological and geochemical data strongly suggested that the anaerobic microbial oxidation of methane (ANME) is active at a depth of approximately 300 m in Olkiluoto. However, proof of the presence and activity of ANME microorganisms was deemed necessary before the existence of active ANME processes in Olkiluoto groundwater could be accepted. Part of the research on behalf of Posiva Oy in 2007 therefore was focused on the development and testing of methods for detecting ANME microorganisms. The groundwater from the ONKALO tunnel was also analysed, and slimy biofilms were found growing on the rock walls at some positions in ONKALO late 2006. It was assumed that the ONKALO slime microbes were growing on various substances added to the shotcrete, the injected concrete, or both. Part of the 2007 research focused on detailed analysis of the slime microorganisms and their potential for acid production. The presence of microorganisms that produce complexing agents, for example, siderophores such as pyoverdin and ferrioxamine, was indicated in 2006 in the ONKALO slime as judged from DNA diversity data. It

  15. Quantitation and identification of methanogens and sulphate reducers in Olkiluoto groundwater

    International Nuclear Information System (INIS)

    Bomberg, M.; Nyyssoenen, M.; Itaevaara, M.


    involved in methanogenesis (mcrA) or sulphate reduction (dsrB) and enables the study of these microbial processes in the deep bedrock groundwater. In the GEOFUNC project, groundwater samples were studied from depths ranging from -14.5 m to -581 m comprising samples from both drillholes in Olkiluoto and groundwater stations in the ONKALO. Methanogenic archaea were present in almost all samples. The highest number of methanogens was detected in the samples ONK-PVA1 (-14.5 m), OL-KR40 (-349 to -351 m and -545 to -553 m) and OL-KR47 (-334 to -338 m) and OL-KR23 (-347 to -376 m). In the samples, where the salinity exceeded 19 g/l (Cl, Na, Ca), the number of methanogens was very low. Sulphate reducing bacteria were present in all studied samples. The highest number of sulphate reducers were detected in the samples ONK-PVA1 (-14.5 m), OL-KR23 (-347 to -376 m) and OLKR11 (-531 to -558 m) and OL-KR40 (-545 to -553 m), however, the last two samples are evident artefact mixtures of SO4 - and CH4 -rich groundwaters, thus they do not represent undisturbed in situ conditions in groundwater system. The diversity of methanogens changed in relation to depth and a clear division into phylogenetic groups containing either mcrA sequences from samples close to the land surface or mcrA sequences from deeper samples. The sulphate reducers were different in all studied samples. Despite their important ecological functions, both methanogens and sulphate reducers were present as only small fractions of the total microbial community in the Olkiluoto groundwater. The methanogens comprised at the most 0.44 % of the microbial community (-349 m) and the sulphate reducers 1.55 % (-14.5 m) and 1.3 % (-531 m). The results presented in this report give indications to the diversity and quantity of the populations of methanogenic archaea and sulphate reducing bacteria in the deep groundwater of Olkiluoto. In spite of the small number of methanogens and sulphate reducers in the environment there ecological

  16. Tomographic imaging of 12 fracture samples selected from Olkiluoto deep drillholes

    International Nuclear Information System (INIS)

    Kuva, J.; Voutilainen, M.; Timonen, J.; Aaltonen, I.


    Rock samples from Olkiluoto were imaged with X-ray tomography to analyze distributions of mineral components and alteration of rock around different fracture types. Twelve samples were analyzed, which contained three types of fractures, and each sample was scanned with two different resolutions. Three dimensional reconstructions of the samples with four or five distinct mineral components displayed changes in the mineral distribution around previously water conducting fractures, which extended to a depth of several millimeters away from fracture surfaces. In addition, structure of fracture filling minerals is depicted. (orig.)

  17. Completed lineament interpretation of the Olkiluoto region

    International Nuclear Information System (INIS)

    Paananen, M.


    Site characterization activities at Olkiluoto have been taking place for c. 25 years, including a wide range of different geophysical survey methods using various geometries and scales of investigation. The measurements have been done from the air, ground surface, shallow and deep drillholes and the ONKALO underground facility. As a part of the complementary site investigations, two low-altitude geophysical airborne survey campaigns were done around and at Olkiluoto in 2008 and 2009. The survey in 2008 was focused in the Eurajoensalmi area N or NE of Olkiluoto Island. The survey in 2009 covered most of the Olkiluoto Island, the neighbouring sea area and the archipelago W, SW and S of Olkiluoto as well as some of the mainland area SE of Olkiluoto. This report presents a new lineament interpretation based on these new geophysical airborne surveys. For the interpretation work, the data were extensively further processed into different gradients and filtered data sets and maps. Furthermore, the potential of automatic curvature analyses was examined. Also, quantitative profile interpretation was done from a number of profiles to find out the dips and exact locations of the contacts of some features. The qualitative interpretation of the lineaments was carried out by visually inspecting the different versions of the geophysical maps and by digitizing the geometry of each interpreted lineament. The lineaments are collated into two ArcGIS themes (one for magnetic and one for EM lineaments), accompanied by an attribute table that includes a number of attributes for each interpreted feature: lineament identifier, reference to the data used in interpretation, uncertainty, length, average orientation and probable geological character. The total number of new interpreted features is 125 magnetic and 33 electromagnetic lineaments. The main trend of the interpreted features varies between WNW-ESE and NNW-SSE. Furthermore, trends in directions almost N-S and E-W are also

  18. Completed lineament interpretation of the Olkiluoto region

    Energy Technology Data Exchange (ETDEWEB)

    Paananen, M. [Geological Survey of Finland, Espoo (Finland)


    Site characterization activities at Olkiluoto have been taking place for c. 25 years, including a wide range of different geophysical survey methods using various geometries and scales of investigation. The measurements have been done from the air, ground surface, shallow and deep drillholes and the ONKALO underground facility. As a part of the complementary site investigations, two low-altitude geophysical airborne survey campaigns were done around and at Olkiluoto in 2008 and 2009. The survey in 2008 was focused in the Eurajoensalmi area N or NE of Olkiluoto Island. The survey in 2009 covered most of the Olkiluoto Island, the neighbouring sea area and the archipelago W, SW and S of Olkiluoto as well as some of the mainland area SE of Olkiluoto. This report presents a new lineament interpretation based on these new geophysical airborne surveys. For the interpretation work, the data were extensively further processed into different gradients and filtered data sets and maps. Furthermore, the potential of automatic curvature analyses was examined. Also, quantitative profile interpretation was done from a number of profiles to find out the dips and exact locations of the contacts of some features. The qualitative interpretation of the lineaments was carried out by visually inspecting the different versions of the geophysical maps and by digitizing the geometry of each interpreted lineament. The lineaments are collated into two ArcGIS themes (one for magnetic and one for EM lineaments), accompanied by an attribute table that includes a number of attributes for each interpreted feature: lineament identifier, reference to the data used in interpretation, uncertainty, length, average orientation and probable geological character. The total number of new interpreted features is 125 magnetic and 33 electromagnetic lineaments. The main trend of the interpreted features varies between WNW-ESE and NNW-SSE. Furthermore, trends in directions almost N-S and E-W are also

  19. Groundwater sampling from shallow boreholes (PP and PR) and groundwater observation tubes (PVP) at Olkiluoto in 2004

    Energy Technology Data Exchange (ETDEWEB)

    Hirvonen, H. [Teollisuuden Voima Oyj, Eurajoki (Finland)


    Groundwater sampling from the shallow boreholes and groundwater observation tubes was performed in summer 2004 (PP2, PP3, PP7, PP8, PRl, PVPl, PVP3A, PVP3B, PVP4A and PVP4B) and in autumn 2004 (PP2, PP3, PP5, PP7, PP8, PP9, PP36, PP37, PP39, PR1, PR2, PVP1, PVP3A, PVP3B, PVP4A, PVP8A, PVP9A, PVP9B, PVP10B, PVP11, PVP12, PVP13, PVP14 and PVP20). The results from previous samplings have been used in the hydrogeochemical baseline characterization at Olkiluoto and some of the latest results have also been part of the ONKALO monitoring program. This study contains data on preliminary pumping of the sampling points and pumping for groundwater sampling and chemical analyses in the laboratory. This study also includes comparison with analytical results obtained between 1995-2004. The total dissolved solids (TDS) of groundwater samples were mainly below 1000 mg/L. According to Davis's TDS classification, these waters were fresh waters. The only exception was the water sample from shallow borehole PP7 (1400mg/L and 1450mg/L), which was brackish. Several different groundwater types were observed, but the most common water type was Ca-HCO{sub 3} (five samples). Analytical results from 1995-2003 were compared. During 2001-2003 in groundwater samples from sampling points PVP1, PVP9A and PP7 all measured main parameters changed considerably, but from summer 2003 to autumn 2004 the greatest alterations occurred in PR2, PVP1, PVP3A and PVP3B waters. These changes can be seen in almost all parameters. For other samples only minor changes in results were observed during the reference period. (orig.)

  20. Drilling and the associated borehole measurements of the pilot hole ONK-PH2

    International Nuclear Information System (INIS)

    Oehberg, A.; Aaltonen, I.; Kemppainen, K.; Mattila, J.; Heikkinen, E.; Lahti, M.; Pussinen, V.; Niemonen, J.; Paaso, N.; Rouhiainen, P.


    The construction of the ONKALO access tunnel started in September 2004 at Olkiluoto. Most of the investigations related to the construction of the access tunnel aim to ensure successful excavations, reinforcement and sealing. Pilot holes are boreholes, which are core drilled along the tunnel profile. The length of the pilot holes typically varies from several tens of metres to a couple of hundred metres. The pilot holes will mostly aim to confirm the quality of the rock mass for tunnel construction, and in particular at identifying water conductive fractured zones and at providing information that could result in modifications of the existing construction plans. The pilot hole ONK-PH2 was drilled in December 2004. The length of the borehole is about 122 metres. The aim during the drilling work was to orientate core samples as much as possible. The deviation of the borehole was measured during and after the drilling phase. Electric conductivity was measured from the collected returning water samples. Logging of the core samples included the following parameters: lithology, foliation, fracturing, fracture frequency, RQD, fractured zones, core loss and weathering. The rock mechanical logging was based on Q-classification. The tests to determine rock strength and deformation properties were made with a Rock Tester-equipment. Difference Flow method was used for the determination of hydraulic conductivity and hydraulic head in fractures and fractured zones in the borehole. The overlapping i.e. the detailed flow logging mode was used. The flow logging was performed with 0.5 m section length and with 0.1 m depth increments. Geophysical borehole logging and optical imaging surveys of the pilot hole PH2 included the field work of all the surveys, the integration of the data as well as interpretation of the acoustic and borehole radar data. One of the objectives of the geochemical study was to get information of composition of ONKALO's groundwater before the construction will

  1. Slug-tests in PP- and PVP-holes at Olkiluoto in 2008

    International Nuclear Information System (INIS)

    Keskitalo, K.


    As part of the program for the final disposal of the nuclear fuel waste, Posiva Oy investigates the hydrological conditions at the Olkiluoto island. The hydraulic conductivity in the shallow holes OL-PP36, OL-PP39, OL-PVP4A, OL-PVP4B, OL-PVP6A, OL-PVP6B, OL-PVP14, OL-PVP21, OL-PVP22, OL-PVP23, OL-PVP24, OL-PVP25, OL-PVP26, OL-PVP27, OL-PVP28, OL-PVP29, OL-HP1, OL-HP2 and OL-HP4 was measured in summer 2008. The length of PP-holes was between 12 and 14 m, and the test sections (1 m) are located in the bedrock. PVP-tubes have an average length between 3 - 11 m, and the test sections (mostly 2 m) are located in the overburden. The measurements were done using the slug-test technique. In the slug-test, the hydraulic head in the borehole is abruptly changed either by pouring water into the borehole or by lowering the pressure sensor. The hydraulic conductivity is interpreted from the recovery of the water level. This report presents the field measurements and their interpretation. The interpretation has been done using the Hvorslev's method, and for reference, conductivity has also been calculated according to Thiem's equation. According to the results, hydraulic conductivity in PP-holes ranges from 10 -9 m/s to 10 -6 m/s and in PVP-tubes from 10 -8 m/s to 10 -5 m/s. The observed range is similar as in the previous measurements in 2002 and 2004 - 2007. In general, the results are consistent with the results obtained in earlier measurements. In OL-PVP14, there seems to be a lowering trend of the conductivity. In OL-PVP4A the results seem to have slight increase year after year. Also, the results agree with hydraulic conductivity interpreted from the pre-pumping done in connection with the groundwater sampling or installation of observation tubes. (orig.)

  2. Slug-tests in PP- and PVP-holes at Olkiluoto in 2009

    International Nuclear Information System (INIS)

    Isola, O.


    As part of the program for the final disposal of the nuclear fuel waste, Posiva Oy investigates the hydrological conditions at the Olkiluoto Island. The hydraulic conductivity in the shallow holes OL-PP36, OL-PP39, OL-PVP4A, OL-PVP4B, OL-PVP6A, OL-PVP6B, OL-PVP14, OL-PVP30, OL-PVP31A, OL-PVP31B, OLPVP32, OL-PVP33, OL-PVP34A, OL-PVP34B, OL-HP1, OL-HP2, OL-HP3 and OLHP4 was measured in summer 2009. The length of PP-holes was between 12 and 14 m, and the test sections (1 m) are located in the bedrock. PVP-tubes have an average length between 3 - 11 m, and the test sections (mostly 2 m) are located in the overburden. The measurements were done using the slug-test technique. In the slug-test, the hydraulic head in the borehole is abruptly changed either by pouring water into the borehole or by lowering the pressure sensor. The hydraulic conductivity is interpreted from the recovery of the water level. This report presents the field measurements and their interpretation. The interpretation has been done using the Hvorslev's method, and for reference, conductivity has also been calculated according to Thiem's equation. According to the results, hydraulic conductivity in PP-holes ranges from 10 -1 0 m/s to 10 -6 m/s and in PVP-tubes from 10 -8 m/s to 10 -5 m/s. The observed range is quite similar as in the previous measurements in 2002 and 2004 - 2008. In general, the results are consistent with the results obtained in earlier measurements. In OL-PVP14, there seems to be a lowering trend of the conductivity. Also, the results agree relatively well with hydraulic conductivity interpreted from the pre-pumping done in connection with the groundwater sampling. (orig.)

  3. Slug-Tests in PP- and PVP-holes at Olkiluoto in 2007

    International Nuclear Information System (INIS)

    Keskitalo, K.


    As part of the program for the final disposal of the nuclear fuel waste, Posiva Oy investigates the hydrological conditions at the Olkiluoto island. The hydraulic conductivity in the shallow holes OL-PP9, OL-PP36, OL-PP39, OL-PVP3A, OL-PVP3B, OL-PVP4A, OL-PVP4B, OL-PVP6A, OL-PVP6B, OL-PVP7A, OL-PVP8A, OL-PVP8B, OL-PVP9A, OL-PVP9B, OL-PVP10A, OL-PVP10B, OL-PVP11, OL-PVP12, OL-PVP13, OL-PVP14, OL-PVP17, OL-PVP18A, OL-PVP18B, OL-PVP19 and OL-PVP20 was measured in summer 2007. The length of PP-holes varies between 12 and 15 m, and the test sections (1 m) are located in the bedrock. PVP-tubes have an average length between 3 - 9 m up to 17 m, and the test sections (mostly 2 m) are located in the overburden. The measurements were done using the slug-test technique. In the slug-test, the hydraulic head in the borehole is abruptly changed either by pouring water into the borehole or by lowering the pressure sensor. The conductivity is interpreted based on the recovery of the water level. This report presents the field measurements and their interpretation. The interpretation has been done using the Hvorslev's method, and for reference, conductivity has also been calculated according to Thiem's equation. According to the results, hydraulic conductivity in PP-holes ranges from 10-9 m/s to 10-6 m/s and in PVP-tubes from 10-8 m/s to 10-4 m/s. The range is similar as observed in measurements of years 2002, 2004, 2005 and 2006. In general, the results are consistent with the results obtained in earlier measurements. Some exceptions exist in OL-PVP6B, where the conductivity is higher than in the earlier measurements. In OL-PVP14, there seems to be a lowering trend of the conductivity. In OL-PP9, the conductivity in test section 5.3 - 6.3 m in 2007 was about one order of magnitude lower than in 2005 but the results from 2007, 2006, and 2002 correlate well in that section. Also, the results agree with hydraulic conductivity interpreted from the pre-pumping done in connection with

  4. Mise-a-la masse survey 2012-2013 in Olkiluoto and modelling of the data

    International Nuclear Information System (INIS)

    Ahokas, T.; Paananen, M.; Paulamaeki, S.; Korhonen, K.; Tiensuu, K.


    This report describes the Mise-a-la-masse (MAM) survey carried out in the Olkiluoto area in 2012 - 2013 and the modelling of the data. The aim of the survey was to find out the continuation of some electrically conductive zones intersected by drillholes drilled in the eastern part of the Olkiluoto island. In the modelling of the data both theoretical calculations and manual modelling were used to get more reliability to the modelling results. Also all the geological information of the known brittle fault zones was taken into account in the modelling. The modelling results will be used in the updates of the geological and hydrogeological models of the Olkiluoto area. Many of the electrically conductive zones modelled from the surveyed data coincide with the brittle deformation zones presented in the present geological model. The results showed also possibilities to join some modelled brittle zones together. According to the modelling results many brittle zones, especially the brittle and hydraulically conductive zone BFZ019C/HZ19C, has a quite complex structure. Many brittle zones also seem to have galvanic connections between each other. (orig.)

  5. Visualisation and interpretation of the autumn 2006 mise-a-la-masse survey data at the Olkiluoto site

    International Nuclear Information System (INIS)

    Lehtonen, T.


    previous surveys. The best electrical connections from current earthings in drillholes OL-KR4 and OL-KR27 were found to drillhole OL-KR40. Drillholes OL-KR41, OL-KR42 and OL-KR43 are too remotely situated for reliable interpretations. Ground surveys were hampered strongly by electrical disturbances of the infrastructure in the Olkiluoto. Results of the all surveys are also collected in the same table, where every one of connections is classified. Interpretations are merely based on mise-a-la-masse data. (orig.)

  6. Estimating the mechanical properties of the brittle deformation zones at Olkiluoto

    International Nuclear Information System (INIS)

    Hudson, J.A.; Cosgrove, J.W.; Johansson, E.


    In rock mechanics modelling to support repository design and safety assessment for the Olkiluoto site, it is necessary to obtain the relevant rock mechanics parameters, these being an essential pre-requisite for the modelling. The parameters include the rock stress state, the properties of the intact rock and the rock mass, and the properties of the brittle deformation zones which represent major discontinuities in the rock mass continuum. However, because of the size and irregularity of the brittle deformation zones, it is not easy to estimate their mechanical properties, i.e. their deformation and strength properties. Following Section 1 explaining the motivation for the work and the objective of the Report, in Sections 2 and 3, the types of fractures and brittle deformation zones that can be encountered are described with an indication of the mechanisms that lead to complex structures. The geology at Olkiluoto is then summarized in Section 4 within the context of this Report. The practical aspects of encountering the brittle deformation zones in outcrops, drillholes and excavations are described in Sections 5 and 6 with illustrative examples of drillhole core intersections in Section 7. The various theoretical, numerical and practical methods for estimating the mechanical properties of the brittle deformation zones are described in Section 8, together with a Table summarizing each method's advantages, disadvantages and utility in estimating the mechanical properties of the zones. We emphasise that the optimal approach to estimating the mechanical properties of the brittle deformation zones cannot be determined without a good knowledge, not only of each estimation method's capabilities and idiosyncrasies, but also of the structural geology background and the specific nature of the brittle deformation zones being characterized. Finally, in Section 9, a Table is presented outlining each method's applicability to the Olkiluoto site. A flowchart is included to

  7. Hydraulic conductivity measurements with HTU at Eurajoki, Olkiluoto, drillholes OL-KR19, OL-KR45 and OL-KR46 in 2009 and 2010

    Energy Technology Data Exchange (ETDEWEB)

    Haemaelaeinen, H. [Geopros Oy, Helsinki (Finland)


    As a part of the site investigations for the disposal of spent nuclear fuel, hydraulic conductivity measurements were carried out with HTU-equipment in drillholes OL-KR19, OL-KR45 and OL-KR46 at Eurajoki, Olkiluoto. The objective was to investigate the distribution of the hydraulic conductivity in the surrounding bedrock volume. Measurements were carried out during 2009 and 2010. The total length of the borehole OL-KR19 is 544,34 m, 241,80 m of which was covered by 121 standard tests with 2 m packer separation as specified in the measurement plan. Respectively, OL-KR45 is 1023,30 m long and 63 similar tests were made in it covering 126,00 m of the hole and OL-KR46 600,10 m long, 151 tests made covering 301,35 m. The measured sections are around the depths of the planned repository. Double-packer constant-head method was used throughout with nominal 200 kPa overpressure. Injection stage lasted normally 20 minutes and fall-off stage 10 minutes. The tests were often shortened if there were clear indications that the hydraulic conductivity is below the measuring range of the system. The pressure in the test section was let to stabilise at least 5 min before injection. In some test sections the test stage times were extended. Two transient (Horner and 1/Q) interpretations and one stationary- state (Moye) interpretation were made in-situ immediately after the test. The Hydraulic Testing Unit (HTU-system) is owned by Posiva Oy and it was operated by Geopros Oy. (orig.)

  8. Slug-tests in PP- and PVP-holes at Olkiluoto in 2010

    International Nuclear Information System (INIS)

    Hinkkanen, H.


    As part of the program for the final disposal of the nuclear fuel waste, Posiva Oy investigates the hydrological conditions at the Olkiluoto Island. The hydraulic conductivity in the shallow holes OL-PP36, OL-PP39, OL-PVP4A, OL-PVP4B, OL-PVP6A, OL-PVP6B, OL-PVP7A, OL-PVP8A, OL-PVP8B, OL-PVP9A OL-PVP9B, OL-PVP9C, OL-PVP10A, OL-PVP10B, OL-PVP11, OL-PVP12, OLPVP14, OL-PVP17, OL-PVP19, OL-PVP20, OL-PVP30, OL-PVP31A, OL-PVP31B, OL-PVP32, OL-PVP33, OL-PVP34A, OL-PVP34B, OL-HP1, OL-HP2, OL-HP3 and OL-HP4 was measured in summer 2010. The length of PP-holes was between 12 and 14 m, and the test sections (1 m) are located in the bedrock. PVP-tubes have an average length between 3..11 m up to c. 17 m, and the test sections (mostly 2 m) are located in the overburden. The measurements were carried out using the slug-test technique with renewed equipment. In the slug-test, the hydraulic head in the borehole is abruptly changed either by pouring water into the borehole or by lowering the pressure sensor. The hydraulic conductivity is interpreted from the recovery of the water level. This report presents the field measurements and their interpretation. The interpretation has been done using the Hvorslev's method, and for reference, conductivity has also been calculated according to Thiem's equation. According to the results, hydraulic conductivity in PP-holes ranges from 10-9 m/s to 10-6 m/s and in PVP-tubes from 10-8 m/s to 10-4 m/s. The observed range is quite similar as in the previous measurements in 2002 and 2004-2009. In general, the results are consistent with the results obtained in earlier measurements. In OL-PVP14, the earlier observed lowering trend of the conductivity seems to have stabilized. Also, the results agree relatively well with hydraulic conductivity interpreted from the pre-pumping done in connection with the groundwater sampling. (orig.)

  9. Prediction of long-term influence of ONKALO and Korvensuo reservoir on groundwater level and water balance components on Olkiluoto island

    International Nuclear Information System (INIS)

    Karvonen, T.


    The Olkiluoto surface hydrological model was used to compute the influence of various ONKALO leakage scenarios on changes in groundwater level in overburden soils and hydraulic heads in the bedrock. Moreover, the model effect of ONKALO leakages on water balance components of the Olkiluoto Island (runoff, evapotranspiration, discharge to the sea area through the bedrock and discharge from the Korvensuo reservoir) and on the thickness and area of unsaturated bedrock layer were computed. Leakages into ONKALO lower the groundwater level in overburden soils especially during those years when precipitation is smaller than the long-term average value 550 mm a -1 . According to model results groundwater level can be below sea level if leakage rate into ONKALO is 180 l/min or more. If leakage rate is smaller than 180 l/min groundwater level is above sea level all the time also during dry years. The modelling results show that there are local water divides inside the island both on the southern and northern side of ONKALO at all time points and for all leakage rates. The local water divides ensure that sea water cannot intrude to ONKALO via surface waters. A more detailed version of the Olkiluoto surface hydrological model was developed for the area around the infiltration experiment. Site scale data were available for the location of the most transmissive hydrogeological zones. The analysis of hydraulic responses has shown that there are local connections between different areas around the pumping drillhole OL-KR14. The importance of the local responses was verified by an additional small hydrogeological zone HZInf connecting HZ19A, HZ19C, OL-KR14, OL-PP66, OL-PP68 and OL-PP69 that was added to the model. In future studies it is necessary to describe the local zones explicitly in the model to allow more realistic flow simulations. Discharge has been measured manually in four measuring weirs since March 2003. The old V-shaped measuring weirs were replaced by new automatic

  10. Summary of petrophysical analysis of Olkiluoto. Core samples 1990-2008

    International Nuclear Information System (INIS)

    Heikkinen, E.; Oehman, I.; Paulamaeki, S.; Saeaevuori, H.; Vuoriainen, S.; Aaltonen, I.


    Posiva prepares for disposal of spent nuclear fuel in deep geological repository at Olkiluoto, Eurajoki. This is in accordance of the application filed in 1999, the Decision in Principle of the State Council in 2000, and ratification by the Parliament in 2001.The site characterization has included comprehensive geological, hydrological and geophysical investigations airborne, on ground and in drillholes since 1988. Petrophysical analysis has been carried out to enhance knowledge on physical properties in rock mass. Also the large scale geophysical interpretations will essentially benefit on this knowledge. This report is associated with and covering the 2005-2008 sampling campaign (932 samples), but also pre-existing results (506 samples from 1990 - 2004) are discussed in the report. Data has been acquired from non-broken core samples, and of representative locations of lithological units. Samples have been taken at 10-30 m interval from all core sections. Selecting the samples and analysis has been carried out for different purposes during campaigns. Altogether there are 1438 samples from drillholes OL-KR1 - OL-KR39 and ONK-PH01-PH07. Petrophysical measurements included density, susceptibility and remanence (partly oriented), resistivity, IP value (frequency effect), P-wave velocity and porosity. Sample data was analyzed for distributions and mutual relations. Petrophysical signatures of different parameters were assessed by lithology. Mineral composition and texture will affect to petrophysical results. Deformation and alteration cause an overprint to lithology specific values. In petrophysical sense, granite pegmatite is distinguished from all other rock types. It is of rather high resistivity and P-wave velocity, and low density and susceptibility. Other distinct lithological unit is mafic gneisses. They are described by high density and Pwave velocity, and also increased susceptibility, IP value and resistivity. The tonaliticgranodioritic- granitic gneiss

  11. Compilation and analysis of hydrogeological pressure responses to field activities in Olkiluoto during 2006-2009

    Energy Technology Data Exchange (ETDEWEB)

    Vaittinen, T.; Pentti, E. [Poeyry Finland Oy, Vantaa (Finland)


    Groundwater flow characteristics provide essential input for the construction and safety assessment of a disposal facility for spent nuclear fuel. On the Olkiluoto site flow connections have been studied in deep drillholes by means of long-term pumping tests, various interference tests, and by interpreting the measured hydraulic heads. This report focuses on the assessment of measured hydraulic heads during 2006-2009. Hydraulic heads have been measured both in open and in packed-off drillholes since 1991. The interpretation of the hydraulic connections is based on observed changes in hydraulic head distribution caused by certain investigation activities on the site. Field activities may increase the head, e.g. drilling, or more typically decrease the head, e.g. flush pumping after drilling, difference flow logging with pumping, and both temporary and currently stable inflows into underground facilities caused by the construction of ONKALO. Processing of the head observations has been developed by determining section-specific corrections for natural fluctuation of the groundwater. The objective of the corrections is to remove natural fluctuation of the groundwater table and sea level, tidal effect, and atmospheric pressure to improve detection of changes in hydraulic head caused by field activities. Time series of observations are compared to schedules of field activities and values for responses are calculated. In addition to temporary responses head drawdown at the end of 2009 is estimated. Analysed responses are mainly related to pumpings from open drillholes and to construction of the access tunnel and the shafts through the hydrogeological HZ19 system until June 2008. Since July 2008 the strongest responses are caused by excavation of the access tunnel and pre-grouting of the shafts through the hydrogeological HZ20 system. Based on the head observations in packed-off drillholes, sub-horizontal hydraulic zones form a layered system at the ONKALO area

  12. Compilation and analysis of hydrogeological pressure responses to field activities in Olkiluoto during 2006-2009

    International Nuclear Information System (INIS)

    Vaittinen, T.; Pentti, E.


    Groundwater flow characteristics provide essential input for the construction and safety assessment of a disposal facility for spent nuclear fuel. On the Olkiluoto site flow connections have been studied in deep drillholes by means of long-term pumping tests, various interference tests, and by interpreting the measured hydraulic heads. This report focuses on the assessment of measured hydraulic heads during 2006-2009. Hydraulic heads have been measured both in open and in packed-off drillholes since 1991. The interpretation of the hydraulic connections is based on observed changes in hydraulic head distribution caused by certain investigation activities on the site. Field activities may increase the head, e.g. drilling, or more typically decrease the head, e.g. flush pumping after drilling, difference flow logging with pumping, and both temporary and currently stable inflows into underground facilities caused by the construction of ONKALO. Processing of the head observations has been developed by determining section-specific corrections for natural fluctuation of the groundwater. The objective of the corrections is to remove natural fluctuation of the groundwater table and sea level, tidal effect, and atmospheric pressure to improve detection of changes in hydraulic head caused by field activities. Time series of observations are compared to schedules of field activities and values for responses are calculated. In addition to temporary responses head drawdown at the end of 2009 is estimated. Analysed responses are mainly related to pumpings from open drillholes and to construction of the access tunnel and the shafts through the hydrogeological HZ19 system until June 2008. Since July 2008 the strongest responses are caused by excavation of the access tunnel and pre-grouting of the shafts through the hydrogeological HZ20 system. Based on the head observations in packed-off drillholes, sub-horizontal hydraulic zones form a layered system at the ONKALO area

  13. Results of monitoring at Olkiluoto in 2012 - hydrology and hydrogeology

    Energy Technology Data Exchange (ETDEWEB)

    Vaittinen, T.; Ahokas, H.; Komulainen, J.; Nummela, J.; Pentti, E.; Tammisto, E.; Turku, J. [Poeyry Finland Oy, Espoo (Finland); Karvonen, T. [WaterHope, Helsinki (Finland); Aro, S.


    The impact of the construction of ONKALO is monitored by measuring and observing numerous different parameters related to hydrology, geochemistry, environment, rock mechanics and foreign materials. The Hydrological Monitoring Programme consists of the following parameters: groundwater level, hydraulic head, flow conditions in open drillholes, transverse flow, hydraulic conductivity, groundwater salinity (in situ EC), precipitation (including snow), sea-water level, surface flow (runoff), infiltration, ground frost, leakages in tunnels, and water balance in the tunnel system and in Korvensuo Reservoir. This Report focuses on hydrogeological parameters. Other parameters, like precipitation, ground frost etc. will be reported in the Monitoring Report of Environment. Updated monitoring program was introduced in the beginning of 2012. The updated program will be used for the period before repository operation. Only minor changes were implemented. Monitoring has been carried out according to plan. This Report presents the results for the year 2012. The access tunnel was excavated from chainage 4913 m to chainage 4987 m in 2012. In addition, demonstration tunnel 2 from chainage 65 m to 101 m and some technical facilities were excavated. Total inflow into ONKALO down to chainage 4580 m including shaft ONK-KU2 down to level -427m was 36 l/min at the end of 2012. The mapping of water leakages and moisture conditions on the tunnel walls and the ceiling has been continued. The general pattern of leakages has remained similar during the construction of ONKALO. Most significant differences are caused by seasonal effects like condensation of warm ventilation air on tunnel walls and ceiling. The changes observed in the groundwater level in shallow observation tubes in the overburden and in shallow drillholes in the bedrock are not necessarily caused by the construction of ONKALO. However, weak indications of a local decrease in groundwater level have been observed. Effects on the

  14. DFN Modeling for the Safety Case of the Final Disposal of Spent Nuclear Fuel in Olkiluoto, Finland (United States)

    Vanhanarkaus, O.


    Olkiluoto Island is a site in SW Finland chosen to host a deep geological repository for high-level nuclear waste generated by nuclear power plants of power companies TVO and Fortum. Posiva, a nuclear waste management organization, submitted a construction license application for the Olkiluoto repository to the Finnish government in 2012. A key component of the license application was an integrated geological, hydrological and biological description of the Olkiluoto site. After the safety case was reviewed in 2015 by the Radiation and Nuclear Safety Authority in Finland, Posiva was granted a construction license. Posiva is now preparing an updated safety case for the operating license application to be submitted in 2022, and an update of the discrete fracture network (DFN) model used for site characterization is part of that. The first step describing and modelling the network of fractures in the Olkiluoto bedrock was DFN model version 1 (2009), which presented an initial understanding of the relationships between rock fracturing and geology at the site and identified the important primary controls on fracturing. DFN model version 2 (2012) utilized new subsurface data from additional drillholes, tunnels and excavated underground facilities in ONKALO to better understand spatial variability of the geological controls on geological and hydrogeological fracture properties. DFN version 2 connected fracture geometric and hydraulic properties to distinct tectonic domains and to larger-scale hydraulically conductive fault zones. In the version 2 DFN model, geological and hydrogeological models were developed along separate parallel tracks. The version 3 (2017) DFN model for the Olkiluoto site integrates geological and hydrogeological elements into a single consistent model used for geological, rock mechanical, hydrogeological and hydrogeochemical studies. New elements in the version 3 DFN model include a stochastic description of fractures within Brittle Fault Zones (BFZ

  15. Optimizing grade-control drillhole spacing with conditional simulations

    Directory of Open Access Journals (Sweden)

    Adrian Martínez-Vargas


    Full Text Available This paper summarizes a method to determine the optimum spacing of grade-control drillholes drilled with reverse-circulation. The optimum drillhole spacing was defined as that one whose cost equals the cost of misclassifying ore and waste in selection mining units (SMU. The cost of misclassification of a given drillhole spacing is equal to the cost of processing waste misclassified as ore (Type I error plus the value of the ore misclassified as waste (Type II error. Type I and Type II errors were deduced by comparing true and estimated grades at SMUs, in relation to a cuttoff grade value and assuming free ore selection. True grades at SMUs and grades at drillhole samples were generated with conditional simulations. A set of estimated grades at SMU, one per each drillhole spacing, were generated with ordinary kriging. This method was used to determine the optimum drillhole spacing in a gold deposit. The results showed that the cost of misclassification is sensitive to extreme block values and tend to be overrepresented. Capping SMU’s lost values and implementing diggability constraints was recommended to improve calculations of total misclassification costs.

  16. Results of monitoring at Olkiluoto in 2012. Rock mechanics

    International Nuclear Information System (INIS)

    Johansson, E.; Siren, T.


    datalogger. The results showed that the displacement behaviour was stable during 2012 and no significant changes took place. For the first time temperature measurements were collected from different sources of the Olkiluoto site (surface, drillholes and underground in the ONKALO). All the results were analysed and they indicate relatively uniform distributions of temperature in all depths across the site. Thermal gradient is around 1.4 deg C/100 m below 300 m. Visual observations from the ONKALO tunnels were also collected and analysed. The rock noises i.e. first indication of possible rock damage have been only recorded after the depth of 250 m and often related to the tunnel crossings or intersections. Rock fallouts have been observed at all depths (150 - 450 m) and they seem to be affected more by the weaknesses in the rock structure (foliation, fracturing, rock type contacts) than the tunnel orientation. (orig.)

  17. Results of monitoring at Olkiluoto in 2013. Hydrology and hydrogeology

    Energy Technology Data Exchange (ETDEWEB)

    Vaittinen, T.; Ahokas, H.; Komulainen, J.; Nummela, J.; Pentti, E.; Turku, J. [Poeyry Finland Oy, Vantaa (Finland); Karvonen, T. [WaterHope, Helsinki (Finland); Aro, S.


    The impact of the construction of ONKALO is monitored by measuring and observing numerous different parameters related to hydrology, geochemistry, environment, rock mechanics and foreign materials. The Hydrological Monitoring Programme consists of the following parameters: groundwater level, hydraulic head, flow conditions in open drillholes, transverse flow, hydraulic conductivity, groundwater salinity (in situ EC), precipitation (including snow), sea-water level, surface flow (runoff), infiltration, ground frost, leakages in tunnels, and water balance in the tunnel system and in Korvensuo Reservoir. This Report focuses on hydrogeological parameters. Other parameters, like precipitation, ground frost etc. will be reported in the Monitoring Report of Environment. Updated monitoring program was introduced in the beginning of 2012. The updated program will be used for the period before repository operation. Only minor changes were implemented. Monitoring has been carried out according to plan. This Report presents the results for the year 2013. Excavation of the access tunnel was completed in 2012. Demonstration tunnels 3 and 4 were excavated and central tunnel 1 was continued from chainage 4366-22 m to chainage 4366-60 m in 2013. Total inflow into ONKALO down to chainage 4580 m including shaft ONK-KU2 down to level -437 m was on average 35 l/min in 2013. The mapping of water leakages and moisture conditions on the tunnel walls and the ceiling has been continued. The general pattern of leakages has remained similar during the construction of ONKALO. Most significant differences are caused by seasonal effects like condensation of warm ventilation air on tunnel walls and ceiling. The changes observed in the groundwater level in observation tubes in the overburden and in shallow drillholes in the bedrock are not necessarily caused by the construction of ONKALO. However, weak indications of a local decrease in groundwater level have been observed. Effects on the head

  18. Diagenesis of sedimentary phosphorite deposits in Djebel Onk basin, Algeria

    DEFF Research Database (Denmark)

    Redjehimi, Hacène; Friis, Henrik; Boutaleb, Abdelhak

    affecting the Upper Paleocene phosphorites of the Djebel Onk include: (1) accumulation of phosphate grains, (2) compaction, (3) dolomite cementation, (3) minor amount of other diagenetic mineral cements: opal-CT, K-feldspar overgrowth, clinoptinolite and pyrite, (4) dissolution of dolomite crystals...

  19. Analysis of temperature data at the Olkiluoto

    Energy Technology Data Exchange (ETDEWEB)

    Sedighi, M.; Bennett, D.; Masum, S.; Thomas, H. [Cardiff Univ. (United Kingdom); Johansson, E. [Saanio and Riekkola Oy, Helsinki (Finland)


    As part of the rock mechanics monitoring programme 2012 at Olkiluoto, temperature data have been recorded. Temperature data have been measured, collected and monitored at the Olkiluoto site and in ONKALO in various locations, by different methods and in conjunction with other investigations carried out at the site. This report provides a detailed description of the investigation and analysis carried out on temperature datasets. This report aims to provide a better understanding of the in-situ temperature of the rock and soil at the site. Three categories of datasets have been analysed and studied from the Posiva thermal monitoring programme. These consist of: (i) data collected from the various drillholes during geophysical logging and Posiva Flow Log (PFL) measurements, (ii) measurements in the ONKALO ramp, the investigation niche located at elevation -140 m and a technical room located at 437 m below the surface, and (iii) surface temperature measurements from four weather stations and four measurement ditches. Time-series data obtained from the groundwater temperature measurements during the 'Posiva Flow Log' (PFL) tests in drillholes OL-KR1 to KR55 at different depths and years have been analysed. Temperature at a depth of 400 m was found to be in the range of 10 to 11 deg C. The geothermal gradient obtained from the PFL data without pumping was found to be approximately 1.4 deg C/100m with relatively uniform temporal and spatial patterns at the repository depth, i.e. at 400 m.The geothermal gradient obtained from the results of the PFL measurements and geophysical loggings indicate similar temperature values at the repository depths, i.e. 400 m. The characteristics of the time series data related to the ONKALO measurements, have been obtained through a series of Non-uniform Discrete Fourier Transform analysis Datasets related to the various chainages and investigation niche at ONKALO have been studied. The largest variation in the temperature

  20. Analysis of temperature data at the Olkiluoto

    International Nuclear Information System (INIS)

    Sedighi, M.; Bennett, D.; Masum, S.; Thomas, H.; Johansson, E.


    As part of the rock mechanics monitoring programme 2012 at Olkiluoto, temperature data have been recorded. Temperature data have been measured, collected and monitored at the Olkiluoto site and in ONKALO in various locations, by different methods and in conjunction with other investigations carried out at the site. This report provides a detailed description of the investigation and analysis carried out on temperature datasets. This report aims to provide a better understanding of the in-situ temperature of the rock and soil at the site. Three categories of datasets have been analysed and studied from the Posiva thermal monitoring programme. These consist of: (i) data collected from the various drillholes during geophysical logging and Posiva Flow Log (PFL) measurements, (ii) measurements in the ONKALO ramp, the investigation niche located at elevation -140 m and a technical room located at 437 m below the surface, and (iii) surface temperature measurements from four weather stations and four measurement ditches. Time-series data obtained from the groundwater temperature measurements during the 'Posiva Flow Log' (PFL) tests in drillholes OL-KR1 to KR55 at different depths and years have been analysed. Temperature at a depth of 400 m was found to be in the range of 10 to 11 deg C. The geothermal gradient obtained from the PFL data without pumping was found to be approximately 1.4 deg C/100m with relatively uniform temporal and spatial patterns at the repository depth, i.e. at 400 m.The geothermal gradient obtained from the results of the PFL measurements and geophysical loggings indicate similar temperature values at the repository depths, i.e. 400 m. The characteristics of the time series data related to the ONKALO measurements, have been obtained through a series of Non-uniform Discrete Fourier Transform analysis Datasets related to the various chainages and investigation niche at ONKALO have been studied. The largest variation in the temperature amplitude of data

  1. Difference flow measurements in Greenland, drillhole DH-GAP04 in July 2011

    Energy Technology Data Exchange (ETDEWEB)

    Poellaenen, J.; Heikkinen, P. [Poyry Finland Oy, Vantaa (Finland); Lehtinen, A.


    To improve the understanding of processes associated with glaciation and their impact on the long-term performance of a deep geological repository of spent nuclear fuel, the Greenland Analogue Project (GAP) has been initiated collaboratively by SKB, Posiva and NWMO. The study site encompasses a land terminus portion of the Greenland ice sheet, east of Kangerlussuaq, and is in many ways considered to be an appropriate analogue of the conditions that are expected to prevail in much of Canada and Fennoscandia during future glacial cycles. The project began in 2009 and is scheduled for completion in 2012. In 2011, deep drillhole DH-GAP04 was drilled at the study site and Posiva Flow Log measurements were carried out in the drillhole. The Posiva Flow Log, Difference Flow Method (PFL DIFF) uses a flowmeter that incorporates a flow guide and can be used for relatively quick determinations of transmissivity and hydraulic head in fractures/fractured zones in cored drillholes. The aim of the measurements was to find high transmissive fractures, which would define the target for water sampling, i.e. the location for the packers in the drillhole. This report presents the principles of the method and the results of measurements carried out in drillhole DH-GAP04 in July 2011. The length of the flow guide in the flow logging measurements was 10 m (section length). Flow into the drillhole or from the drillhole to the bedrock was measured within the section length. The measurements were carried out in both pumped and natural (i.e. un-pumped) conditions. Calculations of the transmissivity (T) and the hydraulic head (h) of the fractures are shown in the results. Measurements were carried out in drillhole length interval 184 - 675 m without pumping. During pumping, measurements were conducted in drillhole length interval 274 - 675 m due to permafrost condition above this level. The risk for the drillhole freezing over in the permafrost area was remarkable. Due to lack of time, the

  2. Olkiluoto site description 2011

    International Nuclear Information System (INIS)


    This fourth version of the Olkiluoto Site Report, produced by the OMTF (Olkiluoto Modelling Task Force), updates the Olkiluoto Site Report 2008 with the data and knowledge obtained up to December 2010. A descriptive model of the site (the Site Descriptive Model, SDM), i.e. a model describing the geological and hydrogeological structure of the site, properties of the bedrock and the groundwater and its flow, and the associated interacting processes and mechanisms. The SDM is divided into six parts: surface system, geology, rock mechanics, hydrogeology, hydrogeochemistry and transport properties

  3. Olkiluoto site description 2011

    Energy Technology Data Exchange (ETDEWEB)



    This fourth version of the Olkiluoto Site Report, produced by the OMTF (Olkiluoto Modelling Task Force), updates the Olkiluoto Site Report 2008 with the data and knowledge obtained up to December 2010. A descriptive model of the site (the Site Descriptive Model, SDM), i.e. a model describing the geological and hydrogeological structure of the site, properties of the bedrock and the groundwater and its flow, and the associated interacting processes and mechanisms. The SDM is divided into six parts: surface system, geology, rock mechanics, hydrogeology, hydrogeochemistry and transport properties.

  4. Selected visualizations and summaries of the contents of the foliation and lithology data regarding drillholes OL-KR1 - OL-KR38

    International Nuclear Information System (INIS)

    Kuusisto, S.; Raunio, J.-P.


    Posiva Oy has acquired an extensive amount of data on the geology of the Olkiluoto Island. Part of that data is the collection of foliation information, known as the foliation database. In this work, the foliation database was studied and analyzed using data mining techniques aiming to characterize the properties of the database. The goal was to discover previously unknown correlations, patterns, and properties contained within the data. In addition to the foliation database, deviation survey measurements were used as a supporting dataset. The following analyses related to the general properties of the database were carried out: logical discrepancies and potential errors in data; statistics of alphanumeric strings, numeric values, and empty fields; discovery of stereotypic data items whose appearance count deviates significantly from the count that would be expected if the properties were assumed independent; analysis of free text remarks; comparison between reported foliation orientations with those that were recalculated using the core orientations and foliation orientations with respect to core. Rock and foliation type sequences were analysed both in terms of the lengths of contiguous segments and the frequencies in which different sequences appear in the drillholes. The variance of rock types and the density of measurements was assessed by dividing the bedrock volume of interest into cubes and providing numerical values for these quantities for each cube. This was carried out in two resolutions: cube's sides were 500 m and 200 m. The foliation orientations were summarized also with respect to these cubes. In addition to analysis tasks, another task was to come up with alternative bedrock models - in terms of rock type units - based on data that contains rock type classifications and foliation orientation measurements obtained from drillholes. The interpretation of the analysis results was beyond the scope of this work. The assessment of the novelty and the

  5. Sampling and characterisation of groundwater colloids in ONKALO at Olkiluoto, Finland in 2007

    International Nuclear Information System (INIS)

    Takala, M.; Manninen, P.


    Colloid samples were collected from ONKALO groundwater station ONK-PVA1 in October 2007 and an additional sample was taken from groundwater station ONK-PVA3 in November 2007. The colloids were collected by filtering the groundwater on site with an Anopore 0.02 μm aluminium oxide filter. In the sampling in October, water samples were also collected to analyse the differences in the water chemistry before and after filtration. The water samples were freeze-dried so that the elements would be concentrated in the water. The colloid concentrations were determined by counting the particles from the SEM micrographs and by calculating the concentration using the micrograph area, the filter area and the filtered volume. The colloid concentration in ONK-PVA1 was very low. The particle concentration within the size range from 0.1 μm to 1 μm was 1.6 x 10 4 pt/L and the mass concentration within the same size range 0.001 μg/L. Owing to the very low concentration, an additional colloid sample was taken from ONK-PVA3. The colloid concentration in ONK-PVA3 within the size range from 0.1 μm to 1 μm was 8.2 x 10 7 pt/L and the mass concentration 0.013 mg/L. When studying the ONKALO groundwater monitoring data it was noticed that in the samples where the colloid concentration was elevated also the sodium fluorescein concentration was probably elevated. This indicated that process water (e.g. drilling water) was present in the water samples. The ONK-PVA1 water probably also contained process water during the colloid sampling performed in 2006. The composition of the colloid phase could not be determined by analysing the differences in the filtered and unfiltered water owing to the low colloid concentration. Furthermore, the aluminium oxide filter caused aluminium contamination. (orig.)

  6. Sampling and characterisation of groundwater colloids in ONKALO at Olkiluoto, Finland, 2011

    Energy Technology Data Exchange (ETDEWEB)

    Takala, M.; Ojala, S.; Jarvinen, E.; Manninen, P. [Ramboll Finland Oy, Espoo (Finland)


    The purpose of this study was to estimate the concentration of colloids and composition of the colloid phase on the basis of the water chemistry results of filtered and unfiltered water samples and to compare the results with the previous ones. The water samples were collected from groundwater stations ONK-PVA1 and ONK-PVA3 in October 2011. The colloid concentrations were determined from scanning electron microscopy (SEM) micrographs taken from the filters. The change in the water chemistry due to filtration was also analysed. The decrease of element concentrations due to filtration would possibly reflect the composition of the colloid phase. Because the concentration of the colloids is very low, two parallel water samples were analysed five times with an Inductively Coupled Plasma - Mass Spectrometry (ICP-MS) analyser so that the chemical differences between the filtered and unfiltered water could be evaluated. The colloid concentration in ONK-PVA1, determined by the single particle analysis of SEM micrographs, was 6 {mu}g/l while the colloid concentration in ONK-PVA3 was 7 {mu}g/l. The colloid phase composition could not be reliably determined due to the low colloid concentration. (orig.)

  7. Compilation and analysis of hydrogeological pressure responses to field activities in Olkiluoto during 2010-2012

    Energy Technology Data Exchange (ETDEWEB)

    Pentti, E.; Penttinen, T.; Vaittinen, T. [Poeyry Finland Oy, Vantaa (Finland)


    Groundwater flow characteristics provide essential input for the construction and safety assessment of a disposal facility for spent nuclear fuel. On the Olkiluoto site flow connections have been studied in deep drillholes by means of long-term pumping tests, various interference tests, and by interpreting the measured hydraulic heads. This report focuses on the assessment of measured hydraulic heads during 2010-2012. Hydraulic heads have been measured both in open and in packed-off drillholes since 1991. The interpretation of the hydraulic connections is based on observed changes in hydraulic head distribution caused by certain investigation activities on the site. Field activities may increase the head, e.g. drilling, or more typically decrease the head, e.g. flush pumping after drilling, difference flow logging with pumping, and both temporary and currently stable inflows into underground facilities caused by the construction of ONKALO. Processing of the head observations has been developed by determining section-specific corrections for natural fluctuation of the groundwater. The objective of the corrections is to remove natural fluctuation of the groundwater table and sea level, tidal effect, and atmospheric pressure to improve detection of changes in hydraulic head caused by field activities. Time series of observations are compared to schedules of field activities and values for responses are calculated. In addition to temporary responses, head drawdown at the end of 2012 is estimated as well as reasons for changes in it during 2010-2012. The temporary drawdowns during the studied period were mainly related to leaks from pregrouting holes in the vertical shafts that penetrate the hydrogeological system HZ20. Drawdowns that have so far remained resulted from the raise boring of the exhaust air shaft through the HZ20 system and from connections of low-transmissivity structures to leaks in the ONKALO at repository depth. According to present understanding, the

  8. The geology of the Olkiluoto area

    International Nuclear Information System (INIS)

    Anttila, P.; Paulamaeki, S.; Lindberg, A.; Paananen, M.; Koistinen, T.; Front, K.; Pitkaenen, P.


    Teollisuuden Voima Oy (TVO) is preparing for the final disposal of spent nuclear fuel from the Olkiluoto nuclear power plant deep in the Finnish bedrock. An area close to the power plant at Olkiluoto, Eurajoki, was one of the five areas selected in 1987 for the preliminary site investigations. A summary of the geological conditions at the Olkiluoto site is presented in the report

  9. GPS operations at Olkiluoto in 2009

    Energy Technology Data Exchange (ETDEWEB)

    Kallio, U.; Nyberg, S.; Koivula, H.; Jokela, J.; Poutanen, M.; Ahola, J. (Finnish Geodetic Institute, Masala (Finland))


    The GPS based deformation studies have been made at the investigation areas of Posiva since 1995, when the network of ten GPS pillars was established at Olkiluoto. One pillar in the investigation area belongs to the Finnish permanent GPS network, FinnRef. 28 GPS measurement campaigns have been carried out at Olkiluoto since 1995. According to the time series of the GPS results 1/3 of the baselines at Olkiluoto have statistically significant change rates. However, the observed movements are smaller than +-0.20 mm/a. There are five pillars, which have statistically significant horizontal velocities at Olkiluoto. These local velocity components are small but taking into account the standard deviations the largest velocity components seems to be reliably determined. At Olkiluoto a baseline for electronic distance measurements (EDM) was built in 2002. The baseline has been measured using EDM instruments in connection to the GPS observations. Changes in he difference between the GPS and EDM results indicate the systematic change in GPS results. No corrections based on only one baseline were not applied to GPS vectors. The GPS network at Olkiluoto was extended in 2003. The new pillars were built close to Kuivalahti village and on a small island of Iso Pyrekari. According to the geological evidence it is expected that a fracture zone is located between the new stations, thus enabling the determination of possible deformations along the fracture zone. The new pillars have been observed since 2003 and now we have computed the first deformation analysis from the six years data. Four new permanent stations will be established in summer 2010 at Olkiluoto. We have automated the processing of the campaign data by using the Bernese processing engine (BPE) together with our own Perl scripts. The local crustal deformations have been studied in GeoSatakunta project, too. This GPS network is located in Cities of Pori and Rauma and their neighbouring municipalities. Two new pillars

  10. GPS operations at Olkiluoto in 2009

    International Nuclear Information System (INIS)

    Kallio, U.; Nyberg, S.; Koivula, H.; Jokela, J.; Poutanen, M.; Ahola, J.


    The GPS based deformation studies have been made at the investigation areas of Posiva since 1995, when the network of ten GPS pillars was established at Olkiluoto. One pillar in the investigation area belongs to the Finnish permanent GPS network, FinnRef. 28 GPS measurement campaigns have been carried out at Olkiluoto since 1995. According to the time series of the GPS results 1/3 of the baselines at Olkiluoto have statistically significant change rates. However, the observed movements are smaller than ±0.20 mm/a. There are five pillars, which have statistically significant horizontal velocities at Olkiluoto. These local velocity components are small but taking into account the standard deviations the largest velocity components seems to be reliably determined. At Olkiluoto a baseline for electronic distance measurements (EDM) was built in 2002. The baseline has been measured using EDM instruments in connection to the GPS observations. Changes in he difference between the GPS and EDM results indicate the systematic change in GPS results. No corrections based on only one baseline were not applied to GPS vectors. The GPS network at Olkiluoto was extended in 2003. The new pillars were built close to Kuivalahti village and on a small island of Iso Pyrekari. According to the geological evidence it is expected that a fracture zone is located between the new stations, thus enabling the determination of possible deformations along the fracture zone. The new pillars have been observed since 2003 and now we have computed the first deformation analysis from the six years data. Four new permanent stations will be established in summer 2010 at Olkiluoto. We have automated the processing of the campaign data by using the Bernese processing engine (BPE) together with our own Perl scripts. The local crustal deformations have been studied in GeoSatakunta project, too. This GPS network is located in Cities of Pori and Rauma and their neighbouring municipalities. Two new pillars

  11. Olkiluoto 3 Experience

    International Nuclear Information System (INIS)

    Tiippana, Petteri


    This paper discusses the experience from the Olkiluoto 3 nuclear power plant project from regulator's point of view. There are certain factors that have affected greatly the project progress. First, Olkiluoto 3 nuclear power plant is the first European Pressurised Reactor (EPR) being constructed. Secondly, construction of the unit started after a fairly long break in nuclear power plant construction in Europe, which had resulted in loss of experienced and qualified engineering and manufacturing resources. These factors have to be kept in mind when evaluating the experience from Olkiluoto 3. Experience discussed in this paper have to do with the licensing and regulatory oversight process, completion of the design prior to construction, experience and know-how of the participating organisations, quality management in a nuclear construction project, advanced manufacturing and construction technologies, turnkey contract with regard to licensee's responsibility, safety culture aspects in a nuclear construction project, and the role and importance of regulator's oversight. (author)

  12. Modelling of salt water upconing in Olkiluoto

    International Nuclear Information System (INIS)

    Loefman, J.; Poteri, A.; Pitkaenen, P.


    Posiva Oy is preparing for the final disposal of spent nuclear fuel in the crystalline bedrock in Finland. Olkiluoto in Eurajoki has been selected as the primary site for the repository, subject to further detailed characterisation, which is currently focused on the construction of an underground rock characterisation and research facility (the ONKALO). During the repository operation the open tunnels and shafts of the ONKALO, and the subsequent repository, are likely to create a hydraulic disturbance to the site's groundwater system for hundreds of years (the greatest impact concerns only the time of the operational period, i.e., c. 100 years). In particular, during the operational phase of the repository upward flow below the tunnels may give rise to the upconing of deep highly saline groundwater up to the planned repository rock volume, which is a concern with regard to the performance of the tunnel backfill material after the closure of the tunnels. This study concerns the supporting groundwater flow analysis for the Rock Suitability Criteria (RSC) programme, which has been set up to develop host rock requirements for the repository design and layout adaptation. The objective is to assess the potential upconing of deep highly saline groundwater into the planned repository rock volume. The work is divided into three separate sub-tasks: characterization of the expected upconing on the basis of 1) observations in the drillholes, 2) numerical groundwater flow modelling, and 3) the analytic groundwater flow modelling

  13. Results of monitoring at Olkiluoto in 2009. Hydrology

    International Nuclear Information System (INIS)

    Vaittinen, T.; Ahokas, H.; Klockars, J.; Nummela, J.; Pentti, E.; Penttinen, T.; Tammisto, E.; Karvonen, T.; Lindgren, S.


    The impact of the ONKALO construction is monitored by measuring and observing numerous different parameters of hydrology, geochemistry, environment, rock mechanics and foreign materials. The Hydrological Monitoring Programme consists of the following parameters: groundwater level, hydraulic head, flow conditions in open boreholes, cross drillhole flow, hydraulic conductivity, groundwater salinity (in situ EC), precipitation (including snow), sea-water level, surface flow (runoff), infiltration, ground frost, leakages in tunnels, water balance in the tunnel system and in Korvensuo Reservoir. This Report focuses on hydrogeological parameters. Other parameters, like precipitation, ground frost etc. will be reported in the Environment Report. Mainly the monitoring has been carried out according to plan. This Report presents the results for the year 2009. A significant change in the Monitoring Programme was performed while most of the open drillholes were packed-off before excavation of the ONKALO access tunnel through the hydrogeological HZ20 zones began in Jun 2008. Prior to packing-off, open drillholes connected the main hydrogeological features, HZ19 and HZ20 systems, to each other. Due to packing-off open drillholes, number of flow logging and hydraulic testing monitoring measurements has considerably decreased. The observed changes in groundwater level in shallow observation tubes in the overburden and in shallow drillholes in the bedrock are not necessarily caused by the construction of ONKALO. However, weak indications of decrease in groundwater level have been observed. The effects on head deeper in the bedrock have been both shortterm and long-term and in 2009 these were mostly connected to drilling of grouting holes of the shafts trough the HZ20 zones. In other drillholes except packed-off sections connected to the HZ20 system, long-term changes i.e. decrease in pressure heads near ONKALO have remained on the same order of magnitude, c 1 m, as the year before

  14. Database for hydraulically conductive fractures. Update 2009

    International Nuclear Information System (INIS)

    Palmen, J.; Tammisto, E.; Ahokas, H.


    Posiva flow logging (PFL) with a 0.5 m test interval and made in 10 cm steps can be used for the determination of the depth of hydraulically conductive fractures. Together with drillhole wall images and fracture data from core logging, PFL provides possibilities to detect individual conductive fractures. In this report, the results of PFL are combined with fracture data on drillholes OL-KR41 - OL-KR48, OL-KR41B - OLKR45B and pilot holes ONK-PH8 - ONK-PH10. In addition, HTU-data measured by 2 m section length and 2 m steps in holes OL-KR39 and OL-KR40 at depths 300-700 m were analyzed and combined with fracture data in a similar way. The conductive fractures were first recognised from PFL data and digital drillhole images and then the fractures from the core logging that correspond to the ones picked from the digital drillhole images were identified. The conductive fractures were primarily recognised in the images based on the openness of fractures or a visible flow in the image. In most of the cases, no tails of flow were seen in the image. In these cases the conductive fractures were recognised in the image based on the openness of fractures and a matching depth. On the basis of the results hydraulically conductive fractures/zones could in most cases be distinguished in the drillhole wall images. An important phase in the work is the calibration of the depth of the image, flow logging and the HTU logging with the sample length. In addition to results of PFL-correlation, Hydraulic Testing Unit (HTU) data measured by 2 m section length and 2 m steps was studied at selected depths for holes OL-KR39, OL-KR40, OL-KR42 and OL-KR45. Due to low HTU section depth accuracy the conducting fractures were successfully correlated with Fracture Data Base (FDB) fractures only in drillholes OL-KR39 and OL-KR40. HTU-data depth matching in these two drillholes was performed using geophysical Single Point Resistance (SPR) data both from geophysical and PFL measurements as a depth

  15. Considering the Epistemic Uncertainties of the Variogram Model in Locating Additional Exploratory Drillholes

    Directory of Open Access Journals (Sweden)

    Saeed Soltani


    Full Text Available To enhance the certainty of the grade block model, it is necessary to increase the number of exploratory drillholes and collect more data from the deposit. The inputs of the process of locating these additional drillholes include the variogram model parameters, locations of the samples taken from the initial drillholes, and the geological block model. The uncertainties of these inputs will lead to uncertainties in the optimal locations of additional drillholes. Meanwhile, the locations of the initial data are crisp, but the variogram model parameters and the geological model have uncertainties due to the limitation of the number of initial data. In this paper, effort has been made to consider the effects of variogram uncertainties on the optimal location of additional drillholes using the fuzzy kriging and solve the locating problem with the genetic algorithm (GA optimization method.A bauxite deposit case study has shown the efficiency of the proposed model.

  16. Olkiluoto biosphere description 2006

    International Nuclear Information System (INIS)

    Haapanen, R.; Aro, L.; Ilvesniemi, H.; Kareinen, T.; Kirkkala, T.; Mykrae, S.; Turkki, H.; Lahdenperae, A.-M.; Ikonen, A.T.K.


    This report summarises the current knowledge of the biosphere of Olkiluoto, and it is the first Biosphere Description Report. The elements considered were climate, topography, land use, overburden, terrestrial vegetation and fauna and sea flora, fauna and water. The principal aim was to present a synthesis of the present state (now to 2020) and the main features of past evolution of the biosphere at the site using currently available data. The lack of site specific parameters and their importance was discussed. Conceptual ecosystem models are presented for land and sea. Currently available data made it possible to calculate the biomass of the terrestrial vegetation and further convert it to carbon. In the case of terrestrial animals, preliminary figures are given for moose alone due to lack of sitespecific data. For the same reason, the sea ecosystem model was not quantified within this work. The ecosystems on Olkiluoto do not deviate from the surrounding areas. Since mires are few on Olkiluoto, forests are the most important land ecosystem. However, coastal areas are the transition zones between land and sea, and also potential sites for deep groundwater discharge. The major interest concerning aquatic ecosystems was laid on four future lakes potentially developing from the sea due to the land up-lift. Current sea sediments near Olkiluoto are future land areas, and thus very important. Spatially, the forest ecosystems of Olkiluoto are now most comprehensively covered, while the temporal coverage is highest in sea ecosystems. Lack of data is greatest in terrestrial fauna and sea sediments. During this work, the system boundaries were crossed and the use of data over disciplines was started. The data were mostly in agreement, but some discrepancies were detected. To solve these, and to supplement the existing data, some recommendations were given. (orig.)

  17. Basic Data Report for Drillhole SNL-2 (C-2948)

    Energy Technology Data Exchange (ETDEWEB)

    Powers, Dennis W. [Washington Regulatory and Environmental Services (United States)


    SNL-2 was drilled in the northwest quarter of Section 12, T22S, R30E, in eastern Eddy County, New Mexico (Figure 2-1). It is located 574 ft from the north line (fnl) and 859 ft from the west line (fwl) of the section (Figure 2-2). This location places the drillhole east of the Livingston Ridge escarpment among oil wells of the Cabin Lake field. SNL-2 will be used to test hydraulic properties and to monitor ground water levels of the Culebra Dolomite Member of the Permian Rustler Formation. SNL-2 was permitted by the New Mexico State Engineer as C-2948. [Official correspondence regarding permitting and regulatory information must reference this permit number.] In the plan describing the integrated groundwater hydrology program (Sandia National Laboratories, 2003), SNL-2 is also codesignated WTS-1 because the location also satisfies needs for long-term monitoring of water quality and movement in the Culebra Dolomite for RCRA permitting; this program is under the management of Washington TRU Solutions LLC (WTS). In the event that additional wells are established on the SNL-2 drillpad to monitor other hydrological units (e.g., the Magenta Dolomite Member of the Permian Rustler Formation), the current drillhole will likely be referred to as SNL-2C because it is completed in the Culebra. Most drillholes at WIPP have been described after completion to provide an account of the geology, hydrology, or other basic data acquired during drilling and immediate completion of the drillhole. In addition, the basic data report provides an account of the drilling procedures and activities that may be helpful to later interpretations of data or for further work in the drillhole, including test activities and eventual plugging and abandoning activities. The basic data report also provides a convenient means of reporting information about administrative activities necessary to drill the hole.

  18. GPS operations at Olkiluoto in 2011

    International Nuclear Information System (INIS)

    Koivula, H.; Kallio, U.; Nyberg, S.; Jokela, J.; Poutanen, M.


    The Finnish Geodetic Institute has studied crustal deformations at Olkiluoto, Kivetty and Romuvaara in co-operation with Posiva Oy since 1995. At Olkiluoto a total of 32 GPS campaigns have been carried out at inner network since 1995 and 17 campaigns at outer network since 2003. Kivetty and Romuvaara were not measured in 2011. In the Olkiluoto inner network 80 percent of the estimated change rates are smaller than 0.10 mm/a. One third of the change rates are statistically significant. They are mainly related to the Olkiluoto permanent station (GPS1) and to the pillars GPS6 and GPS13. The change rates related to GPS6 are not realistic due to the site-specific changes affecting the time series. The maximum change rate (-0.20 mm/a ± 0.05 mm/a) is related to GPS13. The time series of GPS13 is half the length of other pillars and therefore, the change rates are more uncertain. In the Olkiluoto outer network the maximum and statistically significant change rate is between GPS1-GPS11 (0.39 mm/a ± 0.06 mm/a). Pillar GPS12 was not observed this year. The change rates of baselines GPS1-GPS14 and GPS1-GPS15 are first time statistically significant. The change rates indicate a small movement of the GPS1 pillar. The baseline GPS1-GPS11 crosses an old fracture zone locating in the direction of the Eurajoensalmi, which might be a reason for the deformation. On the other hand, the Onkalo excavations in the vicinity of the Olkiluoto permanent station (GPS1) may cause some movement. Electronic distance measurements have been performed at Olkiluoto at the baseline GPS7-GPS8 using the Mekometer since 2002. The measurements have been carried out simultaneously with GPS campaigns. Based on 19 measurements in 10 years, the trends of the two time series seems to be similar. Due to unmodelled or dismodelled geometrical offsets and the scale difference between GPS measurements and EDM there is about 0.3 mm difference between distances GPS7-GPS8 derived from GPS measurements and EDM. It is

  19. GPS operations at Olkiluoto in 2011

    Energy Technology Data Exchange (ETDEWEB)

    Koivula, H.; Kallio, U.; Nyberg, S.; Jokela, J.; Poutanen, M. [Finnish Geodetic Institute, Masala (Finland)


    The Finnish Geodetic Institute has studied crustal deformations at Olkiluoto, Kivetty and Romuvaara in co-operation with Posiva Oy since 1995. At Olkiluoto a total of 32 GPS campaigns have been carried out at inner network since 1995 and 17 campaigns at outer network since 2003. Kivetty and Romuvaara were not measured in 2011. In the Olkiluoto inner network 80 percent of the estimated change rates are smaller than 0.10 mm/a. One third of the change rates are statistically significant. They are mainly related to the Olkiluoto permanent station (GPS1) and to the pillars GPS6 and GPS13. The change rates related to GPS6 are not realistic due to the site-specific changes affecting the time series. The maximum change rate (-0.20 mm/a {+-} 0.05 mm/a) is related to GPS13. The time series of GPS13 is half the length of other pillars and therefore, the change rates are more uncertain. In the Olkiluoto outer network the maximum and statistically significant change rate is between GPS1-GPS11 (0.39 mm/a {+-} 0.06 mm/a). Pillar GPS12 was not observed this year. The change rates of baselines GPS1-GPS14 and GPS1-GPS15 are first time statistically significant. The change rates indicate a small movement of the GPS1 pillar. The baseline GPS1-GPS11 crosses an old fracture zone locating in the direction of the Eurajoensalmi, which might be a reason for the deformation. On the other hand, the Onkalo excavations in the vicinity of the Olkiluoto permanent station (GPS1) may cause some movement. Electronic distance measurements have been performed at Olkiluoto at the baseline GPS7-GPS8 using the Mekometer since 2002. The measurements have been carried out simultaneously with GPS campaigns. Based on 19 measurements in 10 years, the trends of the two time series seems to be similar. Due to unmodelled or dismodelled geometrical offsets and the scale difference between GPS measurements and EDM there is about 0.3 mm difference between distances GPS7-GPS8 derived from GPS measurements and EDM

  20. Olkiluoto surface and near-surface hydrological modelling in 2010

    International Nuclear Information System (INIS)

    Karvonen, T.


    The modeling approaches carried out with the Olkiluoto surface hydrological model (SHYD) include palaeohydrological evolution of the Olkiluoto Island, examination of the boundary condition at the geosphere-biosphere interface zone, simulations related to infiltration experiment, prediction of the influence of ONKALO on hydraulic head in shallow and deep bedrock and optimisation of the shallow monitoring network. A so called short-term prediction system was developed for continuous updating of the estimated drawdowns caused by ONKALO. The palaeohydrological simulations were computed for a period starting from the time when the highest hills on Olkiluoto Island rose above sea level around 2 500 years ago. The input data needed in the model were produced by the UNTAMO-toolbox. The groundwater flow evolution is primarily driven by the postglacial land uplift and the uncertainty in the land uplift model is the biggest single factor that influences the accuracy of the results. The consistency of the boundary condition at the geosphere-biosphere interface zone (GBIZ) was studied during 2010. The comparison carried out during 2010 showed that pressure head profiles computed with the SHYD model and deep groundwater flow model FEFTRA are in good agreement with each other in the uppermost 100 m of the bedrock. This implies that flux profiles computed with the two approaches are close to each other and hydraulic heads computed at level z=0 m with the SHYD can be used as head boundary condition in the deep groundwater flow model FEFTRA. The surface hydrological model was used to analyse the results of the infiltration experiment. Increase in bedrock recharge inside WCA explains around 60-63 % from the amount of water pumped from OL-KR14 and 37-40 % of the water pumped from OL-KR14 flows towards pumping section via the hydrogeological zones. Pumping from OL-KR14 has only a minor effect on heads and fluxes in zones HZ19A and HZ19C compared to responses caused by leakages into

  1. Database for Hydraulically Conductive Fractures. Update 2010

    International Nuclear Information System (INIS)

    Tammisto, E.; Palmen, J.


    Posiva flow logging (PFL) with 0.5 m test interval and made in 10 cm steps can be used for exact depth determination of hydraulically conductive fractures. Together with drillhole wall images and fracture data from core logging PFL provides possibilities to detect single conductive fractures. In this report, the results of PFL are combined to the fracture data in drillholes OL-KR49 .. OL-KR53, OL-KR50B, OL-KR52B and OLKR53B and pilot holes ONK-PH11 - ONK-PH13. The results are used mainly in development of hydroDFN- models. The conductive fractures were first recognised from the PFL data and digital drillhole images and then the fractures from the core logging corresponding to the ones picked from the digital drillhole images were identified. The conductive fractures were recognised from the images primarily based on openness of fractures or a visible flow in the image. In most of the cases of measured flow, no tails of flow were seen in the image. In these cases, the conductive fractures were recognised from the image based on openness of fractures and a matching depth. According to the results the hydraulically conductive fractures/zones can be distinguished from the drillhole wall images in most cases. An important phase in the work is to calibrate the depth of the image and the flow logging with the sample length. The hydraulic conductivity is clearly higher in the upper part of the bedrock in the depth range 0-150 m below sea level than deeper in the bedrock. The frequency of hydraulically conductive fractures detected in flow logging (T > 10 -10 -10 -9 m 2 /s) in depth range 0-150 m varies from 0.07 to 0.84 fractures/meter of sample length. Deeper in the rock the conductive fractures are less frequent, but occur often in groups of few fractures. In drillholes OL-KR49 .. OL-KR53, OL-KR50B, OL-KR52B and OL-KR53B about 8.5 % of all fractures and 4.4 % of the conductive fractures are within HZ-structures. (orig.)

  2. Geological discrete fracture network model for the Olkiluoto site, Eurajoki, Finland. Version 2.0

    International Nuclear Information System (INIS)

    Fox, A.; Forchhammer, K.; Pettersson, A.; La Pointe, P.; Lim, D-H.


    This report describes the methods, analyses, and conclusions of the modeling team in the production of the 2010 revision to the geological discrete fracture network (DFN) model for the Olkiluoto Site in Finland. The geological DFN is a statistical model for stochastically simulating rock fractures and minor faults at a scale ranging from approximately 0.05 m to approximately 565m; deformation zones are expressly excluded from the DFN model. The DFN model is presented as a series of tables summarizing probability distributions for several parameters necessary for fracture modeling: fracture orientation, fracture size, fracture intensity, and associated spatial constraints. The geological DFN is built from data collected during site characterization (SC) activities at Olkiluoto, which is selected to function as a final deep geological repository for spent fuel and nuclear waste from the Finnish nuclear power program. Data used in the DFN analyses include fracture maps from surface outcrops and trenches, geological and structural data from cored drillholes, and fracture information collected during the construction of the main tunnels and shafts at the ONKALO laboratory. Unlike the initial geological DFN, which was focused on the vicinity of the ONKALO tunnel, the 2010 revisions present a model parameterization for the entire island. Fracture domains are based on the tectonic subdivisions at the site (northern, central, and southern tectonic units) presented in the Geological Site Model (GSM), and are further subdivided along the intersection of major brittle-ductile zones. The rock volume at Olkiluoto is dominated by three distinct fracture sets: subhorizontally-dipping fractures striking north-northeast and dipping to the east that is subparallel to the mean bedrock foliation direction, a subvertically-dipping fracture set striking roughly north-south, and a subvertically-dipping fracture set striking approximately east-west. The subhorizontally-dipping fractures

  3. Geological discrete fracture network model for the Olkiluoto site, Eurajoki, Finland. Version 2.0

    Energy Technology Data Exchange (ETDEWEB)

    Fox, A.; Forchhammer, K.; Pettersson, A. [Golder Associates AB, Stockholm (Sweden); La Pointe, P.; Lim, D-H. [Golder Associates Inc. (Finland)


    This report describes the methods, analyses, and conclusions of the modeling team in the production of the 2010 revision to the geological discrete fracture network (DFN) model for the Olkiluoto Site in Finland. The geological DFN is a statistical model for stochastically simulating rock fractures and minor faults at a scale ranging from approximately 0.05 m to approximately 565m; deformation zones are expressly excluded from the DFN model. The DFN model is presented as a series of tables summarizing probability distributions for several parameters necessary for fracture modeling: fracture orientation, fracture size, fracture intensity, and associated spatial constraints. The geological DFN is built from data collected during site characterization (SC) activities at Olkiluoto, which is selected to function as a final deep geological repository for spent fuel and nuclear waste from the Finnish nuclear power program. Data used in the DFN analyses include fracture maps from surface outcrops and trenches, geological and structural data from cored drillholes, and fracture information collected during the construction of the main tunnels and shafts at the ONKALO laboratory. Unlike the initial geological DFN, which was focused on the vicinity of the ONKALO tunnel, the 2010 revisions present a model parameterization for the entire island. Fracture domains are based on the tectonic subdivisions at the site (northern, central, and southern tectonic units) presented in the Geological Site Model (GSM), and are further subdivided along the intersection of major brittle-ductile zones. The rock volume at Olkiluoto is dominated by three distinct fracture sets: subhorizontally-dipping fractures striking north-northeast and dipping to the east that is subparallel to the mean bedrock foliation direction, a subvertically-dipping fracture set striking roughly north-south, and a subvertically-dipping fracture set striking approximately east-west. The subhorizontally-dipping fractures

  4. Olkiluoto surface hydrological modelling: Update 2012 including salt transport modelling

    International Nuclear Information System (INIS)

    Karvonen, T.


    Posiva Oy is responsible for implementing a final disposal program for spent nuclear fuel of its owners Teollisuuden Voima Oyj and Fortum Power and Heat Oy. The spent nuclear fuel is planned to be disposed at a depth of about 400-450 meters in the crystalline bedrock at the Olkiluoto site. Leakages located at or close to spent fuel repository may give rise to the upconing of deep highly saline groundwater and this is a concern with regard to the performance of the tunnel backfill material after the closure of the tunnels. Therefore a salt transport sub-model was added to the Olkiluoto surface hydrological model (SHYD). The other improvements include update of the particle tracking algorithm and possibility to estimate the influence of open drillholes in a case where overpressure in inflatable packers decreases causing a hydraulic short-circuit between hydrogeological zones HZ19 and HZ20 along the drillhole. Four new hydrogeological zones HZ056, HZ146, BFZ100 and HZ039 were added to the model. In addition, zones HZ20A and HZ20B intersect with each other in the new structure model, which influences salinity upconing caused by leakages in shafts. The aim of the modelling of long-term influence of ONKALO, shafts and repository tunnels provide computational results that can be used to suggest limits for allowed leakages. The model input data included all the existing leakages into ONKALO (35-38 l/min) and shafts in the present day conditions. The influence of shafts was computed using eight different values for total shaft leakage: 5, 11, 20, 30, 40, 50, 60 and 70 l/min. The selection of the leakage criteria for shafts was influenced by the fact that upconing of saline water increases TDS-values close to the repository areas although HZ20B does not intersect any deposition tunnels. The total limit for all leakages was suggested to be 120 l/min. The limit for HZ20 zones was proposed to be 40 l/min: about 5 l/min the present day leakages to access tunnel, 25 l/min from

  5. Olkiluoto surface hydrological modelling: Update 2012 including salt transport modelling

    Energy Technology Data Exchange (ETDEWEB)

    Karvonen, T. [WaterHope, Helsinki (Finland)


    Posiva Oy is responsible for implementing a final disposal program for spent nuclear fuel of its owners Teollisuuden Voima Oyj and Fortum Power and Heat Oy. The spent nuclear fuel is planned to be disposed at a depth of about 400-450 meters in the crystalline bedrock at the Olkiluoto site. Leakages located at or close to spent fuel repository may give rise to the upconing of deep highly saline groundwater and this is a concern with regard to the performance of the tunnel backfill material after the closure of the tunnels. Therefore a salt transport sub-model was added to the Olkiluoto surface hydrological model (SHYD). The other improvements include update of the particle tracking algorithm and possibility to estimate the influence of open drillholes in a case where overpressure in inflatable packers decreases causing a hydraulic short-circuit between hydrogeological zones HZ19 and HZ20 along the drillhole. Four new hydrogeological zones HZ056, HZ146, BFZ100 and HZ039 were added to the model. In addition, zones HZ20A and HZ20B intersect with each other in the new structure model, which influences salinity upconing caused by leakages in shafts. The aim of the modelling of long-term influence of ONKALO, shafts and repository tunnels provide computational results that can be used to suggest limits for allowed leakages. The model input data included all the existing leakages into ONKALO (35-38 l/min) and shafts in the present day conditions. The influence of shafts was computed using eight different values for total shaft leakage: 5, 11, 20, 30, 40, 50, 60 and 70 l/min. The selection of the leakage criteria for shafts was influenced by the fact that upconing of saline water increases TDS-values close to the repository areas although HZ20B does not intersect any deposition tunnels. The total limit for all leakages was suggested to be 120 l/min. The limit for HZ20 zones was proposed to be 40 l/min: about 5 l/min the present day leakages to access tunnel, 25 l/min from

  6. Challenges and Solutions for the Integration of Structural and Hydrogeological Understanding of Fracture Systems - Insights from the Olkiluoto Site, Finland (United States)

    Hartley, L. J.; Aaltonen, I.; Baxter, S. J.; Cottrell, M.; Fox, A. L.; Hoek, J.; Koskinen, L.; Mattila, J.; Mosley, K.; Selroos, J. O.; Suikkanen, J.; Vanhanarkaus, O.; Williams, T. R. N.


    A field site at Olkiluoto in SW Finland has undergone extensive investigations as a location for a deep geological repository for spent nuclear fuel, which is expected to become operational in the early 2020s. Characterisation data comes from 58 deep cored drillholes, a wide variety of geophysical investigations, many outcrops, kilometres of underground mapping and testing in the ONKALO research facility, and groundwater pressure monitoring and sampling in both deep and shallow holes. A primary focus is on the properties of natural fractures and brittle fault zones in the low permeability crystalline rocks at Olkiluoto; an understanding of the flow and transport processes in these features are an essential part of assessing long-term safety of the repository. This presentation will illustrate how different types of source data and cross-disciplinary interpretations are integrated to develop conceptual and numerical models of the fracture system. A model of the brittle fault zones developed from geological and geophysical data provides the hydrostructural backbone controlling the most intense fracturing and dynamic conduits for fluids. Models of ductile deformation and lithology form a tectonic framework for the description of fracture heterogeneity in the background rock, revealing correlations between the intensity and orientation of fractures with geological and spatial properties. The sizes of brittle features are found to be best defined on two scales relating to individual fractures and zones. Inferred fracture-specific from flow logging are correlated with fracture geometric and mechanical properties along with in situ stress measurements to create a hydromechanical description of fracture hydraulic properties. The insights and understandings gained from these efforts help define a discrete fracture network (DFN) model for the Olkiluoto site, with hydrogeological characteristics consistent with monitoring data of hydraulic heads and their disturbances to

  7. Eurajoki Olkiluoto birdlife survey 2008

    International Nuclear Information System (INIS)

    Yrjoelae, R.


    The study of birds in Olkiluoto in the summer of 2008 repeated the study of the same area conducted in 1997 (Yrjoelae 1997), and was complemented with two new line transect routes and six new waterfowl counting points for the eastern region of the Olkiluoto island. Using this method the research project covered the whole area of the Olkiluoto island. By repeating the earlier routes and counting points it presented an opportunity to clarify any possible changes in the area. A wide variety of different biotypes are evident in the mixed-growth forests of the whole Olkiluoto island and after that are both spruce and pine forests. There are regionally, however, great differences in the division. In the western sector of the island, on the first three lines, the share of industrial areas and the road network are noticeable. The methods used were line transects for the bird species found on the ground and point checks for the aquatic species of birds (Koskimies and Vaeisaenen 1998), which are the established methods used for the monitoring of birdlife in Finland. In these calculations, the bird observations were 1429 altogether, covering 65 species. The results of the checkpoint census for waterfowl are presented in this study. Altogether, 23 species were interpreted in the census for waterfowl as pairs appearing to nest in the area of the checkpoints. The endangered, or other species mentioned in the EU bird directive, sighted in Olkiluoto in summer 2008 are listed in this study. The Redbacked Shrike and Common Chiffchaff were clearly the most common among these species. The birdlife in Olkiluoto is both rather varied and abundant. A few clear tendencies can be distinguished in the changes within the species of birds. Amongst the waterfowl and gulls, the species favouring flourishing watercourses have increased. The species in the outer archipelago, such as the Common Eider and Velvet Scoter have declined compared to 1997. Probably the waders of the archipelago will

  8. Sampling and characterisation of groundwater colloids in ONKALO at Olkiluoto, Finland 2009-2010

    International Nuclear Information System (INIS)

    Jaervinen, E.; Manninen, P.; Takala, M.; Vilhunen, S.


    The purpose of this study was to estimate the concentration of colloids and composition of the colloid phase on the basis of the water chemistry results of filtered and unfiltered water samples and to compare the results with the previous ones. The water samples were collected from groundwater stations ONK-PVA1 in December 2009 and ONKPVA5 in June 2010. The colloid concentrations were determined from scanning electron microscopy (SEM) micrographs taken from the filters. The change in the water chemistry due to filtration was also analysed. The decrease of element concentrations due to filtration would possibly reflect the composition of the colloid phase. Because the concentration of the colloids is very low, three parallel water samples were analysed three times with an Inductively Coupled Plasma - Mass Spectrometry (ICP-MS) analyser so that the chemical differences between the filtered and unfiltered water could be evaluated. The colloid concentration in ONK-PVA1, determined by the single particle analysis of SEM micrographs, was 0.5 μg/l while the colloid concentration in ONK-PVA5 was 0.15 μg/l. The colloid phase composition could not be reliably determined due to the low colloid concentration. (orig.)

  9. Results of monitoring at Olkiluoto in 2010. Hydrology

    Energy Technology Data Exchange (ETDEWEB)

    Vaittinen, T.; Ahokas, H.; Klockars, J.; Nummela, J.; Pentti, E.; Penttinen, T.; Poellaenen, J. [Poeyry Finland Oy, Espoo (Finland); Karvonen, T. [WaterHope, Helsinki (Finland); Lindgren, S.


    The impact of the construction of ONKALO is monitored by measuring and observing numerous different parameters related to hydrology, geochemistry, environment, rock mechanics and foreign materials. The Hydrological Monitoring Programme consists of the following parameters: groundwater level, hydraulic head, flow conditions in open boreholes, cross drillhole flow, hydraulic conductivity, groundwater salinity (in situ EC), precipitation (including snow), sea-water level, surface flow (runoff), infiltration, ground frost, leakages in tunnels, and water balance in the tunnel system and in Korvensuo Reservoir. This Report focuses on hydrogeological parameters. Other parameters, like precipitation, ground frost etc. will be reported in the Monitoring Report of Environment. Monitoring has primarily been carried out according to plan. This Report presents the results for the year 2010. A significant change took place in the Monitoring Programme when most of the open drillholes were packed-off before the excavation of the ONKALO access tunnel through the hydrogeological HZ20 zones began in June 2008. Prior to packing-off, open drillholes connected the main hydrogeological features, the HZ19 and HZ20 systems, to each other. Due to the packing-off of open drillholes, the number of flow logging and hydraulic testing (HTU) measurements has decreased considerably. The mapping of water leakages and moisture conditions in tunnel walls and roof has been continued. Some changes have been observed in the pattern of moisture content. The changes have probably been caused by shotcreting, postgrouting and possibly also by seasonal effects. The changes have so far not been analysed. The changes observed in the groundwater level in shallow observation tubes in the overburden and in shallow drillholes in the bedrock are not necessarily caused by the construction of ONKALO. However, weak indications of a decrease in groundwater level have been observed. Effects on the head deeper in the

  10. Results of monitoring at Olkiluoto in 2007. Hydrology

    International Nuclear Information System (INIS)

    Vaittinen, T.; Ahokas, H.; Klockars, J.; Nummela, J.; Penttinen, T.; Tammisto, E.; Karvonen, T.


    The impact of the construction of ONKALO is monitored by measuring and observing numerous different parameters related to hydrology, geochemistry, environment, rock mechanics and foreign materials. The hydrological monitoring programme consists of the following parameters: groundwater level, hydraulic head, flow conditions in open boreholes, cross drillhole flow, hydraulic conductivity, groundwater salinity (in situ EC), precipitation (including snow), sea-water level, surface flow (runoff), infiltration, ground frost, leakages in tunnels, water balance in the tunnel system and in the Korvensuo reservoir. This report focuses on the hydrogeological parameters. Other parameters like precipitation, ground frost etc. will be reported in the environment report. Monitoring has in the main parts been carried out according to plan. The previous monitoring report contained results until the end of 2006, and this report presents results for the year 2007. Cross drillhole measurements were started as new measurements by test measurements. Monitoring measurements will start in 2008. In addition, the water balance of the Korvensuo Reservoir was introduced for the first time. According to the observations made in shallow observation tubes in the overburden and in shallow drillholes in the bedrock, the construction of ONKALO has not caused any certain changes in groundwater level. However, weak indications of a decrease in groundwater level have been observed. The effects on the head deeper in the bedrock have been both short-term and long-term. Short-term changes have been caused by several different investigation activities carried out in the field and by ONKALO as well by as temporary leakages due to the e.g. grouting holes drilled in ONKALO. The order of magnitude of long-term changes, i.e. a decrease in pressure heads near ONKALO, has remained the same as the previous year and the changes are in the order of 1 m. The changes observed in flow conditions in open drillholes

  11. ONKALO POSE experiment. Phase 3: execution and monitoring

    International Nuclear Information System (INIS)

    Valli, J.; Hakala, M.; Wanne, T.; Kantia, P.; Siren, T.


    In-depth knowledge of the in situ stress state at the Olkiluoto site is critical for stability assessment both prior to and after deposition of spent nuclear fuel in order to understand and avoid potential damage to the rock at the site. Posiva's Olkiluoto Spalling Experiment (POSE) was designed specifically for this purpose with three primary goals: establish the in situ spalling/damage strength of Olkiluoto migmatitic gneiss, establish the state of in situ stress at the -345 m depth level and act as a Prediction-Outcome (P-O) exercise. Phases 1 and 2 of POSE are outlined in WR 2012-60. The objectives of the third phase of the POSE experiment are the same as the original objectives outlined above. This report outlines the execution and results of the third phase of the POSE experiment. The third phase of the experiment involved internally heating the third experimental hole (ONK-EH3) of the POSE niche in order to cause a symmetrical thermal stress increase around the hole due to the thermal expansion of rock. This thermomechanically induced stress increase, coupled with the estimated existing in situ stress state, should cause the maximum principal stress around the hole to exceed the predicted spalling strength of the rock around the hole. ONK-EH3 is located almost completely in pegmatitic granite. Four fractures near the top of the hole were mapped after boring ONK-EH3, and a tensile failure located at the contact between mica-rich gneiss and pegmatitic granite was observed 18 months after boring, prior to the experiment. Based on predictive calculations and the estimated in situ state of stress, the maximum principal stress magnitude should reach ca. 100 MPa when the temperature was just below 100 deg C after 12 weeks of heating. There were problems with the heater control unit at the beginning of the experiment, after which heating proceeded according to plan. The crack damage threshold of pegmatitic granite has been determined to be 85 ±17 MPa at Olkiluoto

  12. GPS operations at Olkiluoto, Kivetty and Romuvaara in 2010

    International Nuclear Information System (INIS)

    Kallio, U.; Nyberg, S.; Koivula, H.; Jokela, J.; Poutanen, M.


    The Finnish Geodetic Institute (FGI) has studied crustal deformations in co-operation with the Posiva Oy since 1994, when a network of ten pillars for GPS observations was established at Olkiluoto. In 2010 the local GPS network at Olkiluoto consisted of 14 concrete pillars. The whole network has been measured twice a year in the static GPS campaigns with 24 h sessions. The four new pillars were established in 2010 and the permanent measurements on them will start in 2011. The network of seven GPS pillars was built at Kivetty and Romuvaara during the year 1996. One pillar in each investigation area belongs to the Finnish permanent GPS network, FinnRef. A total of 28 GPS measurement campaigns have been carried out at Olkiluoto since 1995, and 18 campaigns at Kivetty and Romuvaara. At Olkiluoto a baseline for electronic distance measurements (EDM) was built in 2002. The baseline has been measured in connection to the GPS observations using the EDM instrument Kern ME5000 Mekometer. The GPS operations in 2010 included the two GPS campaigns at Olkiluoto, GPS campaigns at Kivetty and Romuvaara, EDM baseline measurements at Olkiluoto, and the control marker measurements with the tachymeter at Olkiluoto. All GPS data history was reprocessed with Bernese GPS software using the new processing strategy tested in 2009. The results were analysed by computing the change rates of the baselines and estimating horizontal velocities for the pillars using the barycenter of the velocities as a reference. In the Olkiluoto inner network 80 percent of the change rates were smaller than 0.10 mm/a. Roughly one fourth of the change rates could be considered as statistically significant (change rate larger than 3 σ. The statistically significant change rates were mainly related to the Olkiluoto permanent station (GPS1) and to the pillar GPS5, which had also the maximum change rate (0.21 ± 0.03 mm/a). In Olkiluoto outer network the maximum and statistically significant change rates are

  13. GPS operations at Olkiluoto, Kivetty and Romuvaara in 2010

    Energy Technology Data Exchange (ETDEWEB)

    Kallio, U.; Nyberg, S.; Koivula, H.; Jokela, J.; Poutanen, M. [Finnish Geodetic Institute, Masala (Finland)


    The Finnish Geodetic Institute (FGI) has studied crustal deformations in co-operation with the Posiva Oy since 1994, when a network of ten pillars for GPS observations was established at Olkiluoto. In 2010 the local GPS network at Olkiluoto consisted of 14 concrete pillars. The whole network has been measured twice a year in the static GPS campaigns with 24 h sessions. The four new pillars were established in 2010 and the permanent measurements on them will start in 2011. The network of seven GPS pillars was built at Kivetty and Romuvaara during the year 1996. One pillar in each investigation area belongs to the Finnish permanent GPS network, FinnRef. A total of 28 GPS measurement campaigns have been carried out at Olkiluoto since 1995, and 18 campaigns at Kivetty and Romuvaara. At Olkiluoto a baseline for electronic distance measurements (EDM) was built in 2002. The baseline has been measured in connection to the GPS observations using the EDM instrument Kern ME5000 Mekometer. The GPS operations in 2010 included the two GPS campaigns at Olkiluoto, GPS campaigns at Kivetty and Romuvaara, EDM baseline measurements at Olkiluoto, and the control marker measurements with the tachymeter at Olkiluoto. All GPS data history was reprocessed with Bernese GPS software using the new processing strategy tested in 2009. The results were analysed by computing the change rates of the baselines and estimating horizontal velocities for the pillars using the barycenter of the velocities as a reference. In the Olkiluoto inner network 80 percent of the change rates were smaller than 0.10 mm/a. Roughly one fourth of the change rates could be considered as statistically significant (change rate larger than 3 {sigma}. The statistically significant change rates were mainly related to the Olkiluoto permanent station (GPS1) and to the pillar GPS5, which had also the maximum change rate (0.21 {+-} 0.03 mm/a). In Olkiluoto outer network the maximum and statistically significant change rates

  14. The Olkiluoto 3 project

    International Nuclear Information System (INIS)

    Knoche, Ph.


    This series of slides presents the Olkiluoto 3 project involving the EPR (European Pressurized water Reactor). This EPR is the first reactor of third generation to have be put into construction. The contract was signed between the Areva-Siemens consortium and the Tvo Finn company in december 2003. The construction of the first-off reactor is always a big challenge but also opens the way for its industrial development as it brings knowledge and experience: Olkiluoto is the first international licensing of the EPR, a valuable feedback experience has been acquired on both the fabrication of the primary components and the qualification of the suppliers. A point on the state of the construction works is made at the first term 2009. (A.C.)

  15. GPS Operations at Olkiluoto, Kivetty and Romuvaara in 2005

    International Nuclear Information System (INIS)

    Ahola, J.; Ollikainen, M.; Koivula, H.; Jokela, J.


    The GPS based deformation studies has been made at the investigation areas of Posiva since 1995, when the network of ten GPS pillars was established at Olkiluoto. The network of seven GPS pillars was built at Kivetty and Romuvaara during the year 1996. One pillar in each investigation area belongs to the Finnish permanent GPS network, FinnRef. Twenty GPS measurement campaigns have been carried out at Olkiluoto since 1995, and fourteen campaigns at Kivetty and Romuvaara. According to the time series of the GPS results 1/3 of the baselines at Olkiluoto have statistically significant change rates. However, the observed movements are smaller than ± 0.22 mm/a. There are no statistically signicant movements at Kivetty and Romuvaara expect one pillar at Romuvaara. There are five pillars, which have statistically significant horizontal velocities at Olkiluoto. The local velocity components are small but taking into account the standard deviations the largest velocity components seems to be reliable (maximum velocity is - 0.25 mm/a ± 0.025 mm/a). The uniform scale for the GPS measurements made in different years is the basic condition for reliable results in the deformation analyses. At Olkiluoto a baseline for electronic distance measurements (EDM) was built in 2002. The baseline has been measured using EDM instruments simultaneously with the GPS observations. The comparison between the GPS and EDM results to show a possible scale error of the GPS. The GPS network at Olkiluoto was enlarged in 2003. The new pillars were built close to Kuivalahti village and on a small island of Iso Pyrekari, both north from Olkiluoto. According to the geological evidence it is expected that a fracture zone is located between the new stations, thus enabling the determination of possible deformations along the fracture zone. The new pillars have been observed five times since 2003, but the time series are still too short for reliable deformation studies. Including the new pillars the local

  16. Drilling and the associated borehole measurements of the pilot hole ONK-PH3

    International Nuclear Information System (INIS)

    Oehberg, A.; Heikkinen, E.; Hirvonen, H.; Kemppainen, K.; Majapuro, J.; Niemonen, J.; Poellaenen, J.; Rouhiainen, P.


    The construction of the ONKALO access tunnel started in September 2004 at Olkiluoto. Most of the investigations related to the construction of the access tunnel aim to ensure successful excavations, reinforcement and sealing. Pilot holes are boreholes, which are core drilled along the tunnel profile. The length of the pilot holes typically varies from several tens of metres to a couple of hundred metres. The pilot holes will mostly aim to confirm the quality of the rock mass for tunnel construction, and in particular at identifying water conductive fractured zones and at providing information that could result in modifications of the existing construction plans. The pilot hole ONK-PH3 was drilled in September 2005. The length of the borehole is 145.04 metres. The aim during the drilling work was to orientate core samples as much as possible. The deviation of the borehole was measured during and after the drilling phase. Electric conductivity was measured from the collected returning water samples. Logging of the core samples included the following parameters: lithology, foliation, fracturing, fracture frequency, RQD, fractured zones, core loss and weathering. The rock mechanical logging was based on Q-classification. The tests to determine rock strength and deformation properties were made with a Rock Tester-equipment. Difference Flow method was used for the determination of hydraulic conductivity in fractures and fractured zones in the borehole. The overlapping i.e. the detailed flow logging mode was used. The flow logging was performed with 0.5 m section length and with 0.1 m depth increments. Water loss tests (Lugeon tests) and a pressure build-up test were used to give background information for the grouting design. Geophysical borehole logging and optical imaging surveys of the pilot hole PH3 included the field work of all the surveys, the integration of the data as well as interpretation of the acoustic and borehole radar data. One of the objectives of the

  17. Results of monitoring at Olkiluoto in 2008. Hydrology

    International Nuclear Information System (INIS)

    Vaittinen, T.; Ahokas, H.; Klockars, J.; Nummela, J.; Penttinen, T.; Tammisto, E.; Karvonen, T.


    The impact of the ONKALO construction is monitored by measuring and observing numerous different parameters of hydrology, geochemistry, environment, rock mechanics and foreign materials. The Hydrological Monitoring Programme consists of the following parameters: groundwater level, hydraulic head, flow conditions in open boreholes, cross drillhole flow, hydraulic conductivity, groundwater salinity (in situ EC), precipitation (including snow), sea-water level, surface flow (runoff), infiltration, ground frost, leakages in tunnels, water balance in the tunnel system and in Korvensuo Reservoir. This Report focuses on hydrogeological parameters. Other parameters, like precipitation, ground frost etc. will be reported in the Environment Report. Mainly the monitoring has been carried out according to plan. The previous Monitoring Report contained the results until the end of 2007, and this Report presents the results for the year 2008. A significant change in the Monitoring Programme was performed while most of the open drillholes were packed-off before excavation of the ONKALO access tunnel through the hydrogeological HZ20 zones began in Jun 2008. Prior to packing-off, open drillholes connected the main hydrogeological features, HZ19 and HZ20 systems, to each other. Due to packing-off open drillholes, number of flow logging and hydraulic testing monitoring measurements has considerably decreased. According to the observations carried out in shallow observation tubes in the overburden and in shallow drillholes in the bedrock, the construction of ONKALO has not caused any certain changes in groundwater level. However, weak indications of decrease in groundwater level have been observed. The effects on head deeper in the bedrock have been both short-term and long-term and in 2008 these were mostly connected to excavation of the tunnel trough the HZ20 zones. In most cases, short-term changes have been caused by temporary leakages due to the probe holes and grouting holes

  18. GPS operations at Olkiluoto, Kivetty and Romuvaara in 2008

    International Nuclear Information System (INIS)

    Kallio, U.; Ahola, J.; Koivula, H.; Jokela, J.; Poutanen, M.


    The GPS based deformation studies have been made at the investigation areas of Posiva since 1995, when the network of ten GPS pillars was established at Olkiluoto. The network of seven GPS pillars was built at Kivetty and Romuvaara during the year 1996. One pillar in each investigation area belongs to the Finnish permanent GPS network, FinnRef. A total of 26 GPS measurement campaigns have been carried out at Olkiluoto since 1995, and 17 campaigns at Kivetty and Romuvaara. According to the time series of the GPS results 1/3 of the baselines at Olkiluoto have statistically significant change rates. However, the observed movements are smaller than 0.20 mm/a. The networks of Kivetty and Romuvaara are quite stable expect one pillar at Romuvaara. There are seven pillars, which have statistically significant horizontal velocities at Olkiluoto. These local velocity components are small but taking into account the standard deviations the largest velocity components seems to be reliably determined. The uniform scale for the GPS measurements made in different years is the basic condition for reliable results in the deformation analyses. At Olkiluoto a baseline for electronic distance measurements (EDM) was built in 2002. The baseline has been measured using EDM instruments in connection to the GPS observations. The comparison between the GPS and EDM results can help to fix a possible scale error of the GPS measurements. The GPS network at Olkiluoto was extended in 2003. The new pillars were built close to Kuivalahti village and on a small island of Iso Pyrekari. According to the geological evidence it is expected that a fracture zone is located between the new stations, thus enabling the determination of possible deformations along the fracture zone. The new pillars have been observed since 2003 and now we have computed the first deformation analysis from the six years data. The local crustal deformations have been studied in GeoSatakunta project, too. This GPS network is

  19. GPS operations at Olkiluoto, Kivetty and Romuvaara in 2006

    International Nuclear Information System (INIS)

    Ahola, J.; Koivula, H.; Poutanen, M.; Jokela, J.


    The GPS based deformation studies have been made at the investigation areas of Posiva since 1995, when the network of ten GPS pillars was established at Olkiluoto. The network of seven GPS pillars was built at Kivetty and Romuvaara during the year 1996. One pillar in each investigation area belongs to the Finnish permanent GPS network, FinnRef. 22 GPS measurement campaigns have been carried out at Olkiluoto since 1995, and 15 campaigns at Kivetty and Romuvaara. According to the time series of the GPS results 1/3 of the baselines at Olkiluoto have statistically significant change rates. However, the observed movements are smaller than ± 0.22 mm/a. The networks of Kivetty and Romuvaara are quite stabile expect one pillar at Romuvaara. There are five pillars, which have statistically significant horizontal velocities at Olkiluoto. These local velocity components are small but taking into account the standard deviations the largest velocity components seems to be reliably determined (maximum velocity is -0.23 mm/a ± 0.023 mm/a). The uniform scale for the GPS measurements made in different years is the basic condition for reliable results in the deformation analyses. At Olkiluoto a baseline for electronic distance measurements (EDM) was built in 2002. The baseline has been measured using EDM instruments simultaneously with the GPS observations. The comparison between the GPS and EDM results can solve a possible scale error of the GPS. The GPS network at Olkiluoto was extended in 2003. The new pillars were built close to Kuivalahti village and on a small island of Iso Pyrekari. According to the geological evidence it is expected that a fracture zone is located between the new stations, thus enabling the determination of possible deformations along the fracture zone. The new pillars have been observed since 2003, but the time series are still too short for reliable deformation studies. The local crustal deformations have been studied in GeoSatakunta project, too. This

  20. GPS operations at Olkiluoto, Kivetty and Romuvaara in 2007

    International Nuclear Information System (INIS)

    Ahola, J.; Koivula, H.; Jokela, J.


    The GPS based deformation studies have been made at the investigation areas of Posiva since 1995, when the network of ten GPS pillars was established at Olkiluoto. The network of seven GPS pillars was built at Kivetty and Romuvaara during the year 1996. One pillar in each investigation area belongs to the Finnish permanent GPS network, FinnRef. 24 GPS measurement campaigns have been carried out at Olkiluoto since 1995, and 16 campaigns at Kivetty and Romuvaara. According to the time series of the GPS results 1/3 of the baselines at Olkiluoto have statistically significant change rates. However, the observed movements are smaller than ± 0.20 mm/a. The networks of Kivetty and Romuvaara are quite stabile expect one pillar at Romuvaara. There are five pillars, which have statistically significant horizontal velocities at Olkiluoto. These local velocity components are small but taking into account the standard deviations the largest velocity components seems to be reliably determined (maximum velocity is -0.22 mm/a ± 0.02 mm/a). The uniform scale for the GPS measurements made in different years is the basic condition for reliable results in the deformation analyses. At Olkiluoto a baseline for electronic distance measurements (EDM) was built in 2002. The baseline has been measured using EDM instruments simultaneously with the GPS observations. The comparison between the GPS and EDM results can solve a possible scale error of the GPS. The GPS network at Olkiluoto was extended in 2003. The new pillars were built close to Kuivalahti village and on a small island of Iso Pyrekari. According to the geological evidence it is expected that a fracture zone is located between the new stations, thus enabling the determination of possible deformations along the fracture zone. The new pillars have been observed since 2003, but the time series are still too short for reliable deformation studies. The local crustal deformations have been studied in GeoSatakunta project, too. This

  1. Groundwater flow modelling at the Olkiluoto site, Finland

    International Nuclear Information System (INIS)

    Loefman, J.


    Preliminary site investigations for spent fuel disposal has been carried out at the Olkiluoto site, Finland. During the investigations high salt concentrations were measured in the groundwater samples deep in the bedrock. In this study, the groundwater flow is analyzed at Olkiluoto taking into account the effects of salinity. The transient simulations are performed by solving coupled and non-linear partial differential equations describing the flow and solute transport. A site-specific simulation model for flow and transport is developed on the basis of the field investigations. The simulations are carried out for a period that started when the highest hills at Olkiluoto rose above sea level. The simulation period continues until the present day. The results of the coupled simulations were strongly dependent on the poorly known initial salinity distribution in the solution domain. The DP approximation together with the EC approximation proved to be a useful complementary approach when simulating solute transport in a fractured rock mass. The simulations also confirm the assumption that the realistic simulation of groundwater flow at Olkiluoto requires taking into account the effects of salinity

  2. Environment studies in the Olkiluoto area

    International Nuclear Information System (INIS)

    Ikonen, A.T.K.; Kaapu, J.; Lehtonen, K.; Mattila, J.; Raeisaenen, R.; Turkki, H.; Sauvonsaari, J.


    In the report, different aspects of environmental status of the Olkiluoto area, an island with the near-sea in the Finnish coast of the Baltic Sea, are described by five topical papers. Regarding animal-life, Olkiluoto represents a typical seashore area of southwestern Finland dominated by rocky hills and commercial forests. In the literature and interview study of local hunters, locally dominant mammal and bird species are identified. No threatened or endangered mammals species were found on the island, and only few bird species in Olkiluoto have a high conservation value. The sea area off Olkiluoto is rather shallow and the water mixing conditions are favourable. The quality and biological production of the water are affected by the general state of the Bothian Sea, the loading brought by the Eurajoki and Lapinjoki Rivers and local wastewaters. Also the cooling waters from the local nuclear power plant impact the sea environment. The bottom vegetation varies from an algae-dominant to a vascular-plantdominant community. Amount of benthic fauna and its species composition has varied considerably, due to both variations of the quality of the bottom and eutrophication. The Eurajoki River represents the second largest river system in southwestern Finland. At its upper reaches, the river is classified as clean and suitable for recreational use. Intermittently, additional waters rich in nutrients flow into the river from ditches and tributaries. Diffuse pollution and the wastewaters of riverside municipalities and industry affect on the water of the lower course, where it is only mildly contaminated, hygienically fairly good and satisfactory for recreational use. The benthic fauna of the river is composed of oligochaetes, clams, leeches and larvae. The fish reserve is versatile in places due to stocking. The Eurajoensalmi Strait, the inlet of the river, is a transitional zone between the river and further sea environments. In the offshore area facing Olkiluoto, there

  3. Rock mass seismic imaging around the ONKALO tunnel, Olkiluoto 2007

    International Nuclear Information System (INIS)

    Cosma, C.; Cozma, M.; Balu, L.; Enescu, N.


    Posiva Oy prepares for disposal of spent nuclear fuel in bedrock focusing in Olkiluoto, Eurajoki. This is in accordance of the application filed in 1999, the Decision-in-Principle of the State Council in 2000, and ratification by the Parliament in 2001. Vibrometric Oy has performed a tunnel seismic survey in ONKALO access tunnel on a 100 m line in December 2007. Tunnel length (chainage) was 1720 - 1820 m (vertical depth 170 - 180 m). Measurement applied 120 source positions at 1 m spacing, and on the both ends at 4 m spacing. Electromechanical Vibsist-20 tool was used as the source. Hammer produced 15.36 s sweeps. Signal was recorded with 2-component geophone assemblies, installed in 400 mm long, 45 mm drillholes in the tunnel wall. Sweeps were recorded with Summit II seismograph and decoded to seismic traces. Also percussion drill rig, which is used in drilling the blasting holes in tunnel excavation, was tested from a 100-m distance as a seismic source. Signal is equally good as from actual seismic source, and may be applied later on for production. Obtained seismic results were processed with tomographic reconstruction of the first arrivals to P and S wave refraction tomograms, and to tomograms of Young's modulus and Shear Modulus. The obtained values correspond the typical levels known from Olkiluoto. There are indications of lower velocity near tunnel wall, but resolution is not adequate for further interpretation. Some variation of velocity is detected in the rock mass. Seismic data was also processed with normal reflection profile interpretation and migrated. As a result there was obtained reflection images to a 100-m distance from the tunnel. Several reflecting events were observed in the rock mass. Features making an angle of 30 deg or more with tunnel axis can be imaged from distances of tens of metres. Vertical fractures perpendicular to tunnel can be imaged only near the tunnel. Gently dipping features can be imaged below and above. Images are 2D, i

  4. Results of Monitoring at Olkiluoto in 2007. Rock Mechanics

    International Nuclear Information System (INIS)

    Mattila, J.; Hakala, M.


    Posiva Oy has operated a local microseismic at Olkiluoto network since February 2002. During the monitoring in 2007, altogether 2207 events have been located in the Olkiluoto area, in the reported time period. The magnitudes of the observed events range from ML = -2.1 to 1.5 (ML = magnitude in local Richter's scale). All these events are explosions. Evidence of seismic activity that would have influence on the safety of the ONKALO, have not been observed. One recorded event was a microearthquake of magnitude ML 1.9, which occurred in Laitila, approximately 40 km from Olkiluoto. The GPS based deformation studies have been made at the investigation areas of Posiva since 1995, when the network of ten GPS pillars was established at Olkiluoto. Since then, altogether 24 GPS measurement campaigns have been carried out at Olkiluoto. According to the time series of the GPS results, 1/3 of the baselines at Olkiluoto have statistically significant change rates. However, the observed movements are smaller than ± 0.20 mm/a. There are five pillars, which have statistically significant horizontal velocities at Olkiluoto. These local velocity components are small but taking into account the standard deviations the largest velocity components seems to be reliably determined (maximum velocity is -0.21 mm/a ± 0.02 mm/a) In order to monitor vertical movements at Olkiluoto, precise leveling campaigns of the GPS stations were started in the area in autumn 2003. Since then, leveling campaigns have taken place in 2005 and 2007, including the leveling of the existing GPS network and line from Olkiluoto Island to Lapijoki at the main land. Additional smaller leveling campaigns took place in 2006. The campaign in autumn 2007 consisted of the levellings of all measured and undestroyed points of the earlier campaigns. Compared to the mean theoretical land uplift, the nodal bench mark near the crossing of Olkiluodontie and Satamatie had risen in four years 2.6 mm more than the nodal bench

  5. Future vegetation types and related main processes for Olkiluoto site

    International Nuclear Information System (INIS)

    Haapanen, R.


    This working report summarizes current knowledge of the land up-lift induced vegetation succession and future vegetation types on Olkiluoto Island and its surroundings. The report is based on generic literature and site-specific studies concerning Olkiluoto Island. Current vegetation on Olkiluoto Island and typical succession lines on different soil types are described, as well as main factors affecting the succession. Most relevant materials on hand are listed. Some problems and possible areas to be emphasized before using the data in modelling work are pointed out. (orig.)

  6. Results of monitoring at Olkiluoto in 2009. Rock mechanics

    International Nuclear Information System (INIS)

    Lahti, M.; Hakala, M.


    The rock mechanical monitoring at Olkiluoto concentrates on the assessment of potential tectonic movements and stability of the bedrock. The construction of ONKALO is not expected to induce large-scale movements of the rock blocks or affect the rate of isostatic uplift but the evaluation of any tectonic events is important for the safety assessment. The monitoring consists of seismic measurements, GPS measurements and precise levelling campaigns at Olkiluoto and vicinity and additionally extensometer and convergence measurements carried out in ONKALO. Posiva established a local seismic network of six stations on the island of Olkiluoto in 2002. The number of seismic stations has increased gradually being in 2009 altogether 14. The purpose of the microearthquake measurements at Olkiluoto is to improve understanding of the structure, behaviour and long term stability of the bedrock. The investigation area includes two target areas. The larger target area, called seismic semi-regional area, covers the Olkiluoto Island and its surroundings. The purpose is to monitor explosions and tectonic earthquakes in regional scale. The smaller target area is s called the seismic ONKALO block, which is a 2 km *2 km *2 km cube surrounding the ONKALO. All the expected excavation induced events assumingly occur within this volume. At the moment the seismic ONKALO block includes 10 seismic stations. An additional task of monitoring is related to safeguarding of the ONKALO. The seismic network has operated continuously in 2009 and during the year altogether 1256 events have been located in the Olkiluoto area. Most of them (1161) are explosions that occurred inside the seismic semi-regional area and especially inside the seismic ONKALO block (1135 events)

  7. Basic Data Report for Drillhole SNL-2 (C-2948) (Waste Isolation Pilot Plant)

    International Nuclear Information System (INIS)

    Powers, Dennis W.


    SNL-2 was drilled in the northwest quarter of Section 12, T22S, R30E, in eastern Eddy County, New Mexico (Figure 2-1). It is located 574 ft from the north line (fnl) and 859 ft from the west line (fwl) of the section (Figure 2-2). This location places the drillhole east of the Livingston Ridge escarpment among oil wells of the Cabin Lake field. SNL-2 will be used to test hydraulic properties and to monitor ground water levels of the Culebra Dolomite Member of the Permian Rustler Formation. SNL-2 was permitted by the New Mexico State Engineer as C-2948. [Official correspondence regarding permitting and regulatory information must reference this permit number.] In the plan describing the integrated groundwater hydrology program (Sandia National Laboratories, 2003), SNL-2 is also codesignated WTS-1 because the location also satisfies needs for long-term monitoring of water quality and movement in the Culebra Dolomite for RCRA permitting; this program is under the management of Washington TRU Solutions LLC (WTS). In the event that additional wells are established on the SNL-2 drillpad to monitor other hydrological units (e.g., the Magenta Dolomite Member of the Permian Rustler Formation), the current drillhole will likely be referred to as SNL-2C because it is completed in the Culebra. Most drillholes at WIPP have been described after completion to provide an account of the geology, hydrology, or other basic data acquired during drilling and immediate completion of the drillhole. In addition, the basic data report provides an account of the drilling procedures and activities that may be helpful to later interpretations of data or for further work in the drillhole, including test activities and eventual plugging and abandoning activities. The basic data report also provides a convenient means of reporting information about administrative activities necessary to drill the hole.

  8. Baseline conditions at Olkiluoto

    International Nuclear Information System (INIS)


    The main purpose of this report is to establish a reference point - defined as the data collected up until the end of year 2002 - for the coming phases of the Finnish spent nuclear fuel disposal programme. The focus is: to define the current surface and underground conditions at the site, both as regards the properties for which a change is expected and for the properties which are of particular interest for long-term safety or environmental impact; to establish, as far as possible, the natural fluctuation of properties that are potentially affected by construction of the underground laboratory, the ONKALO, and to provide references to data on parameters or use in model development and testing and to use models to assist in understanding and interpreting the data. The emphasis of the baseline description is on bedrock characteristics that are relevant to the long-term safety of a spent fuel repository and, hence, to include the hydrogeological, hydrogeochemical, rock mechanical, tectonic and seismic conditions of the site. The construction of the ONKALO will also affect some conditions on the surface, and, therefore, a description of the main characteristics of the nature and the man-made constructions at Olkiluoto is also given. This report is primarily a road map to the available information on the prevailing conditions at the Olkiluoto site and a framework for understanding of data collected. Hence, it refers to numerous available background reports and other archived information produced over the past 20 years or more, and forms a recapitulation and revaluation of the characterisation data of the Olkiluoto site. (orig.)

  9. Game statistics for the island of Olkiluoto in 2005-2006

    International Nuclear Information System (INIS)

    Oja, S.


    The game statistics for the island of Olkiluoto was updated in February 2006. The estimate of game populations in Olkiluoto was done on the basis of interviews of local hunters and available statistical materials. The collected data were compared to earlier studies of game animals done in Olkiluoto. The populations of Elk and White-tailed Deer are stable, and the population of Roe Deer is increasing significantly. The populations of small mammal predators (American Mink, Raccoon Dog, Red Fox) are very high level, despite of intensive hunting. Other game animals like waterfowls are hunted moderately and the amount of catches are small. (orig.)

  10. Evolution of the Olkiluoto site. Palaeohydrogeochemical considerations

    International Nuclear Information System (INIS)

    Smellie, J.; Pitkaenen, P.; Koskinen, L.


    Over the past 20 years a considerable amount of work has been carried out to establish a palaeohydrogeological understanding of the Olkiluoto site and surrounding area, and to integrate this knowledge into the hydrogeochemical and hydrogeological descriptive and modelling programmes. This has involved not only a wide range of well established disciplines such as geology, hydrogeology and hydrochemistry, but also the extraction and determination of rock matrix porewaters by out-diffusion, a relatively new approach in crystalline rock. This required a sophisticated laboratory based input, not only to extract and analyse the porewaters, but also to take into consideration any effects associated to, for example, connected physical porosity and/or geochemical porosity in the rock matrix. In general, there is a good integrated understanding of the Olkiluoto site in terms of the geology, mineralogy, hydrology, hydrochemistry and the overall palaeohydrogeochemical model. The Olkiluoto site has had a complex geological and environmental history from Precambrian to the Quaternary as shown by fluid inclusions in quartz grains and fracture calcites. The Quaternary time period has been dominated by a large climatic variation of cold glacial cycles with temperate interglacials and sea-level changes, all of which have contributed to the hydrogeochemical evolution at the Olkiluoto site. All data indicate that infiltration of aerobic water has systematically been limited to few metres depth in the bedrock at Olkiluoto. Today at about the -300 m elevation level, there exists a distinct change in groundwater chemistry and mean residence time including a redox divide supported by a significant reduction in both the intensity and transmissivity of the water connected fracture networks. These indicate that long term stability (over the time span of glacial cycles) and sufficient buffering capacity of the water-rock system against aerobic infiltration, has dominated continuously until

  11. Evolution of the Olkiluoto site. Palaeohydrogeochemical considerations

    Energy Technology Data Exchange (ETDEWEB)

    Smellie, J. (ed.) [Conterra AB, Stockholm (Sweden); Pitkaenen, P.; Koskinen, L.; and others


    Over the past 20 years a considerable amount of work has been carried out to establish a palaeohydrogeological understanding of the Olkiluoto site and surrounding area, and to integrate this knowledge into the hydrogeochemical and hydrogeological descriptive and modelling programmes. This has involved not only a wide range of well established disciplines such as geology, hydrogeology and hydrochemistry, but also the extraction and determination of rock matrix porewaters by out-diffusion, a relatively new approach in crystalline rock. This required a sophisticated laboratory based input, not only to extract and analyse the porewaters, but also to take into consideration any effects associated to, for example, connected physical porosity and/or geochemical porosity in the rock matrix. In general, there is a good integrated understanding of the Olkiluoto site in terms of the geology, mineralogy, hydrology, hydrochemistry and the overall palaeohydrogeochemical model. The Olkiluoto site has had a complex geological and environmental history from Precambrian to the Quaternary as shown by fluid inclusions in quartz grains and fracture calcites. The Quaternary time period has been dominated by a large climatic variation of cold glacial cycles with temperate interglacials and sea-level changes, all of which have contributed to the hydrogeochemical evolution at the Olkiluoto site. All data indicate that infiltration of aerobic water has systematically been limited to few metres depth in the bedrock at Olkiluoto. Today at about the -300 m elevation level, there exists a distinct change in groundwater chemistry and mean residence time including a redox divide supported by a significant reduction in both the intensity and transmissivity of the water connected fracture networks. These indicate that long term stability (over the time span of glacial cycles) and sufficient buffering capacity of the water-rock system against aerobic infiltration, has dominated continuously until

  12. Results of Monitoring at Olkiluoto in 2005. Rock Mechanics

    International Nuclear Information System (INIS)

    Riikonen, S.


    Programme of Monitoring (Posiva 2003 b) was introduced to study Olkiluoto investigation are both during and following the excavation of underground test facility, ONKALO. Programme consists of four main headings: rock mechanics, hydrology and hydrogeology, geochemistry and other types of disturbance. Monitoring programme in year 2005 consist of three fields of research: microseismic measurements, GPS measurements and precise levelling. This report presents Posiva's rock mechanical monitoring programme results from the year 2005. Report has been composed from annual reports of microseismic measurements, GPS measurements and precise levelling by Sanna Riikonen. In Olkiluoto, Posiva Oy has operated a local seismic network since February 2002. This report gives the results of microseismic monitoring during the year 2005. Also the changes in the structure and the operation procedure of the network are described. The network has operated nearly continuously. The total duration of network failures has been about 8 hours. Altogether 2159 events have been located in the Olkiluoto area, in reported time period. The magnitudes of the observed events range from ML = -2.1to ML = 1.6 (ML = magnitude in local Richter's scale). Most of them are explosions. Three of the observed events are be classified as microearthquakes. Evidence of activity that would has influence on the safety of the ONKALO, have not found. The GPS based deformation studies has been made at the investigation areas of Posiva since 1995, when the network of ten GPS pillars was established at Olkiluoto. Twenty GPS measurement campaigns have been carried out at Olkiluoto since 1995. According to the time series of the GPS results 1/3 of the baselines at Olkiluoto have statistically significant change rates. However, the observed movements are smaller than ± 0.22 mm/a. There are five pillars, which have statistically significant horizontal velocities at Olkiluoto. The local velocity components are small but

  13. Hydrogeological structure model of the Olkiluoto Site. Update in 2010

    International Nuclear Information System (INIS)

    Vaittinen, T.; Ahokas, H.; Nummela, J.; Paulamaeki, S.


    As part of the programme for the final disposal of spent nuclear fuel, a hydrogeological structure model containing the hydraulically significant zones on Olkiluoto Island has been compiled. The structure model describes the deterministic site scale zones that dominate the groundwater flow. The main objective of the study is to provide the geometry and the hydrogeological properties related to the groundwater flow for the zones and the sparsely fractured bedrock to be used in the numerical modelling of groundwater flow and geochemical transport and thereby in the safety assessment. Also, these zones should be taken into account in the repository layout and in the construction of the disposal facility and they have a long-term impact on the evolution of the site and the safety of the disposal repository. The previous hydrogeological model was compiled in 2008 and this updated version is based on data available at the end of May 2010. The updating was based on new hydrogeological observations and a systematic approach covering all drillholes to assess measured fracture transmissivities typical of the site-scale hydrogeological zones. New data consisted of head observations and interpreted pressure and flow responses caused by field activities. Essential background data for the modelling included the ductile deformation model and the site scale brittle deformation zones modelled in the geological model version 2.0. The GSM combine both geological and geophysical investigation data on the site. As a result of the modelling campaign, hydrogeological zones HZ001, HZ008, HZ19A, HZ19B, HZ19C, HZ20A, HZ20B, HZ21, HZ21B, HZ039, HZ099, OL-BFZ100, and HZ146 were included in the structure model. Compared with the previous model, zone HZ004 was replaced with zone HZ146 and zone HZ039 was introduced for the first time. Alternative zone HZ21B was included in the basic model. For the modelled zones, both the zone intersections, describing the fractures with dominating groundwater

  14. Results of Monitoring at Olkiluoto in 2010. Rock Mechanics

    Energy Technology Data Exchange (ETDEWEB)

    Lahti, M [ed.; Siren, T


    The rock mechanical monitoring at Olkiluoto concentrates on the assessment of potential tectonic movements and stability of the bedrock. The construction of ONKALO is not expected to induce large-scale movements of the rock blocks or affect the rate of isostatic uplift but the evaluation of any tectonic events is important for the safety assessment. The monitoring consists of seismic measurements, GPS measurements and precise levelling campaigns at Olkiluoto and vicinity and extensometer and convergence measurements carried out in ONKALO. Posiva established a local seismic network of six stations on the island of Olkiluoto in 2002. After that the number of seismic stations has increased gradually. In 2010 the permanent seismic network consists of 15 seismic stations and 20 triaxial sensors. The purpose of the microearthquake measurements at Olkiluoto is to improve understanding of the structure, behaviour and long term stability of the bedrock. The investigation area includes two target areas. The larger target area, called seismic semiregional area, covers the Olkiluoto Island and its surroundings. The purpose is to monitor explosions and tectonic earthquakes in regional scale inside that area. The smaller target area is called the seismic ONKALO block, which is a 2 km *2 km *2 km cube surrounding the ONKALO. It is assumed that all the expected excavation induced events occur within this volume. At the moment the seismic ONKALO block includes ten seismic stations. An additional task of monitoring is related to safeguarding of the ONKALO. This report gives the results of microseismic monitoring during 2010.

  15. Results of Monitoring at Olkiluoto in 2010. Rock Mechanics

    International Nuclear Information System (INIS)

    Lahti, M.; Siren, T.


    The rock mechanical monitoring at Olkiluoto concentrates on the assessment of potential tectonic movements and stability of the bedrock. The construction of ONKALO is not expected to induce large-scale movements of the rock blocks or affect the rate of isostatic uplift but the evaluation of any tectonic events is important for the safety assessment. The monitoring consists of seismic measurements, GPS measurements and precise levelling campaigns at Olkiluoto and vicinity and extensometer and convergence measurements carried out in ONKALO. Posiva established a local seismic network of six stations on the island of Olkiluoto in 2002. After that the number of seismic stations has increased gradually. In 2010 the permanent seismic network consists of 15 seismic stations and 20 triaxial sensors. The purpose of the microearthquake measurements at Olkiluoto is to improve understanding of the structure, behaviour and long term stability of the bedrock. The investigation area includes two target areas. The larger target area, called seismic semiregional area, covers the Olkiluoto Island and its surroundings. The purpose is to monitor explosions and tectonic earthquakes in regional scale inside that area. The smaller target area is called the seismic ONKALO block, which is a 2 km *2 km *2 km cube surrounding the ONKALO. It is assumed that all the expected excavation induced events occur within this volume. At the moment the seismic ONKALO block includes ten seismic stations. An additional task of monitoring is related to safeguarding of the ONKALO. This report gives the results of microseismic monitoring during 2010

  16. Bedrock model of the Olkiluoto area

    International Nuclear Information System (INIS)

    Saksa, P.; Paananen, M.; Paulamaeki, S.; Anttila, P.; Front, K.; Pitkaenen, P.; Hassinen, P.; Ylinen, A.


    Site investigations were carried out at Olkiluoto (in Finland) in 1987-1992 in accordance with an investigation programme drawn up by Teollisuuden Voima Oy (TVO). The site was modelled in terms of rock types, fracturing, fracture structures and geohydrological conditions, the main focus of examination was on fracturing and associated hydraulic conductivity. The various properties of the bedrock structures were classified by means of a three-dimensional model. The descriptions of the models were gathered in a computer system for illustration and storage purposes. The rock types at Olkiluoto are migmatite, which may be divided into mica gneiss and veined gneiss, and also tonalite and coarse-grained migmatite granite (pegmatite). (64 refs., 65 figs.)

  17. Sampling and characterisation of groundwater colloids at ONKALO, Olkiluoto, Finland

    International Nuclear Information System (INIS)

    Takala, M.; Manninen, P.


    The purpose of this sampling campaign was to test different filtering methods and filter membranes, to determine the colloid concentration and to characterise the composition of the colloid phase at ONKALO groundwater station ONK-PVA1 at Olkiluoto. The sampling was done on 18 to 19 April 2006. The filtering methods tested were downhole in-situ filtration and in-line syringe filtration. The membranes tested were Anopore 0.2-μm membrane and Nuclepore 0.05 -μm membrane. The Anopore filter was designed to be 0.02 -μm, but according to the SEM micrograph the nominal pore size of the membranes was 0.2 -μm. The size distributions were determined by single particle analysis of the SEM micrographs taken from the used filter membranes. The size distribution can be expressed as a function of the Pareto power law (Buffle, 1988). Parameters A and b of the Pareto power law distribution were determined by using the least square sum method. The particle and mass concentrations were then calculated using the Pareto power law. The size distribution varied between the filtering methods, so that the syringe filtered samples indicated less aggregation than the downhole filtered samples. The colloid concentrations were higher in the Nuclepore filter membranes. This is probably due to the shorter settling time prior to the sampling or differences in the membrane pore size and material. The concentration of the colloid phase determined from the anopore membranes (0.05-1 -μm) was 0.2-0.4 mg/L. The water samples were analysed at the accredited laboratory of Consulting Engineers Paavo Ristola Ltd. The differences in the element concentrations were not detectable between the filtered and unfiltered samples. Contamination with, e.g., nickel, aluminium and organic carbon was evident. The valves, fittings and filter membranes probably caused the contamination. An EDS spectrum was taken from the downhole filtered Nuclepore membrane. The filter cake showed traces of aluminium, silicon and

  18. Thermo/viscoelastic analysis of the waste-container sleeve: I. Time-dependent salt loading on the sleeve and closure of the drillhole. Technical memorandum report RSI-0020

    International Nuclear Information System (INIS)

    Callahan, G.D.; Ratigan, J.L.


    The thermo/viscoelastic analyses predicts a maximum drillhole surface pressure of approximately 3,000 psi after one-half year of heating, assuming the drillhole surface is fixed against radial displacement. With the drillhole surface free to displace radially, the radial displacement is observed to be about 1.5 inches after twenty-five years of heating, for a total drillhole closure of 3.0 inches. In this particular case, with the centerline of the pillar being a line of symmetry, the material expansion upon heating forces the salt upward and into the room and drillhole areas

  19. Results of monitoring at Olkiluoto in 2006. Rock mechanics

    International Nuclear Information System (INIS)

    Mattila, J.


    Posiva Oy has operated a local microseismic at Olkiluto network since February 2002. During the monitoring in 2006, altogether 2041 events have been located in the Olkiluoto area, in the reported time period. The magnitudes of the observed events range from ML = -1.1 to 3.1 (ML = magnitude in local Richter's scale). Most of the events are construction-related explosions but two of them are recorded as microearthquakes. Evidence of seismic activity that would have influence on the safety of the ONKALO, have not been observed. The observed earthquakes that occurred in 2006 were small, with a magnitude of ML -0.6 and ML= -0.9. The earthquakes relate to small movements in brittle deformation zones OL-BFZ043 and OL-BFZ034. Estimated peak slip values of the earthquakes are 14 μm and 4 μm and the source radiuses 11 and 8 meters, respectively. The GPS based deformation studies have been made at the investigation areas of Posiva since 1995, when the network of ten GPS pillars was established at Olkiluoto. Since then, altogether 22 GPS measurement campaigns have been carried out at Olkiluoto. According to the time series of the GPS results, 1/3 of the baselines at Olkiluoto have statistically significant change rates. However, the observed movements are smaller than ± 0.22 mm/a. There are five pillars, which have statistically significant horizontal velocities at Olkiluoto. These local velocity components are small but taking into account the standard deviations the largest velocity components seems to be reliably determined (maximum velocity is -0.23 mm/a ± 0.023 mm/a) (orig.)

  20. Petrology of Olkiluoto

    International Nuclear Information System (INIS)

    Kaerki, A.; Paulamaeki, S.


    The rocks of Olkiluoto fall into four main groups: (1) gneisses, (2) migmatitic gneisses, (3) TGG-gneisses (TGG = tonalite-granodiorite-granite) and 4) pegmatitic granites. In addition, narrow diabase dykes occur sporadically. The gneisses include homogeneous mica-bearing quartz gneisses, banded mica gneisses and hornblende or pyroxene-bearing mafic gneisses. The migmatitic gneisses, which typically comprise 20 - 40% leucosome, can be divided into three subgroups in terms of their migmatite structures: veined gneisses, stromatic gneisses and diatexitic gneisses. The leucosomes of the veined gneisses show vein-like, more or less elongated traces with some features similar to augen structures. Planar leucosome layers characterize the stromatic gneisses, while the migmatite structure of the diatexitic gneisses is asymmetric and irregular. The TGG gneisses are medium-grained, relatively homogeneous rocks that can show a blastomylonitic foliation, but they can also resemble plutonic, unfoliated rocks. The pegmatitic granites are leucocratic, very coarse-grained rocks, which may contain large garnet, tourmaline and cordierite phenocrysts. Mica gneiss inclusions are typical of the larger pegmatitic bodies. Gneisses, which are weakly or not at all migmatitic, make ca. 9% of the bedrock. Migmatitic gneisses make up over 64% of the volume of the Olkiluoto bedrock, with the veined gneisses accounting for 43%, the stromatic gneisses for 0.4% and the diatexitic gneisses for 21%, based on drill core logging. Of the remaining lithologies, TGG gneisses constitute 8% and pegmatitic granites almost 20% by volume. The supracrustal rocks of Olkiluoto can be divided into four series by reference to whole rock chemical composition: a T series, S series, P series and basic, volcanogenic gneisses. Rocks of the T, S and P series seem to make up 42%, 12% and 26%, respectively, of the volume of central part of the island of Olkiluoto, in addition to which, pegmatitic granites and diabases

  1. Microbiology of Olkiluoto Groundwater 2004 - 2006

    International Nuclear Information System (INIS)

    Pedersen, K.


    The microbiology of shallow and deep groundwater in Olkiluoto, Finland, was analysed for almost three years from 2004 to 2006. The extensive sampling and analysis programme produced a substantial database, including 60 analytical datasets on the microbiology of Olkiluoto groundwater, which is described and interpreted here. One part of this database comprises 39 complete analytical datasets on microbiology, chemistry, and dissolved gas composition assembled on four sampling campaigns from measurements from 16 shallow observation tubes and boreholes ranging in depth from 3.5 to 24.5 m. The second part of the database contains 21 datasets on microbiology and chemistry covering 13 deep boreholes ranging in depth from 35 to 450 m. In addition, the database contains 33 completed analyses of gas covering 14 deep boreholes ranging in depth from 40 to 742 m. Most of these analyses were completed before the onset of ONKALO construction, and the remaining samples were collected before ONKALO construction had extended below a depth of 100 m; therefore, this dataset captures the undisturbed conditions before the building of ONKALO. Shallow groundwater in Olkiluoto contained dissolved oxygen at approximately 10% or less of saturation. The presence of aerobic and anaerobic microorganisms, including methane-oxidizing bacteria, has been documented. The data confirm earlier suggested processes of oxygen reduction in the shallow part of the bedrock. These microbial processes reduce intruding oxygen in the shallow groundwater using dissolved organic carbon and methane as the main electron donors. Microbiological and geochemical data strongly suggest that the anaerobic microbial oxidation of methane (ANME) is active at a depth down to approximately 300 m in Olkiluoto, as has been suggested previously, based on interpretations of geochemical data. However, proof of the presence and activity of ANME microorganisms is needed before the existence of active ANME processes in Olkiluoto

  2. Diffusion in the matrix of rocks from Olkiluoto. The effect of anion exclusion

    International Nuclear Information System (INIS)

    Valkiainen, M.; Aalto, H.; Olin, M.; Lindberg, A.; Siitari-Kauppi, M.


    Diffusion in the rock matrix is dependent on two basic factors: the effective diffusion conductivity of the rock and the rock-capacity factor. The aim of this ongoing research is to study both of these factors more closely by finding evidence and studying the significance of anion exclusion and surface diffusion. The material for the study was selected form the drill-core of the drill-hole OL-KR5 from Olkiluoto investigations site. Six rock-types were included in the study, three unaltered and three altered. The water-types selected can be divided to two groups: in one the ionic strength is varied, in the another the ionic type is varied. The diffusion measurements were carried out partly by the equilibration-leaching method, partly by the through-diffusion method. The measurements by the equilibration-leaching method were performed in the anaerobic cabinet and the through-diffusion measurement in laboratory room conditions. Radioactive isotopes 3 H, 35 S, 36 Cl and 22 Na were selected as tracers. This report contains results of the equilibration-leaching measurements and through- diffusion measurements using 3 H (HTO), 36 Cl (Cl-) and 35 S(SO 4 2- ) as tracers. The rock-types under study were also studied in the University of Helsinki, Department of Chemistry using polymethylmethacrylate labelled with 14 C revealing the pore structure. Also, results of specific surface area measurements made in BAM, Berlin are given. The comparison of results obtained by the gas diffusion method at the University of Jyvaeskylae to the results obtained by tritium are also appended. (12 refs., 20 figs., 10 tabs.)

  3. Results of monitoring at Olkiluoto in 2004. Rock mechanics

    International Nuclear Information System (INIS)

    Riikonen, S.


    This report presents Posiva Oy's results of the rock mechanical monitoring programme from the year 2004. Monitoring programme was established for long time monitoring of modifications in the bedrock during the excavation of the ONKALO underground research facility stated in Olkiluoto island. This is the first annual report where rock mechanical research work has being reported also from the monitoring point of view. Rock mechanical research work consists of both GPS measurements and microseismic measurements carried out in Olkiluoto island. Both measurements have been performed during several years even before monitoring programme was established. GPS measurements have been carried out since 1995 and microseismic network has operated since 2002. There have been no significant changes in observations when studying rock mechanical results from the year 2004 and comparing them to results from the previous years. Therefore it can be said, that so far ONKALO has barely had any effect on rock mechanics in Olkiluoto. Report has been composed from the annual reports of GPS measurements.(orig.)

  4. Geological data acquisition for site characterisation at Olkiluoto: a framework for the phase of underground investigations

    International Nuclear Information System (INIS)

    Milnes, A.G.; Aaltonen, I.; Kemppainen, K.; Mattila, J.; Wikstroem, L.; Front, K.; Kaerki, A.; Gehoer, S.; Paulamaeki, S.; Paananen, M.; Ahokas, T.


    'Geological data acquisition' is a general term for the collection of observations and measurements by direct observation of exposed bedrock in the field (i.e. in natural outcrops and trenches, in drillholes, and in tunnels and other underground excavations). Only field-based data acquisition is included in this report: laboratory-based investigations will be continued, based on the field data and sampling, and all the data will be subject to discipline-specific processing, as the project proceeds. The ultimate aim of geological data acquisition is to provide the necessary data base for geological models of the bedrock of the Olkiluoto site, in connection with the construction of an underground rock characterisation facility, ONKALO, and a repository for spent nuclear fuel, at about 500m depth. Geological data acquisition plays a central role in site characterisation and modelling, and is intended to provide a solid platform on which the other disciplines (rock mechanics, hydrogeology, seismic risk assessment, etc.) can base their investigations. Based on consideration of a series of guidelines (e.g. modelling scale, source of data, level of investigation, national and international experience, special conditions at Olkiluoto, need for process understanding), a project-oriented 'framework' has been developed as a background to the different projects within the geological data acquisition programme. Each project will require its own system of data acquisition (methodology, spreadsheets, protocols, etc.), as described in the corresponding reports; the present report concentrates on the general principles which lie behind the different methodologies and data sheets. These principles are treated under three main headings: characterization of intact rock, characterization of deformation zone intersections, and characterization of individual fractures. Geological mapping of natural outcrops and trenches at Olkiluoto, and lithological logging of more than 40 rock cores

  5. Environmental Impact Assessment for Olkiluoto 4 Nuclear Power Plant Unit in Finland

    International Nuclear Information System (INIS)

    Dersten, Riitta; Gahmberg, Sini; Takala, Jenni


    In order to improve its readiness for constructing additional production capacity, Teollisuuden Voima Oyj (TVO) initiated in spring 2007 the environmental impact assessment procedure (EIA procedure) concerning a new nuclear power plant unit that would possibly be located at Olkiluoto. When assessing the environmental impacts of the Olkiluoto nuclear power plant extension project, the present state of the environment was first examined, and after that, the changes caused by the projects as well as their significance were assessed, taking into account the combined impacts of the operations at Olkiluoto. The environmental impact assessment for the planned nuclear power plant unit covers the entire life cycle of the plant unit. (authors)

  6. Environmental Impact Assessment for Olkiluoto 4 Nuclear Power Plant Unit in Finland

    Energy Technology Data Exchange (ETDEWEB)

    Dersten, Riitta; Gahmberg, Sini; Takala, Jenni [Teollisuuden Voima Oyj, Olkiluoto, FI-27160 Eurajoki (Finland)


    In order to improve its readiness for constructing additional production capacity, Teollisuuden Voima Oyj (TVO) initiated in spring 2007 the environmental impact assessment procedure (EIA procedure) concerning a new nuclear power plant unit that would possibly be located at Olkiluoto. When assessing the environmental impacts of the Olkiluoto nuclear power plant extension project, the present state of the environment was first examined, and after that, the changes caused by the projects as well as their significance were assessed, taking into account the combined impacts of the operations at Olkiluoto. The environmental impact assessment for the planned nuclear power plant unit covers the entire life cycle of the plant unit. (authors)

  7. Site scale groundwater flow in Olkiluoto

    International Nuclear Information System (INIS)

    Loefman, J.


    Groundwater flow modelling on the site scale has been an essential part of site investigation work carried out at different locations since 1986. The objective of the modelling has been to provide results that characterise the groundwater flow conditions deep in the bedrock. The main result quantities can be used for evaluation of the investigation sites and of the preconditions for safe final disposal of spent nuclear fuel. This study represents the latest modelling effort at Olkiluoto (Finland), and it comprises the transient flow analysis taking into account the effects of density variations and the repository as well as the post-glacial land uplift. The analysis is performed by means of numerical finite element simulation of coupled and transient groundwater flow and solute transport carried out up to 10000 years into the future. This work provides also the results for the site-specific data needs for the block scale groundwater flow modelling at Olkiluoto. Conceptually the fractured bedrock is divided into hydraulic units: the planar fracture zones and the remaining part of the bedrock. The equivalent-continuum (EC) model is applied so that each hydraulic unit is treated as a homogeneous and isotropic continuum with representative average characteristics. All the fracture zones are modelled explicitly and represented by two-dimensional finite elements. A site-specific simulation model for groundwater flow and solute transport is developed on the basis of the latest hydrogeological and hydrogeochemical field investigations at Olkiluoto. The present groundwater table and topography together with a mathematical model describing the land uplift at the Olkiluoto area are employed as a boundary condition at the surface of the model. The overall flow pattern is mostly controlled by the local variations in the topography. Below the island of Olkiluoto the flow direction is mostly downwards, while near the shoreline and below the sea water flows horizontally and

  8. Site scale groundwater flow in Olkiluoto

    Energy Technology Data Exchange (ETDEWEB)

    Loefman, J. [VTT Energy, Espoo (Finland)


    Groundwater flow modelling on the site scale has been an essential part of site investigation work carried out at different locations since 1986. The objective of the modelling has been to provide results that characterise the groundwater flow conditions deep in the bedrock. The main result quantities can be used for evaluation of the investigation sites and of the preconditions for safe final disposal of spent nuclear fuel. This study represents the latest modelling effort at Olkiluoto (Finland), and it comprises the transient flow analysis taking into account the effects of density variations and the repository as well as the post-glacial land uplift. The analysis is performed by means of numerical finite element simulation of coupled and transient groundwater flow and solute transport carried out up to 10000 years into the future. This work provides also the results for the site-specific data needs for the block scale groundwater flow modelling at Olkiluoto. Conceptually the fractured bedrock is divided into hydraulic units: the planar fracture zones and the remaining part of the bedrock. The equivalent-continuum (EC) model is applied so that each hydraulic unit is treated as a homogeneous and isotropic continuum with representative average characteristics. All the fracture zones are modelled explicitly and represented by two-dimensional finite elements. A site-specific simulation model for groundwater flow and solute transport is developed on the basis of the latest hydrogeological and hydrogeochemical field investigations at Olkiluoto. The present groundwater table and topography together with a mathematical model describing the land uplift at the Olkiluoto area are employed as a boundary condition at the surface of the model. The overall flow pattern is mostly controlled by the local variations in the topography. Below the island of Olkiluoto the flow direction is mostly downwards, while near the shoreline and below the sea water flows horizontally and

  9. Monitoring the bedrock stability in Olkiluoto. Summary of campaign based GPS measurements in 1996-2011

    International Nuclear Information System (INIS)

    Nyberg, S.; Kallio, U.; Haekli, P.; Jokela, J.; Koivula, H.; Saaranen, V.; Rouhiainen, P.


    The Finnish Geodetic Institute has monitored crustal deformations in Olkiluoto since mid-1990s. This is a final report of campaign based GPS measurements carried out in 1996-2011. The aim of the research has been monitoring the bedrock stability in the Olkiluoto area. The research were started in 1995, when a local GPS network of ten pillars, called inner network, was established on Olkiluoto Island. The research area was expanded in 2003- 2005 with four new pillars (outer network) established at 5-10 km distances from the inner network. One of the pillar points is the Olkiluoto permanent GPS station. Regular biannual measurement campaigns have been carried out on other pillar points

  10. Means of achieving high load factors at Olkiluoto 1 and 2

    International Nuclear Information System (INIS)

    Patrakka, E.


    Teollisuuden Voima Oy operates two BWR units Olkiluoto 1 and 2 that have achieved load factors typically higher than 90%. The operating experiences gained in the 1990s is summarised and the factors contributing to the high capacity factors are addressed. These include the general objectives for operation and maintenance, plant modernisation programme, maintenance principles, and outage policy and experiences. Finally, the international evaluations performed at Olkiluoto are mentioned. (author)

  11. Basic data report for drilling and hydrologic testing of drillhole DOE-2 at the Waste Isolation Pilot Plant (WIIP) site

    Energy Technology Data Exchange (ETDEWEB)

    Mercer, J.W.; Beauheim, R.L.; Snyder, R.P.; Fairer, G.M.


    Drillhole DOE-2 was drilled to investigate a structural depression marked by the downward displacement of stratigraphic markers in the Salado Formation. Contrary to several hypotheses, halite layers were thicker in the lower part of the Salado, not thinner as a result of any removal of halite. The upper Castile anhydrite in Drillhole DOE-2 is anomalously thick and is strongly deformed relative to the anhydrite in adjacent drillholes. In contrast, the halite was <8 ft thick and significantly thinner than usually encountered. The lower Castile anhydrite appears to be normal. The depression within the correlated marker beds in the Salado Formation in Drillhole DOE-2 is interpreted as a result of gravity-driven deformation of the underlying Castile Formation. Several stratigraphic units were hydrologically tested in Drillhole DOE-2. Testing of the unsaturated lower portion of the Dewey Lake Red Beds was unsuccessful because of exceptionally small rates of fluid intake. Drill-stem tests were conducted in five intervals in the Rustler Formation, over the Marker Bed 138-139 interval in the Salado formation, and over three sandstone members of the Bell Canyon Formation. A pumping test was conducted in the Culebra Dolomite Member of the Rustler Formation. Pressure-pulse tests were conducted over the entire Salado Formation. Fluid samples were collected from the Culebra Dolomite Member and from the Hays Member of the Bell Canyon Formation. 31 refs., 31 figs., 5 tabs.

  12. Basic data report for drilling and hydrologic testing of drillhole DOE-2 at the Waste Isolation Pilot Plant (WIIP) site

    International Nuclear Information System (INIS)

    Mercer, J.W.; Beauheim, R.L.; Snyder, R.P.; Fairer, G.M.


    Drillhole DOE-2 was drilled to investigate a structural depression marked by the downward displacement of stratigraphic markers in the Salado Formation. Contrary to several hypotheses, halite layers were thicker in the lower part of the Salado, not thinner as a result of any removal of halite. The upper Castile anhydrite in Drillhole DOE-2 is anomalously thick and is strongly deformed relative to the anhydrite in adjacent drillholes. In contrast, the halite was <8 ft thick and significantly thinner than usually encountered. The lower Castile anhydrite appears to be normal. The depression within the correlated marker beds in the Salado Formation in Drillhole DOE-2 is interpreted as a result of gravity-driven deformation of the underlying Castile Formation. Several stratigraphic units were hydrologically tested in Drillhole DOE-2. Testing of the unsaturated lower portion of the Dewey Lake Red Beds was unsuccessful because of exceptionally small rates of fluid intake. Drill-stem tests were conducted in five intervals in the Rustler Formation, over the Marker Bed 138-139 interval in the Salado formation, and over three sandstone members of the Bell Canyon Formation. A pumping test was conducted in the Culebra Dolomite Member of the Rustler Formation. Pressure-pulse tests were conducted over the entire Salado Formation. Fluid samples were collected from the Culebra Dolomite Member and from the Hays Member of the Bell Canyon Formation. 31 refs., 31 figs., 5 tabs

  13. Engineering rock mass classification of the Olkiluoto investigation site

    Energy Technology Data Exchange (ETDEWEB)

    Aeikaes, K. [ed.; Hagros, A.; Johansson, E. [Saanio and Riekkola Consulting Engineers, Helsinki (Finland)] [and others


    Olkiluoto in Eurajoki is being investigated as a possible site for the final disposal of spent nuclear fuel from the Finnish nuclear power plants. The selection of the depth, placement and layout of the repository is affected by the constructability of the bedrock. The constructability, in turn, is influenced by several properties of the host rock, such as its Ethology, the extent of fracturing, its hydrogeological properties and rock engineering characteristics and also by the magnitude and orientation of the in situ stresses and the chemistry of the groundwater. The constructability can be evaluated by the application of a rock classification system in which the properties of the host rock are assessed against common rock engineering judgements associated with underground construction. These judgements are based partly on measurements of in situ stresses and the properties of the bedrock determined from rock samples, but an important aspect is also the practical experience which has been gained during underground excavation in similar conditions and rock types. The aim of the engineering rock mass classification was to determine suitable bedrock volumes for the construction of the repository and has used data from the site characterisation programme carried out at Olkiluoto, which consisted of both surface studies and borehole investigations. The classification specifies three categories of constructability - normal, demanding and very demanding. In addition, rock mass quality has also been classified according to the empirical Q-system to enable a comparison to be made. The rock mass parameters that determine the constructability of the bedrock at Olkiluoto depend primarily on the depth and the Ethology, as well as on whether construction takes place in intact or in fractured rock. The differences in the characteristics of intact rock within a single rock type have been shown to be small. The major lithological unit at Olkiluoto, the mica gneiss, lies in the

  14. Simulations of permafrost evolution at Olkiluoto

    Energy Technology Data Exchange (ETDEWEB)

    Hartikainen, J. [Aalto Univ., Espoo (Finland)


    This report provides numerical estimations of the evolution of permafrost and perennially frozen ground at Olkiluoto on time-scales of 60,000 and 125,000 years using Olkiluoto's site-specific information on time histories of ground level temperatures, ice sheet thickness, basal conditions, shoreline migration, soil and vegetation cover as well as heat generation from the spent fuel at a depth of 420 metres. When considering environmental conditions akin to the last glacial cycle for a 125,000 years long period, the maximum permafrost depth over the repository area can exceed the depth of 300 m and the maximum depth of perennially frozen ground the depth of 270 m. If Olkiluoto, after a 50,000 years long temperate phase of boreal climate, was subjected to a 10,000 years long periglacial period with air temperature decreased between -5 deg C and -10 deg C, the maximum permafrost depth would range between 60 and 240 m and the maximum depth of perennially frozen ground between 50 and 220 m. Furthermore, permafrost would reach the repository depth in 10,000 years, if the air temperature was lowered down to -15 deg C and the ground surface had a very thin vegetation and snow cover. Alternatively, if Olkiluoto experienced a 125,000 years long glacial cycle with a very long periglacial periods of low air temperatures and thin vegetation and snow cover and without any ice sheet development, permafrost would reach the depth of 400 m in 98,000 years and perennially frozen ground in 101,000 years. The areal distribution of permafrost and perennially frozen ground are broadly affected by the snow cover, lakes and the peat areas, especially when an extensive peat growth occurs. The lack of snow cover can enhance the evolution of the maximum depth of permafrost and perennially frozen ground by over 50 %. In addition, ground thermal conditions and the heat generation from the spent fuel modify the spatial and temporal development of permafrost and perennially frozen ground. A

  15. Simulations of permafrost evolution at Olkiluoto

    International Nuclear Information System (INIS)

    Hartikainen, J.


    This report provides numerical estimations of the evolution of permafrost and perennially frozen ground at Olkiluoto on time-scales of 60,000 and 125,000 years using Olkiluoto's site-specific information on time histories of ground level temperatures, ice sheet thickness, basal conditions, shoreline migration, soil and vegetation cover as well as heat generation from the spent fuel at a depth of 420 metres. When considering environmental conditions akin to the last glacial cycle for a 125,000 years long period, the maximum permafrost depth over the repository area can exceed the depth of 300 m and the maximum depth of perennially frozen ground the depth of 270 m. If Olkiluoto, after a 50,000 years long temperate phase of boreal climate, was subjected to a 10,000 years long periglacial period with air temperature decreased between -5 deg C and -10 deg C, the maximum permafrost depth would range between 60 and 240 m and the maximum depth of perennially frozen ground between 50 and 220 m. Furthermore, permafrost would reach the repository depth in 10,000 years, if the air temperature was lowered down to -15 deg C and the ground surface had a very thin vegetation and snow cover. Alternatively, if Olkiluoto experienced a 125,000 years long glacial cycle with a very long periglacial periods of low air temperatures and thin vegetation and snow cover and without any ice sheet development, permafrost would reach the depth of 400 m in 98,000 years and perennially frozen ground in 101,000 years. The areal distribution of permafrost and perennially frozen ground are broadly affected by the snow cover, lakes and the peat areas, especially when an extensive peat growth occurs. The lack of snow cover can enhance the evolution of the maximum depth of permafrost and perennially frozen ground by over 50 %. In addition, ground thermal conditions and the heat generation from the spent fuel modify the spatial and temporal development of permafrost and perennially frozen ground. A

  16. Results of Monitoring at Olkiluoto in 2009. Hydrogeochemistry

    International Nuclear Information System (INIS)

    Penttinen, T.; Lahdenperae, A.-M.; Ahokas, T.; Partamies, S.; Kasa, S.; Pitkaenen, P.


    The construction work of underground research facility ONKALO started in the autumn 2004. Possible changes caused by the construction of the disposal facility in the chemical environment in shallow and deep groundwaters are monitored on a regular basis. This report presents the hydrogeochemical monitoring measurements and observations made in 2009. A total of 31 shallow groundwater samples were taken in monitoring programme and 49 shallow groundwater samples in the Infiltration experiment area in 2009. The sampling points of shallow groundwaters were divided into groups on a basis of their typical geological and geographic features. The seasonal variation in concentration levels was now clearly observed in OL-PVP3A, OL-PVP13, OL-PVP14, OL-PVP17, OL-PVP18A, OL-PVP20, OL-PP39 and OL-PP56. This behaviour is related to high naturally fluctuating concentrations in these sampling sites. The effect of Korvensuo on the groundwater of OL-PVP30 appeared. No straight connection can be made with the ONKALO construction work and the observed changes in shallow groundwater concentrations. 47 deep groundwater samplings were carried out during the year 2009 from 19 different drillholes and 30 groundwater samples were taken from ONKALO. 10 gas samples have been analysed and collected from 6 open drillholes during the year 2009 and 5 are from sampling points of ONKALO. The results from ground surface based monitoring campaign in 2009 show indications of changes in groundwater compositions, which are most probably caused by high hydraulic gradient of ONKALO. The 2009 results show slight but clear systematic dilution (in all species) in two monitoring points (OL-KR4 T 76 and OL-KR37 T 165, both intersections of HZ19) relative to the previous samplings. Of the monitored intersections of hydraulic zone HZ20B the OL-KR10 T 326 have continued dilution trend (after packering) and OL-KR9 T 468 and OL-KR23 T 424 h ave become more saline. Particularly the start of salinity increase in OL-KR9

  17. Migmatites and migmatite-like rocks of Olkiluoto

    International Nuclear Information System (INIS)

    Kaerki, A.


    Bedrock of the Olkiluoto Island in the western end of the Palaeoproterozoic Svecofennian Accretionary Arc Complex, SW Finland is composed of high-grade metamorphic pelites, arenites and intermediate, arc type metavolcanic rocks intruded by granodioritic to tonalitic plutonic rocks. Regional metamorphism culminated with voluminous migmatization in the temperature of 660 - 700 deg C and relatively low pressure of about 3.5 - 4 kbar. The end result of polyphase metamorphism and deformation is a metamorphic rock succession composed of diverse migmatite rocks, metatexites and diatexites. Metatexites are migmatites in which several, discrete components can be detected, and in which the paleosome with some pre-partial-melting textures is identifiable. Diatexites are more advanced migmatites in which the pre-migmatization structures are often totally destroyed and the rock is dominated by different neosome components meaning leucosome, melanosome or mesosome. Based on the migmatite structures the metatexites of Olkiluoto have been classified into six subgroups. Dike-structured metatexites are composed of well preserved paleosome intruded by one single set of narrow, subparallel leucosome dikes which cover ca. 5 - 10 % of the whole rock volume. Net-structure is composed of a network of narrow leucosome dikes which show a reticulated structure in a plane section and cover less than 30 % of the whole rock volume. Breccia-structure is composed of angular or rounded paleosome blocks surrounded by moderate amount of leucosome. Patch-structure is composed of irregular leucosome patches which intruded the well preserved paleosome and compose typically 20 - 70 % of the rock volume. Layer-structure is characterized by more or less regular leucosome dikes sub-parallel to the foliation of the well preserved paleosome. Vein-structured metatexites and also diatexites include a set of pipe-like, longish leucosome veins most probably generated by synchronous melting and deformation

  18. Migmatites and migmatite-like rocks of Olkiluoto

    Energy Technology Data Exchange (ETDEWEB)

    Kaerki, A. [Kivitieto Oy, Oulu (Finland)


    Bedrock of the Olkiluoto Island in the western end of the Palaeoproterozoic Svecofennian Accretionary Arc Complex, SW Finland is composed of high-grade metamorphic pelites, arenites and intermediate, arc type metavolcanic rocks intruded by granodioritic to tonalitic plutonic rocks. Regional metamorphism culminated with voluminous migmatization in the temperature of 660 - 700 deg C and relatively low pressure of about 3.5 - 4 kbar. The end result of polyphase metamorphism and deformation is a metamorphic rock succession composed of diverse migmatite rocks, metatexites and diatexites. Metatexites are migmatites in which several, discrete components can be detected, and in which the paleosome with some pre-partial-melting textures is identifiable. Diatexites are more advanced migmatites in which the pre-migmatization structures are often totally destroyed and the rock is dominated by different neosome components meaning leucosome, melanosome or mesosome. Based on the migmatite structures the metatexites of Olkiluoto have been classified into six subgroups. Dike-structured metatexites are composed of well preserved paleosome intruded by one single set of narrow, subparallel leucosome dikes which cover ca. 5 - 10 % of the whole rock volume. Net-structure is composed of a network of narrow leucosome dikes which show a reticulated structure in a plane section and cover less than 30 % of the whole rock volume. Breccia-structure is composed of angular or rounded paleosome blocks surrounded by moderate amount of leucosome. Patch-structure is composed of irregular leucosome patches which intruded the well preserved paleosome and compose typically 20 - 70 % of the rock volume. Layer-structure is characterized by more or less regular leucosome dikes sub-parallel to the foliation of the well preserved paleosome. Vein-structured metatexites and also diatexites include a set of pipe-like, longish leucosome veins most probably generated by synchronous melting and deformation

  19. GPS deformation measurements at Olkiluoto in 2013

    International Nuclear Information System (INIS)

    Nyberg, S.; Kallio, U.; Koivula, H.


    The Finnish Geodetic Institute has monitored crustal deformations since mid-1990s at Olkiluoto, Kivetty and Romuvaara. The research was focused on the Olkiluoto area in 2001, when Olkiluoto was chosen to the site for the final disposal facility of the spent nuclear fuel. The work and the results of the GPS deformation monitoring at Olkiluoto in 2013 are presented. The measurement consisted of two GPS measurement campaigns, observations at local permanent stations and control markers measurements at four stations. In spring six new stations were set up for permanent tracking. In total 12 permanent stations were operating continuously from April to the end of the year. The residual time series of the stations showed periodic trends up to 3 mm in height and 1 mm in horizontal component relative to the GPS1 station. A few stations were still measured as campaign-based and analysed baseline by baseline. The data from permanent stations (GPS1-GPS9, and GPS13) were included. The analysis of the inner network based on campaign sessions showed very small motions as in previous years: 75 % of change rates are smaller than 0.10 mm/y. Roughly one third of the change rates could be considered statistically significant at 1 % significance level. Statistically significant change rates were estimated for baselines from GPS1 and GPS5. The trends and strains differed at some baselines clearly from the earlier analysis because of different troposphere modelling. The results of the outer network showed the largest difference on the baseline GPS1-GPS11 where the trend decreased from -0.42 mm/y to -0.28 mm/y. The strain pattern of the outer network shows an eastwards motion of GPS1. The estimated strains for the baselines east of GPS1 were -0.03/-0.04 ppm/y. The control marker measurements were carried at the stations GPS1, GPS2, GPS4 and GPS6. A comparison of the results with the previous measurements showed that the distance between control markers at GPS6 continues to increase. Also

  20. GPS deformation measurements at Olkiluoto in 2013

    Energy Technology Data Exchange (ETDEWEB)

    Nyberg, S.; Kallio, U.; Koivula, H. [Finnish Geodetic Institute, Masala (Finland)


    The Finnish Geodetic Institute has monitored crustal deformations since mid-1990s at Olkiluoto, Kivetty and Romuvaara. The research was focused on the Olkiluoto area in 2001, when Olkiluoto was chosen to the site for the final disposal facility of the spent nuclear fuel. The work and the results of the GPS deformation monitoring at Olkiluoto in 2013 are presented. The measurement consisted of two GPS measurement campaigns, observations at local permanent stations and control markers measurements at four stations. In spring six new stations were set up for permanent tracking. In total 12 permanent stations were operating continuously from April to the end of the year. The residual time series of the stations showed periodic trends up to 3 mm in height and 1 mm in horizontal component relative to the GPS1 station. A few stations were still measured as campaign-based and analysed baseline by baseline. The data from permanent stations (GPS1-GPS9, and GPS13) were included. The analysis of the inner network based on campaign sessions showed very small motions as in previous years: 75 % of change rates are smaller than 0.10 mm/y. Roughly one third of the change rates could be considered statistically significant at 1 % significance level. Statistically significant change rates were estimated for baselines from GPS1 and GPS5. The trends and strains differed at some baselines clearly from the earlier analysis because of different troposphere modelling. The results of the outer network showed the largest difference on the baseline GPS1-GPS11 where the trend decreased from -0.42 mm/y to -0.28 mm/y. The strain pattern of the outer network shows an eastwards motion of GPS1. The estimated strains for the baselines east of GPS1 were -0.03/-0.04 ppm/y. The control marker measurements were carried at the stations GPS1, GPS2, GPS4 and GPS6. A comparison of the results with the previous measurements showed that the distance between control markers at GPS6 continues to increase. Also

  1. Safety assessment of Olkiluoto NPP units 1 and 2. Decision of the Radiation and Nuclear Safety Authority regarding the periodic safety review of the Olkiluoto NPP

    International Nuclear Information System (INIS)


    In this safety assessment the Radiation and Nuclear Safety Authority (STUK) has evaluated the safety of the Olkiluoto Nuclear Power Plant units 1 and 2 in connection with the periodic safety review. This safety assessment provides a summary of the reviews, inspections and continuous oversight carried out by STUK. The issues addressed in the assessment and the related evaluation criteria are set forth in the nuclear energy and radiation safety legislation and the regulations issued thereunder. The provisions of the Nuclear Energy Act concerning the safe use of nuclear energy, security and emergency preparedness arrangements, and waste management are specified in more detail in the Government Decrees and Regulatory Guides issued by STUK. Based on the assessment, STUK consideres that the Olkiluoto Nuclear Power Plant units 1 and 2 meet the set safety requirements for operational nuclear power plants, the emergency preparedness arrangements are sufficient and the necessary control to prevent the proliferation of nuclear weapons has been appropriately arranged. The physical protection of the Olkiluoto nuclear power plant is not yet completely in compliance with the requirements of Government Decree 734/2008, which came into force in December 2008. Further requirements concerning this issue based also on the principle of continuous improvement were included in the decision relating to the periodic safety review. The safety of the Olkiluoto nuclear power plant was assessed in compliance with the Government Decree on the Safety of Nuclear Power Plants (733/2008), which came into force in 2008. The decree notes that existing nuclear power plants need not meet all the requirements set out for new plants. Most of the design bases pertaining to the Olkiluoto 1 and 2 nuclear power plant units were set in the 1970s. Substantial modernisations have been carried out at the Olkiluoto 1 and 2 nuclear power plant units since their commissioning to improve safety. This is in line with

  2. Climate scenarios for Olkiluoto on a time-scale of 120,000 years

    Energy Technology Data Exchange (ETDEWEB)

    Pimenoff, N.; Venaelaeinen, A.; Jaervinen, H. [Finnish Meteorological Institute, Helsinki (Finland)


    Posiva Oy is planning to dispose of spent nuclear fuel in a repository, to be constructed at a depth of 400 m in the crystalline bedrock at Olkiluoto, Finland. Planning the storage requires careful consideration of many aspects, including an assessment of long-term repository safety. For estimating possible climate states at Olkiluoto on a time-scale of 120,000 years, we analyze climate simulations of an Earth System Model of Intermediate Complexity (CLIMBER-2) coupled with an ice sheet model (SICOPOLIS). The simulations into the future clearly show that the onset of the next glaciation is strongly dependent on the Earth's orbital variations and the atmospheric CO{sub 2} concentration. It is evident that due to global warming, the climate of the next centuries will be warmer and wetter than at present. Most likely, due to global warming and low variations in the Earth's orbit around the sun, the present interglacial will last for at least the next 30,000 years. Further, the future simulations showed that the insolation minima on the Northern Hemisphere 50,000-60,000 and 90,000-100,000 years after the present hold a potential for the onset of the next glaciation. Hence, on a time-scale of 120,000 years, one must take into account climate periods lasting several thousand years having the following features: an interglacial climate, a periglacial climate, a climate with an ice sheet margin near Olkiluoto, a glacial climate with an ice sheet covering Olkiluoto, and a climate with Olkiluoto being depressed below sea level after glaciation due to isostatic depression. Due to the uncertainties related to the evolution of the future climate, it is recommended the simulations into the far future to be used only qualitatively. Quantitative information about glacial climate is achieved from the reconstructions and simulations of the past climate. (orig.)

  3. Climate scenarios for Olkiluoto on a time-scale of 120,000 years

    International Nuclear Information System (INIS)

    Pimenoff, N.; Venaelaeinen, A.; Jaervinen, H.


    Posiva Oy is planning to dispose of spent nuclear fuel in a repository, to be constructed at a depth of 400 m in the crystalline bedrock at Olkiluoto, Finland. Planning the storage requires careful consideration of many aspects, including an assessment of long-term repository safety. For estimating possible climate states at Olkiluoto on a time-scale of 120,000 years, we analyze climate simulations of an Earth System Model of Intermediate Complexity (CLIMBER-2) coupled with an ice sheet model (SICOPOLIS). The simulations into the future clearly show that the onset of the next glaciation is strongly dependent on the Earth's orbital variations and the atmospheric CO 2 concentration. It is evident that due to global warming, the climate of the next centuries will be warmer and wetter than at present. Most likely, due to global warming and low variations in the Earth's orbit around the sun, the present interglacial will last for at least the next 30,000 years. Further, the future simulations showed that the insolation minima on the Northern Hemisphere 50,000-60,000 and 90,000-100,000 years after the present hold a potential for the onset of the next glaciation. Hence, on a time-scale of 120,000 years, one must take into account climate periods lasting several thousand years having the following features: an interglacial climate, a periglacial climate, a climate with an ice sheet margin near Olkiluoto, a glacial climate with an ice sheet covering Olkiluoto, and a climate with Olkiluoto being depressed below sea level after glaciation due to isostatic depression. Due to the uncertainties related to the evolution of the future climate, it is recommended the simulations into the far future to be used only qualitatively. Quantitative information about glacial climate is achieved from the reconstructions and simulations of the past climate. (orig.)

  4. Climate scenarios for Olkiluoto on a time-scale of 100,000 years

    International Nuclear Information System (INIS)

    Pimenoff, N.; Venaelaeinen, A.; Jaervinen, H.


    Posiva Oy is planning to dispose of spent nuclear fuel in a repository, to be constructed at a depth of 400 m in the crystalline bedrock at Olkiluoto, Finland. Planning the storage requires careful consideration of many aspects, including an assessment of long-term repository safety. For estimating possible climate states at Olkiluoto on a time-scale of 100,000 years, we analyze climate simulations of an Earth System Model of Intermediate Complexity (CLIMBER-2) coupled with an ice sheet model (SICOPOLIS). The simulations into the future clearly show that the onset of the next glaciation is strongly dependent on the Earth's orbital variations and the atmospheric CO 2 concentration. It is evident that due to global warming, the climate of the next centuries will be warmer and wetter than at present. Most likely, due to global warming and low variations in the Earth's orbit around the sun, the present interglacial will last for at least the next 30,000 years. Further, the future simulations showed that the insolation minima on the Northern Hemisphere 50,000-60,000 and 90,000-100,000 years after the present hold a potential for the onset of the next glaciation. Hence, on a time-scale of 100,000 years, one must take into account climate periods lasting several thousand years having the following features: an interglacial climate, a periglacial climate, a climate with an ice sheet margin near Olkiluoto, a glacial climate with an ice sheet covering Olkiluoto, and a climate with Olkiluoto being depressed below sea level after glaciation due to isostatic depression. Due to the uncertainties related to the evolution of the future climate, it is recommended the simulations into the far future to be used only qualitatively. Quantitative information about glacial climate is achieved from the reconstructions and simulations of the past climate. (orig.)

  5. A system of nomenclature for rocks in Olkiluoto

    International Nuclear Information System (INIS)

    Mattila, J.


    Due to international interest in the Finnish deep repository project at Olkiluoto (SW Finland) and the need for collaboration between scientists involved in site investigations for the disposal of spent nuclear fuel in other countries, a well-documented system of rock nomenclature is required, based on existing classification schemes and international recommendations. The BGS (British Geological Survey) rock classification scheme is the most comprehensive rock classification scheme and the basic principles behind it are utilised for the system of nomenclature for rocks in Olkiluoto. The BGS classification system is based on the use of descriptive names and a clear hierarchy, making it possible to classify rocks at different levels depending on the specific goals of the study, the level of available information, and the expertise of the user. Each rock type is assigned a root name, which is based on structural and textural characteristics or modal compositions of the rock and the root names are refined with qualifier terms as prefixes. Qualifier terms refer to the structure or modal composition of the rock. The bedrock at the Olkiluoto site consists of metamorphic and igneous rocks. The metamorphic rocks consist of migmatitic gneisses and (non-migmatitic) gneisses, which are further divided according to their structural characteristics and modal compositions, the former into stromatic, veined, diatexitic gneisses, the latter into mica, quartz, mafic and TGG gneisses. Igneous rocks consist of pegmatitic granites, K-feldspar porphyry and diabases. (orig.)

  6. Olkiluoto 1 and 2 - Plant efficiency improvement and lifetime extension-project (PELE) implemented during outages 2010 and 2011

    Energy Technology Data Exchange (ETDEWEB)

    Kosonen, M.; Hakola, M. [Teollisuuden Voima Oyj, F- 27160 Eurajoki (Finland)


    Teollisuuden Voima Oyj (TVO) is a non-listed public company founded in 1969 to produce electricity for its stakeholders. TVO is the operator of the Olkiluoto nuclear power plant. TVO follows the principle of continuous improvement in the operation and maintenance of the Olkiluoto plant units. The PELE project (Plant Efficiency Improvement and Lifetime Extension), mainly completed during the annual outages in 2010 and 2011, and forms one part of the systematic development of Olkiluoto units. TVO maintains a long-term development program that aims at systematically modernizing the plant unit systems and equipment based on the latest technology. According to the program, the Olkiluoto 1 and Olkiluoto 2 plant units are constantly renovated with the intention of keeping them safe and reliable, The aim of the modernization projects is to improve the safety, reliability, and performance of the plant units. PELE project at Olkiluoto 1 was done in 2010 and at Olkiluoto 2 in 2011. The outage length of Olkiluoto 1 was 26 d 12 h 4 min and Olkiluoto 2 outage length was 28 d 23 h 46 min. (Normal service-outage is about 14 days including refueling and refueling-outage length is about seven days. See figure 1) The PELE project consisted of several single projects collected into one for coordinated project management. Some of the main projects were as follows: - Low pressure turbines: rotor, stator vane, casing and turbine instrumentation replacement. - Replacement of Condenser Cooling Water (later called seawater pumps) pumps - Replacement of inner isolation valves on the main steam lines. - Generator and the generator cooling system replacement. - Low voltage switchgear replacement. This project will continue during future outages. PELE was a success. 100 TVO employees and 1500 subcontractor employees participated in the project. The execution of the PELE projects went extremely well during the outages. The replacement of the low pressure turbines and seawater pumps improved the

  7. Olkiluoto 1 and 2 - Plant efficiency improvement and lifetime extension-project (PELE) implemented during outages 2010 and 2011

    International Nuclear Information System (INIS)

    Kosonen, M.; Hakola, M.


    Teollisuuden Voima Oyj (TVO) is a non-listed public company founded in 1969 to produce electricity for its stakeholders. TVO is the operator of the Olkiluoto nuclear power plant. TVO follows the principle of continuous improvement in the operation and maintenance of the Olkiluoto plant units. The PELE project (Plant Efficiency Improvement and Lifetime Extension), mainly completed during the annual outages in 2010 and 2011, and forms one part of the systematic development of Olkiluoto units. TVO maintains a long-term development program that aims at systematically modernizing the plant unit systems and equipment based on the latest technology. According to the program, the Olkiluoto 1 and Olkiluoto 2 plant units are constantly renovated with the intention of keeping them safe and reliable, The aim of the modernization projects is to improve the safety, reliability, and performance of the plant units. PELE project at Olkiluoto 1 was done in 2010 and at Olkiluoto 2 in 2011. The outage length of Olkiluoto 1 was 26 d 12 h 4 min and Olkiluoto 2 outage length was 28 d 23 h 46 min. (Normal service-outage is about 14 days including refueling and refueling-outage length is about seven days. See figure 1) The PELE project consisted of several single projects collected into one for coordinated project management. Some of the main projects were as follows: - Low pressure turbines: rotor, stator vane, casing and turbine instrumentation replacement. - Replacement of Condenser Cooling Water (later called seawater pumps) pumps - Replacement of inner isolation valves on the main steam lines. - Generator and the generator cooling system replacement. - Low voltage switchgear replacement. This project will continue during future outages. PELE was a success. 100 TVO employees and 1500 subcontractor employees participated in the project. The execution of the PELE projects went extremely well during the outages. The replacement of the low pressure turbines and seawater pumps improved the

  8. A drill-hole geodatabase as a tool to investigate geological hazard in Napoli Urban Area (United States)

    Albericoa, I.; Lirer, L.; Petrosino, P.


    Geological investigations in urban areas are complicated by the absence of good outcrops and field exposures, as a result of the density of civil buildings and railway and road network. On the other side, in urban areas geological investigation represents a basic tool to decisional support for the management of present private buildings and public works and for the planning of new ones. This is much more true in urban areas very exposed to geological hazard (volcanic, hydrogeological, seismic) where the high exposed value greatly rises the risk. The methodology to deal with the geological hazard in urban areas here presented is the reconstruction of buried geological formations deduced by drill-holes stratigraphy.The test area is represented by the whole municipality of Napoli city, that proves very apt to the investigation of the hazard in urban areas since it stands over an active volcanic area, comprised between the Campi Flegrei volcanic field and the Somma-Vesuvio district, that both gave explosive and effusive activity through the last centuries. Besides, the extension of the main part of the city constrained between the coastline and the belt of volcanic hills together with the presence of loose material due to pyroclastic activity makes the alluvional events an other hazardous phenomenon for the city. The performed up datable drill-holes geodata-base for the city of Napoli at present contains the record of about 800 holes stratigraphy, collected through the main public and private bodies, reflecting the drill-holes surveys made along the last 50 years before constructing the main railways, roads and aqueduct network. Drill-holes data have been interpreted and can now be read under various viewpoints (geological, lithological, volcanological); the present work presents the first results of the geological hazard investigation. The investigation of buried stratigraphy in the eastern area allows to identify the presence of pyroclastic flow deposits from Somma

  9. Studies on the aquatic environment at Olkiluoto and reference area. 1: Olkiluoto, reference lakes and Eurajoki and Lapijoki rivers in 2009-2010

    Energy Technology Data Exchange (ETDEWEB)

    Kangasniemi, V. [Environmental Research and Assessment EnviroCase Ltd., Pori (Finland); Helin, J.


    This working report presents the first results of a sampling campaign at Olkiluoto and reference lakes and rivers selected to resemble the aquatic systems expected to form at the site in the future with the post-glacial crustal rebound (land uplift). In 2009-2010, the aim of the studies was to improve the knowledge of the aquatic systems and to produce input data to the safety case for the spent nuclear fuel repository at Olkiluoto. The first main objective was to estimate the areal biomass distribution and measure the dimensions of characteristic aquatic plants and animals. Another objective was to estimate the transfer of different elements from water to the aquatic organisms paying special attention on key elements (Ag, Cl, I, Mo, Nb and Se) in the dose assessment within the safety case. Surface water, sediment, macrophyte, fish and macrobenthos samples were collected from the Olkiluoto coastal area and from the reference lakes for biomass and dimension measurements and analysis of element concentration. Water-to-biota concentration ratios were estimated for the coastal area and for the reference lakes. From rivers, only water samples were collected at this stage. In 2009-2010, sampling procedures and pre-treatment methods were developed and analytical methods were optimised. Thus, the results reported here are indicative by their nature. After 2010, the studies have been continued with better established methods, and the more recent results will be reported later. (orig.)

  10. Reactive transport predictions for an Olkiluoto. Final repository tunnel unit

    International Nuclear Information System (INIS)

    Luukkonen, A.; Nordman, H.


    The presented hydrogeochemical reactive transport calculations concentrate to a defined unit piece (unit cell) of the planned Olkiluoto repository that is under design for spent nuclear fuel. The material properties assigned to the tunnel unit are based on literature as far as possible. Calculations make up geochemical future scenarios on the repository evolution. Most recent predictions on the potential future climate at Olkiluoto are utilised together with estimates how future hydraulic conditions affect the repository. Two climate scenarios are considered in detail. The Weichselian-R scenario is based on the repetition of the last glacial cycle, while the Emissions-M scenario attempts to predict the future groundwater conditions at Olkiluoto in the situation where the atmospheric greenhouse gasses delay the next glacial cycle at least for 100,000 years. The groundwater compositions, considered active at the repository depth in future, are judged in this study. Several geochemical processes are considered active at the repository depth. Calculations concentrate on the changes occurring with time within the tunnel unit. All simulations are done in geochemically reducing conditions. It turns out that sulphur cycling in these conditions is in central role considering the safety assessment studies of Olkiluoto repository. Furthermore, groundwater salinity and cation occupancy within the exchange sites of montmorillonite contributes to sealing properties of the engineered barrier system. Calculations attempt to estimate effects of possible future scenarios for the Olkiluoto repository. The results indicate that the buffer capacities assigned to the tunnel unit are large enough, at least to next 100,000 years, to maintain dissolved sulphide contents low in the groundwater infiltrating through the tunnel engineered barrier system. Geochemical reactions raise the bicarbonate levels within the groundwater. This is a useful buffer if low pH conditions emerge in the

  11. The analysis of the bedrock deformation in Olkiluoto using precise levelling measurements

    International Nuclear Information System (INIS)

    Saaranen, V.; Rouhiainen, P.; Suurmaeki, H.


    In order to research vertical bedrock deformations in the Olkiluoto area, Posiva Oy and the Finnish Geodetic Institute began monitoring with precise levelling in 2003. At the moment, the measuring plan includes a loop between the monitoring GPS stations around the island, a levelling line from the island to the mainland, levelling loops to ONKALO, the final disposal site, and VLJ, the low and intermediate level waste repository there. The levelling to the mainland has been performed every fourth year and the levelling of the GPS stations every second year. The micro loops (ONKALO and VLJ) have been measured annually. In this report, we use three-step method to research a vertical deformation of the Olkiluoto area. Firstly, the linear deformation rate in the area has been determined by the least squares adjustment of the levelling data. It varies from -0.2 mm/yr to +0.2 mm/yr. Secondly, local deformations have been analysed by comparing the height differences for different years. In this comparison a starting value for the yearly adjustment has been corrected for land uplift. Using this method the elevation changes are relative to the whole network. For a fixed benchmark, we correct its yearly deformation. Thirdly, the fault lines have been analysed by comparing the elevation changes between the successive benchmarks from one observation epoch to another. The results show that ONKALO and Lapijoki are in the subsidence area of the network, and VLJ has small uplift rate. On the island some deformations exist, but elevation difference from 2003 to 2011 is less than one millimetre at every benchmarks. The measurements in the Lapijoki-Olkiluoto line in 2003, 2007 and 2011 show that linear elevation change between the mainland and Olkiluoto island is a little since 2003. The elevation differences, from Olkiluoto to Lapijoki, measured in 2003 and 2011 differ less than one millimetre each other, but the 2007 observation differs three millimetres from the other measurements

  12. Concentration ratios to great cormorant (Phalacrocorax carbo) at Olkiluoto repository site

    Energy Technology Data Exchange (ETDEWEB)

    Kangasniemi, Ville; Ikonen, Ari T.K. [Environmental Research and Assessment EnviroCase, Ltd., Hallituskatu 1 D 4, 28100 Pori (Finland); Haavisto, Fiia [FM Meri and Erae Oy, Seijaistentie 133a, 21230 Lemu (Finland); Salmi, Juhani A. [Finnish Game and Fisheries Research Institute, Itaeinen Pitkaekatu 3, 20520 Turku (Finland)


    Olkiluoto Island on the western coast of Finland has been selected as a repository site for spent nuclear fuel disposal. The great cormorant was a common species in the Finnish coastal area and possibly also a resource for human uses before the decline of the cormorant population in the 18. century. During the last decade, the great cormorant has become again a relevant part of food web in the Bothnian Sea coastal area. Due to the regulatory requirements, the biosphere assessment demonstrating the long-term safety of the repository is developed into more and more site specific. As the adequate literature data on common waterfowl is sparse or in some cases lacking, samples of adult cormorants, eggs and guano together with water and fish samples were collected from the Olkiluoto coastal area. This contribution will present concentration ratios of stable element based on these samples with focus on the elements of a high relevance to the biosphere assessment of the Olkiluoto spent fuel repository together with discussion on the role of food (fish) versus the application of the water-to-bird concentration ratio. (authors)

  13. Ageing study of protection automation components of Olkiluoto nuclear power plant

    International Nuclear Information System (INIS)

    Simola, K.; Haenninen, S.


    A study on ageing of reactor protection system of the Olkiluoto nuclear power plant is described. The objective of the study was to present an ageing analysis approach and apply in to the automation chains of reactor protection system of the Olkiluoto nuclear power plant. The study includes the measuring instrumentation, the protection logics, and the control electronics of some pumps and valves. The analysis is based on the information collected on the structure of the system, environmental conditions and maintenance practices of components, and operating experience. Based on this information, the possible ageing effects of equipment and their safety significance are evaluated. (orig.). (15 refs., 16 figs., 12 tabs.)

  14. Results of monitoring at Olkiluoto in 2007. Environment

    International Nuclear Information System (INIS)

    Haapanen, R.


    This Working Report presents the main results of Posiva Oy's environmental monitoring programme on Olkiluoto Island in 2007. These summary reports have been published since 2005 (target year 2004). The environmental monitoring system supervised by Posiva Oy produces input for biosphere modelling for long-term safety purposes as well as for monitoring the state of the environment during the construction (and later operation) of ONKALO underground characterization facility. Although some of the nuclear power production related monitoring studies by TVO (the power company) have been going on from the 1970s, the repository-related environmental monitoring of Olkiluoto Island has only recently been comprehensive. In the monitoring data, the ongoing construction work (OL3, ONKALO and related infrastructure) is seen for instance in raised noise levels and deposition of base cations and iron. The land-use continues to change, but where there is natural environment, it resembles other coastal locations. The nearby marine environment is affected by the cooling water from the nuclear power plant. (orig.)

  15. Feasibility study and technical proposal for seismic monitoring of tunnel boring machine in Olkiluoto

    Energy Technology Data Exchange (ETDEWEB)

    Saari, J.; Lakio, A. (AF-Consult Ltd, Vantaa (Finland))


    In Olkiluoto, Posiva Oy has operated a local seismic network since February 2002. The purpose of the microearthquake measurements at Olkiluoto is to improve understanding of the structure, behaviour and long term stability of the bedrock. The studies include both tectonic and excavation-induced microearthquakes. An additional task of monitoring is related to safeguarding of the ONKALO. The possibility to excavate an illegal access to the ONKALO, have been concerned when the safeguards are discussed. Therefore all recorded explosions in the Olkiluoto area and in the ONKALO are located. If a concentration of explosions is observed, the origin of that is found out. Also a concept of hidden illegal explosions, detonated at the same time as the real excavation blasts, has been examined. According to the experience gained in Olkiluoto, it can be concluded that, as long the seismic network is in operation and the results are analysed by a skilled person, it is practically impossible to do illegal excavation by blasts. In this report a possibility of seismic monitoring of illegal excavation done by tunnel boring machine (TBM) has been investigated. Characteristics of the seismic signal generated by the raise boring machine are described. According to this study, it can be concluded that the generated seismic signal can be detected and the source of the signal can be located. However, this task calls for different kind of monitoring system than that, which is currently used for monitoring microearthquakes and explosions. The presented technical proposal for seismic monitoring of TBM in Olkiluoto is capable to detect and locate TBM coming outside the ONKALO area about two months before it would reach the ONKALO. (orig.)

  16. Feasibility study and technical proposal for seismic monitoring of tunnel boring machine in Olkiluoto

    International Nuclear Information System (INIS)

    Saari, J.; Lakio, A.


    In Olkiluoto, Posiva Oy has operated a local seismic network since February 2002. The purpose of the microearthquake measurements at Olkiluoto is to improve understanding of the structure, behaviour and long term stability of the bedrock. The studies include both tectonic and excavation-induced microearthquakes. An additional task of monitoring is related to safeguarding of the ONKALO. The possibility to excavate an illegal access to the ONKALO, have been concerned when the safeguards are discussed. Therefore all recorded explosions in the Olkiluoto area and in the ONKALO are located. If a concentration of explosions is observed, the origin of that is found out. Also a concept of hidden illegal explosions, detonated at the same time as the real excavation blasts, has been examined. According to the experience gained in Olkiluoto, it can be concluded that, as long the seismic network is in operation and the results are analysed by a skilled person, it is practically impossible to do illegal excavation by blasts. In this report a possibility of seismic monitoring of illegal excavation done by tunnel boring machine (TBM) has been investigated. Characteristics of the seismic signal generated by the raise boring machine are described. According to this study, it can be concluded that the generated seismic signal can be detected and the source of the signal can be located. However, this task calls for different kind of monitoring system than that, which is currently used for monitoring microearthquakes and explosions. The presented technical proposal for seismic monitoring of TBM in Olkiluoto is capable to detect and locate TBM coming outside the ONKALO area about two months before it would reach the ONKALO. (orig.)

  17. Potential reference mires and lakes ecosystems for biosphere assessment of Olkiluoto site

    International Nuclear Information System (INIS)

    Haapanen, R.; Aro, L.; Kirkkala, T.; Paloheimo, A.; Koivunen, S.; Lahdenperae, A.-M.


    New lakes and mires will develop in the sea area now surrounding Olkiluoto Island due to the postglacial land uplift. The properties of these objects can be forecast using data from existing lakes and mires. There are, however, no such objects on the present Olkiluoto Island. This Working Report presents a project, initiated in 2007, where lakes and mires at different successional stages, suitable as reference objects for the future ones, were searched. The task included delineation of the study area, based on e.g. geological and climatological factors, and development of the selection criteria. As background, development history and properties of present lakes and mires in the study area are described in this report. For this and forthcoming projects, several GIS data sets were acquired. With help of these data, literature and environmental databases, 33 mires and 27 lakes were selected. These were considered to be the best available analogues for the future objects around Olkiluoto Island. The characteristics of these objects are presented briefly; more detailed information is found in the literature and databases. (orig.)

  18. Results of monitoring at Olkiluoto in 2012. Environment

    International Nuclear Information System (INIS)

    Haapanen, A.


    In 2003, Posiva Oy presented a programme for monitoring at Olkiluoto during construction and operation of ONKALO. In 2012 the monitoring programme was updated to concern the years 2012-2018. Part of the monitoring is performed by the company running the nuclear power plants on the island, Teollisuuden Voima Oy (TVO). This Working Report presents the main results of Posiva's environmental monitoring programme on Olkiluoto Island in 2012. Results are presented under five topics: 1. Evolution of geosphere, 2. Biosphere modelling input data, 3. Interaction between surface environment and groundwater in bedrock, 4. Environmental impact and 5. Baseline of monitoring of radioactive releases. Concerning the evolution of geosphere, LIDAR-scannings were done in the Olkiluoto area in 2012. The acquired data can be used for elevation and other modelling purposes. The soil solution quality in 2012 was quite comparable to that in earlier years. Proximity of the sea and the young age of soils are seen in soil solution results. Biosphere modelling input data in 2012 included e.g. continuous tree litterfall and transpiration data, as well as updated game statistics and population estimates of fauna, a fishery survey from the River Eurajoki (2011) and basic monitoring data from Olkiluoto offshore properties. Interaction between surface environment and groundwater in bedrock includes e.g. weather and surface water monitoring data. Environmental impact analyses included e.g. monitoring of noise, air quality, effluent waters and private drilled wells. Noise monitoring in the vicinity of ONKALO showed that in the case of raised noise levels the sources are mainly the traffic on Olkiluodontie road, the air conditioning of ONKALO and occasional sources such as springtime bird sounds. Construction activities in the area were seen in increased amount of NO 3 -N in the bulk deposition, and Al and Fe accumulating on needle surfaces in areas close to the rock piling and crushing area. Scots

  19. Results of monitoring at Olkiluoto in 2012. Environment

    Energy Technology Data Exchange (ETDEWEB)

    Haapanen, A. (ed.) [Haapanen Forest Consulting, Vanhakylae (Finland)


    In 2003, Posiva Oy presented a programme for monitoring at Olkiluoto during construction and operation of ONKALO. In 2012 the monitoring programme was updated to concern the years 2012-2018. Part of the monitoring is performed by the company running the nuclear power plants on the island, Teollisuuden Voima Oy (TVO). This Working Report presents the main results of Posiva's environmental monitoring programme on Olkiluoto Island in 2012. Results are presented under five topics: 1. Evolution of geosphere, 2. Biosphere modelling input data, 3. Interaction between surface environment and groundwater in bedrock, 4. Environmental impact and 5. Baseline of monitoring of radioactive releases. Concerning the evolution of geosphere, LIDAR-scannings were done in the Olkiluoto area in 2012. The acquired data can be used for elevation and other modelling purposes. The soil solution quality in 2012 was quite comparable to that in earlier years. Proximity of the sea and the young age of soils are seen in soil solution results. Biosphere modelling input data in 2012 included e.g. continuous tree litterfall and transpiration data, as well as updated game statistics and population estimates of fauna, a fishery survey from the River Eurajoki (2011) and basic monitoring data from Olkiluoto offshore properties. Interaction between surface environment and groundwater in bedrock includes e.g. weather and surface water monitoring data. Environmental impact analyses included e.g. monitoring of noise, air quality, effluent waters and private drilled wells. Noise monitoring in the vicinity of ONKALO showed that in the case of raised noise levels the sources are mainly the traffic on Olkiluodontie road, the air conditioning of ONKALO and occasional sources such as springtime bird sounds. Construction activities in the area were seen in increased amount of NO{sub 3}-N in the bulk deposition, and Al and Fe accumulating on needle surfaces in areas close to the rock piling and crushing area

  20. Safety analysis of disposal of decommissioning waste from the Olkiluoto nuclear power plant - PURKU-93

    International Nuclear Information System (INIS)

    Vieno, T.; Meszaros, F.; Nordman, H.; Taivassalo, V.


    Decommissioning waste from the Olkiluoto nuclear power plant will be disposed of at the depth between 60 and 100 meters in the bedrock at the power plant site. The existing VLJ repository for low and medium level operating waste will be extended with three new silos for the decommissioning waste of the TVO I and II reactors and the spent fuel interim store at the Olkiluoto site. Besides dismantling waste also used fuel boxes, control rods and other activated metal components accumulated during the operation of the reactors will be disposed of in the repository. The safety analysis is based on the detailed decommissioning plan of the Olkiluoto power plants and the comprehensive safety analysis carried out for the Final Safety Analysis Report of the VLJ repository. (58 refs., 31 figs., 38 tabs.)

  1. Local seismic network at the Olkiluoto site. Annual report 2002-2004

    Energy Technology Data Exchange (ETDEWEB)

    Saari, J. [Enprima Oy, Vantaa (Finland)


    In Olkiluoto, Posiva Oy has operated a local seismic network since February 2002. In the beginning, the network consisted of six seismic stations. Later, in June 2004, the seismic network was expanded with two new seismic stations. At that time started the excavation of the underground characterisation facility (the ONKALO) and the basic operation procedure was changed more suitable for the demands of the new situation. The purpose of the microearthquake measurements at Olkiluoto is to improve understanding of the structure, behaviour and long term stability of the bedrock. The studies include both tectonic and excavation-induced microearthquakes. An additional task of monitoring is related to safeguarding of the ONKALO. This report gives the results of microseismic monitoring during the years 2002 - 2004. Also the changes in the structure and the operation procedure of the network are described. The network has operated nearly continuously. The longest interruption occurred 16.-17.6.2004, when two new seismic stations were installed in the network and the operation procedure was changed. Altogether 757 events have been located in the Olkiluoto area. The magnitudes of the observed events range from ML = -3.5 to ML = 1.2. All of them are explosions or other artificial events. So far, none of the 757 observed events can be classified as microearthquakes. Five of the events have characteristics that make the origin of the recorded signal uncertain. They are quite unlikely microearthquakes, but they are not typical examples of artificial seismic signals either. When the experience and the data set of the Olkiluoto microearthquakes increase the identification of events will be more definite. Evidence of activity that would has influence on the safety of the ONKALO, have not found. (orig.)

  2. Local seismic network at the Olkiluoto site. Annual report 2002-2004

    International Nuclear Information System (INIS)

    Saari, J.


    In Olkiluoto, Posiva Oy has operated a local seismic network since February 2002. In the beginning, the network consisted of six seismic stations. Later, in June 2004, the seismic network was expanded with two new seismic stations. At that time started the excavation of the underground characterisation facility (the ONKALO) and the basic operation procedure was changed more suitable for the demands of the new situation. The purpose of the microearthquake measurements at Olkiluoto is to improve understanding of the structure, behaviour and long term stability of the bedrock. The studies include both tectonic and excavation-induced microearthquakes. An additional task of monitoring is related to safeguarding of the ONKALO. This report gives the results of microseismic monitoring during the years 2002 - 2004. Also the changes in the structure and the operation procedure of the network are described. The network has operated nearly continuously. The longest interruption occurred 16.-17.6.2004, when two new seismic stations were installed in the network and the operation procedure was changed. Altogether 757 events have been located in the Olkiluoto area. The magnitudes of the observed events range from ML = -3.5 to ML = 1.2. All of them are explosions or other artificial events. So far, none of the 757 observed events can be classified as microearthquakes. Five of the events have characteristics that make the origin of the recorded signal uncertain. They are quite unlikely microearthquakes, but they are not typical examples of artificial seismic signals either. When the experience and the data set of the Olkiluoto microearthquakes increase the identification of events will be more definite. Evidence of activity that would has influence on the safety of the ONKALO, have not found. (orig.)

  3. Operation set for 2018 as regulator considers olkiluoto-3 licence application

    Energy Technology Data Exchange (ETDEWEB)

    Kraev, Kamen [NucNet, Brussels (Belgium)


    Finland has announced progress with its delayed nuclear project and has confirmed it will not be affected by anomalies discovered in some components manufactured for EPRs in France. The Olkiluoto-3 European Pressurised Reactor (EPR) nuclear plant under construction in Finland is on schedule to begin commercial operation in 2018 with the country's regulator preparing a safety assessment that will pave the way for fuel loading. Jouni Silvennoinen, senior vice-president for Olkiluoto-3 at Teollisuuden Voima Oyj (TVO), told NucNet that fuel loading at the EPR plant, which is nine years behind schedule, is expected in the spring of 2018. He said construction and licensing of the plant are progressing.

  4. Modelling of the in situ stress state at Olkiluoto Site, Western Finland

    International Nuclear Information System (INIS)

    Valli, J.; Kuula, H.; Hakala, M.


    In order to determine the interaction of in situ stress and geological features at Olkiluoto with the ONKALO area under more specific focus, stress modelling work was launched in 2009. This entailed updating a previously used model geometry to suit current needs whilst also updating interpreted brittle deformation zones according to the data provided by Posiva in the beginning of 2010. The previous model geometry was originally used for seismic and glacial load simulations. Brittle deformation zones were updated in the model according to a new selection criterion which added a number of brittle deformation zones. Changes in the geometry of certain brittle deformation zones were also necessary to better fit the early 2010 interpretations from Posiva. Modelling goals were to clarify the effect of joint parameters on stress magnitude and orientation and which of the major brittle deformation zones detected in the ONKALO region could have potential effects on local in situ stress states. Additional goals included modelling the effect of several optional thrust boundary conditions and an ice-age. Compression from the northwest-southeast was used as the default approach whilst north-south, east-west and northeast-southwest were optional conditions. A simplified glaciation cycle was also simulated. Results were clear in demonstrating the critical effect of joint cohesion and joint friction angle, i.e. shear strength, on stress-geology interaction, essentially in this order of importance. The case that utilised both drillhole core-logging and ONKALO tunnel mapping results did not exhibit much if any stress-geology interactions as BFZ strength parameters were too high in order to allow any interactions to occur. The geometry and orientation of brittle deformation zones was found to be of significant importance; deformation zones with a shallow dip roughly in the direction of applied compression were optimal for causing stress rotations and the increase of stress magnitude

  5. Models of bedrock surface and overburden thickness over Olkiluoto island and nearby sea area

    Energy Technology Data Exchange (ETDEWEB)

    Moenkkoenen, H. [WSP Finland Oy, Helsinki (Finland)


    In this report, a model of bedrock surface and a model of overburden thickness over the Olkiluoto Island and the nearby sea area are presented. Also in purpose to produce material for biosphere and radionuclide transport modelling, stratigraphy models of different sediment layers were created at two priority areas north and south of the Olkiluoto Island. The work concentrated on the collection and description of available data of bedrock surface and overburden thickness. Because the information on the bedrock surface and overburden is collected from different sources and is based on a number of types of data the quality and applicability of data sets varies. Consequently also the reliability in different parts of the models varies. Input data for the bedrock surface and overburden thickness models include 2928 single points and additional outcrops observations (611 polygons) in the modelled area. In addition, the input data include 173 seismic refraction lines (6534 points) and acousticseismic sounding lines (26655 points from which 13721 points are located in model area) in the Olkiluoto offshore area. The average elevation of bedrock surface in area is 2.1 metres above the sea level. The average thickness of overburden is 2.5 metres varying typically between 2 - 4 metres. Thickest overburden covers (approximately 16 metres) of terrestrial area are located at the western end of the Olkiluoto Island and in sea basin south of the island. (orig.)

  6. Models of bedrock surface and overburden thickness over Olkiluoto island and nearby sea area

    International Nuclear Information System (INIS)

    Moenkkoenen, H.


    In this report, a model of bedrock surface and a model of overburden thickness over the Olkiluoto Island and the nearby sea area are presented. Also in purpose to produce material for biosphere and radionuclide transport modelling, stratigraphy models of different sediment layers were created at two priority areas north and south of the Olkiluoto Island. The work concentrated on the collection and description of available data of bedrock surface and overburden thickness. Because the information on the bedrock surface and overburden is collected from different sources and is based on a number of types of data the quality and applicability of data sets varies. Consequently also the reliability in different parts of the models varies. Input data for the bedrock surface and overburden thickness models include 2928 single points and additional outcrops observations (611 polygons) in the modelled area. In addition, the input data include 173 seismic refraction lines (6534 points) and acousticseismic sounding lines (26655 points from which 13721 points are located in model area) in the Olkiluoto offshore area. The average elevation of bedrock surface in area is 2.1 metres above the sea level. The average thickness of overburden is 2.5 metres varying typically between 2 - 4 metres. Thickest overburden covers (approximately 16 metres) of terrestrial area are located at the western end of the Olkiluoto Island and in sea basin south of the island. (orig.)

  7. Geophysical investigations in the Olkiluoto area, Finland

    International Nuclear Information System (INIS)

    Heikkinen, E.; Paananen, M.


    Investigations were carried out at the Olkiluoto site at Eurajoki using geological, geophysical, geohydrological and geochemical methods in 1987-1992 to determine the suitability of the bedrock for the final disposal of spent nuclear fuel. In this survey airborne, ground and borehole geophysical methods were used to study the rock type distribution, fracturing and hydraulic conductivity of the bedrock to a depth of one kilometre

  8. The use of gamma spectrometry in mapping alteration zones in Olkiluoto

    International Nuclear Information System (INIS)

    Ojala, J.V.; Turunen, P.; Eilu, P.; Julkunen, A.; Gehoer, S.


    In the Olkiluoto site, a detailed gammaspectrometry log from the drill hole OL-KR27 was used to estimate the concentrations of K, Th and U. The gamma spectrometry results, lithological variations, and kaolinite and illite alteration visually mapped from the drill hole were compared. The result indicate that the Th/K ratio correlates best with lithology and that, in most cases, the changes in the ratio indicate lithological contacts and rising or falling trends of Th/K ratio with some peaks have some correlation with the kaolinite-illite alteration. From the result it is suggested that that very variable Th/K ratio is a reasonably good indicator of alteration zones even in the migmatic gneiss area in the Olkiluoto site. (orig.)

  9. Geological setting of the Olkiluoto investigation site, Eurajoki, SW Finland. Excursion guidebook

    International Nuclear Information System (INIS)

    Paulamaeki, S.


    Olkiluoto is an island of ca. 10 km 2 in area on the coast of the Botnian Bay and separated from the mainland by a narrow strait. The Olkiluoto nuclear power plant, with two reactors in operation and a third one under construction, and the underground repository for low and intermediate waste are located in the western part of the island. The repository for spent fuel will be constructed in the central part of the island at a depth of between 400 and 600 m. The suitability of Olkiluoto as a location for a spent fuel repository has been investigated over a period of 20 years by means of extensive ground- and air-based methods and shallow and deep drillings. In a regional context, Olkiluoto is located within a bedrock area, covering approximately 800 million years of geological history of the Precambrian Fennoscandian Shield. The oldest part of the bedrock consists of supracrustal, metasedimentary and metavolcanic rocks deformed and metamorphosed during the Palaeoproterozoic Svecofennian orogeny ca. 1900-1800 million years ago. They are mostly migmatised, high-grade metamorphic mica gneisses, containing cordierite, sillimanite or garnet porphyroblasts. Plutonic rocks consisting of trondhjemites, tonalites, granodiorites, coarse-grained granites and pegmatites intrude the supracrustal rocks. The Mesoproterozoic anorogenic Laitila rapakivi batholith, dated at 1583 ±3 Ma, is located in the central part of the region. The Eurajoki rapakivi stock, located 5 km east of Olkiluoto, is a satellite massif to the Laitila batholiths. After the rapakivi magmatism the geological evolution of the area continued with the deposition of the Satakunta sandstone. The upper parts of the sandstone were deposited ca. 1400-1300 Ma ago, but the development of the sedimentation basin (graben) may have begun already during the rifting period, ca. 1650 Ma ago, associated with the intrusion of the rapakivi magma. The sandstone and older rocks are cut by olivine diabase dykes and sills 1270

  10. Game statistics for the island of Olkiluoto in 2009-2010

    Energy Technology Data Exchange (ETDEWEB)

    Nieminen, M. (Faunatica Oy, Espoo (Finland))


    The game statistics for the island of Olkiluoto were updated in the spring 2010, and compared with earlier studies. Population size estimates are based on interviews of local hunters, and on other material available. No elk nor deer inventories were made in the winter 2009-2010. The elk population is still slightly decreasing. The white-tailed deer population was made smaller by hunting. The changes in the roe deer population are not known accurately, but population size varies somewhat from year to year. The number of hunted small predators approximately doubled in the latest hunting season. Altogether 17 waterfowl were hunted in 2009 (none in the previous year). The populations of mountain hare and red squirrel are abundant. The brown hare population is still small, even though there was one brood in Olkiluoto in 2009. (orig.)

  11. Game statistics for the island of Olkiluoto in 2009-2010

    International Nuclear Information System (INIS)

    Nieminen, M.


    The game statistics for the island of Olkiluoto were updated in the spring 2010, and compared with earlier studies. Population size estimates are based on interviews of local hunters, and on other material available. No elk nor deer inventories were made in the winter 2009-2010. The elk population is still slightly decreasing. The white-tailed deer population was made smaller by hunting. The changes in the roe deer population are not known accurately, but population size varies somewhat from year to year. The number of hunted small predators approximately doubled in the latest hunting season. Altogether 17 waterfowl were hunted in 2009 (none in the previous year). The populations of mountain hare and red squirrel are abundant. The brown hare population is still small, even though there was one brood in Olkiluoto in 2009. (orig.)

  12. Interpretation of aeromagnetic survey in Eurajoensalmi, Olkiluoto (2008)

    International Nuclear Information System (INIS)

    Oehman, I.; Ahokas, T.; Lahti, M.


    In 2001, Olkiluoto was selected as the site for the final disposal of spent nuclear waste in Finland. Current construction of the underground research facility, ONKALO, is occurring at the Olkiluoto site. During the past three decades, detailed geological and geophysical investigations have been carried out on Olkiluoto Island and in the Olkiluoto vicinity in order to define its bedrock properties and structures that affect the final nuclear waste disposal. In April 2008, a high resolution aeromagnetic survey was carried out in the Eurajoensalmi inlet in order to investigate the sea and coastal areas north and west of Eurajoensalmi. Measured parameter was total magnetic field. The main goal of the survey was to improve the magnetic image of Eurajoensalmi area, to locate the area's most significant magnetic features, and by magnetic modelling find the best geological explanations for them. Some preliminary lineament interpretations were also performed to compare the accuracy of location data between lineaments interpreted in earlier surveys versus the new 2008 data. Data acquired during earlier magnetic surveys was used as reference data. Interpretation was conducted using measured total magnetic field, derivatives computed from the total field and various visualisation techniques. Comparison of data from the 1988 aeromagnetic survey conducted by GTK and the 2008 survey proves that a more detailed survey configuration sharpens anomalies and increases reliability in the interpretation of subtle features. Positioning techniques have improved significantly since the 1980's, which improves positioning accuracy and increases consistency. It can be concluded that the 2008 data is significantly more detailed and brings interpretation to a new level. Four areas, including well known bedrock structures HZ21, which corresponds to brittle deformation zone OL-BFZ002, and Liikla and Selkaenummi shear zones, were modelled. Modelling was intentionally kept relatively simple using

  13. Geomicrobial investigations of groundwaters from Olkiluoto, Haestholmen, Kivetty and Romuvaara, Finland

    Energy Technology Data Exchange (ETDEWEB)

    Haveman, S.A.; Pedersen, K. [Goeteborg Univ. (Sweden); Ruotsalainen, P. [Fintact Oy, Helsinki (Finland)


    Groundwater from four deep hard rock sites being considered for nuclear waste disposal in Finland (Olkiluoto, Haestholmen, Kivetty and Romuvaara) were investigated for microbial populations. Bacteria will be present in a waste disposal vault, so it is important to understand the microbiology of any potential site. Groundwater samples were collected from 200 to 950 m depth and included fresh, brackish and saline waters. Samples were collected with a pressurized groundwater sampler, PAVE, which is an excellent tool for microbiological sampling. Total cell numbers were typical for deep groundwater, 105 to 106 cells/ml. Growth media designed using groundwater chemistry data were used for enumeration of methanogens, acetogens, sulfate reducing bacteria (SRB) and iron reducing bacteria (IRB). Microbial populations varied between sites. Iron sulfide fracture minerals are common in the brackish high sulfate groundwaters of Olkiluoto, where SRB predominated. Haestholmen groundwater has high dissolved iron, iron hydroxide fracture minerals and IRB were the main microbial population. Kivetty and Romuvaara had mixed populations. It has been proposed that deep subsurface ecosystems are based on hydrogen and carbon dioxide which provide energy and carbon to support the food chain. Signs of such an ecosystem were seen in Olkiluoto. More study is needed to understand the basis for deep subsurface life. From a microbiological point of view, all sites investigated are equally suitable for nuclear waste disposal. (orig.) 66 refs.

  14. Geomicrobial investigations of groundwaters from Olkiluoto, Haestholmen, Kivetty and Romuvaara, Finland

    International Nuclear Information System (INIS)

    Haveman, S.A.; Pedersen, K.; Ruotsalainen, P.


    Groundwater from four deep hard rock sites being considered for nuclear waste disposal in Finland (Olkiluoto, Haestholmen, Kivetty and Romuvaara) were investigated for microbial populations. Bacteria will be present in a waste disposal vault, so it is important to understand the microbiology of any potential site. Groundwater samples were collected from 200 to 950 m depth and included fresh, brackish and saline waters. Samples were collected with a pressurized groundwater sampler, PAVE, which is an excellent tool for microbiological sampling. Total cell numbers were typical for deep groundwater, 105 to 106 cells/ml. Growth media designed using groundwater chemistry data were used for enumeration of methanogens, acetogens, sulfate reducing bacteria (SRB) and iron reducing bacteria (IRB). Microbial populations varied between sites. Iron sulfide fracture minerals are common in the brackish high sulfate groundwaters of Olkiluoto, where SRB predominated. Haestholmen groundwater has high dissolved iron, iron hydroxide fracture minerals and IRB were the main microbial population. Kivetty and Romuvaara had mixed populations. It has been proposed that deep subsurface ecosystems are based on hydrogen and carbon dioxide which provide energy and carbon to support the food chain. Signs of such an ecosystem were seen in Olkiluoto. More study is needed to understand the basis for deep subsurface life. From a microbiological point of view, all sites investigated are equally suitable for nuclear waste disposal. (orig.)

  15. Seismic network at the Olkiluoto site and microearthquake observations in 2002-2013

    International Nuclear Information System (INIS)

    Saari, J.; Malm, M.


    This report describes the structure and operation of Posiva's seismic network after the comprehensive upgrade performed in 2013 and presents a summary of its micro-earthquake observations in 2002 - 2013. Excavation of the underground rock characterisation facility called ONKALO started in 2004. Before that, in February 2002, Posiva Oy established a local seismic network of six stations on the island of Olkiluoto. The number of seismic stations has increased gradually and communication, hardware and software have developed in over ten years. The upgrade in 2013 included data transmission, the equipment in several seismic stations, the server responsible for the data processing in Olkiluoto and software applied in operation and analysis of observations. After the upgrade Posiva's permanent seismic network consists of 17 seismic stations and 21 triaxial sensors. The purpose of the microearthquake measurements at Olkiluoto is to improve understanding of the structure, behaviour and long term stability of the bedrock. The investigation area includes two target areas, of which the larger one, the seismic semi-regional area, includes the Olkiluoto island and its surroundings. The aim is to monitor explosions and tectonic earthquakes in regional scale inside that area. All the expected excavation induced events are assumed to occur inside the smaller target area, the seismic ONKALO block, which is a 2 km x 2 km x 2 km cube surrounding the ONKALO. An additional task of monitoring is related to safeguarding of the construction of the ONKALO.In the beginning the network monitored tectonic earthquakes in order to characterise the undisturbed baseline of seismicity in Olkiluoto. After August 2004, the network also monitored excavation induced seismicity. The first three excavation induced earthquakes were recorded in September 2005. At the moment the total number of excavation induced earthquakes is 17. During the same time about 10 000 excavation blasts were located. The

  16. Olkiluoto site description 2008. Part 1

    International Nuclear Information System (INIS)


    This third version of the Olkiluoto Site Report, produced by the OMTF (Olkiluoto Modelling Task Force), updates the Olkiluoto Site Report 2006 (Andersson et al. 2007) with the data and knowledge obtained up to December 2007. The main product of the modelling has been to develop an updated version of the descriptive model of the site (the Site Descriptive Model), i.e. a model describing the geometry, properties of the bedrock and the water and the associated interacting processes and mechanisms. The Site Descriptive Model is divided into six parts: the surface system, geology, rock mechanics, hydrogeology, hydrogeochemistry and migration, which are presented in individual chapters. Five separated models are presented: the geological, rock mechanics, hydrogeological, hydrogeochemical and migration models. The main advances since Site Report 2006 are: (1) The geological model has been revised according to new data and interpretations. This has improved the consistency between the locations of the deformation zones in the geological model and the hydraulic zones in the hydrogeological model, (2) New 3D seismic data have been incorporated within the geological model and an initial model for the eastern part of the Island is presented. Site-scale brittle deformation zones are extrapolated to intersect the surrounding regional lineaments, unless prohibited by direct observations to the contrary. The alteration model has been revised, showing a clear correspondence between the illitisation and the sitescale fault zones, (3) A first account of the development of the brittle deformation history of the site is provided, (4) A new geological DFN model has been developed, that considers mapped fracture traces from both the surface and the ONKALO, (5) A new stress state model and fracture and fracture zone properties are presented, (6) A new hydrogeological DFN model has been developed, (7) An updated site scale (EPM) flow model has been developed, (8) There has been an

  17. Modelling end-glacial earthquakes at Olkiluoto

    International Nuclear Information System (INIS)

    Faelth, B.; Hoekmark, H.


    The objective of this study is to obtain estimates of the possible effects that post-glacial seismic events in three verified deformation zones (BFZ100, BFZ021/099 and BFZ214) at the Olkiluoto site may have on nearby fractures in terms of induced fracture shear displacement. The study is carried out by use of large-scale models analysed dynamically with the three dimensional distinct element code 3DEC. Earthquakes are simulated in a schematic way; large planar discontinuities representing earthquake faults are surrounded by a number of smaller discontinuities which represent rock fractures in which shear displacements potentially could be induced by the effects of the slipping fault. Initial stresses, based on best estimates of the present-day in situ stresses and on state-of-the-art calculations of glacially-induced stresses, are applied. The fault rupture is then initiated at a pre-defined hypocentre and programmed to propagate outward along the fault plane with a specified rupture velocity until it is arrested at the boundary of the prescribed rupture area. Fault geometries, fracture orientations, in situ stress model and material property parameter values are based on data obtained from the Olkiluoto site investigations. Glacially-induced stresses are obtained from state-of-the-art ice-crust/mantle finite element analyses. The response of the surrounding smaller discontinuities, i.e. the induced fracture shear displacement, is the main output from the simulations

  18. Microbiology of transitional groundwater of the porous overburden and underlying shallow fractured bedrock aquifers in Olkiluoto, Finland. October 2005 - January 2006

    International Nuclear Information System (INIS)

    Pedersen, K.


    The subsurface biosphere on Earth appears to be far more expansive and metabolically and phylogenetically complex than previously thought. A diverse suite of subsurface environments has been reported to support microbial ecosystems, extending from a few meters below the surface to several thousand meters. The discovery of a deep biosphere will have several important implications for underground repositories for radioactive wastes. The main potential effects of microorganisms in the context of a KBS-3 type repository for spent fuel in the bedrock of Olkiluoto are: (1) Oxygen reduction and maintenance of anoxic and reduced conditions. (2) Bio-immobilisation and bio-mobilisation of radionuclides, and the effects from microbial metabolism on radionuclide mobility. (3) Sulphate reduction to sulphide and the risk for copper sulphide corrosion. The main objective of this study was to characterize the geochemistry, biomass and microbial diversity of shallow subsurface groundwater at Olkiluoto, from 4.0 m down to 14.9 m. This objective also permitted the determination of whether or not there is any transition in the shallow depths at Olkiluoto to microbial conditions associated with the deep subsurface. This was the second investigation that covered both shallow and some moderately deep groundwater microbiology in Olkiluoto. The analysis of microbiology is very important for proper understanding of the evolution of geochemical processes in and around the underground research facility ONKALO being constructed at Olkiluoto by Posiva since autumn 2004, as well as for the planned KBS-3 type spent fuel repository at Olkiluoto. There are several conclusions from this investigation that are of importance for ONKALO. The following present day conclusions can be drawn. Continued investigations will update and test them: The shallow biosphere was dominated by oxygen consuming microorganisms that block oxygen migration to deeper groundwater. This effect was most pronounced during the

  19. Precise levelling campaigns at Olkiluoto in 2012-2013

    International Nuclear Information System (INIS)

    Saaranen, V.; Rouhiainen, P.


    In order to research vertical bedrock deformations in the Olkiluoto area, Posiva Oy and the Finnish Geodetic Institute began monitoring with precise levelling in 2003. At the moment, the measuring plan includes a loop between the GPS stations around the island, a levelling line from the island to the mainland, levelling loops over the ONKALO, the characterization facility for the final disposal of spent nuclear fuel, and VLJ, the low and intermediate level waste repository. The levelling to the mainland has been performed every fourth year and the levelling of the GPS stations every second year. The micro loops (ONKALO and VLJ) have been measured annually. In this report, we present the Olkiluoto levelling observations, performed in 2012 and 2013. Local deformations have been analysed by comparing the height differences for different years. In the Olkiluoto strait area, the height changes from 2011 to 2012 were within ± 0.1 mm. In the GPS station loop, in 2011-2013, the height of benchmark (BM) GPS3 changed + 0.69 mm. It is the only benchmark, which height has changed more than one millimetre from the year 2003. Second largest deformation happened at GPS1. Its height changed - 0.49 mm from 2011 to 2013. In the ONKALO loop, largest height change, from 2011 to 2012 was - 0.37 mm. From 2012 to 2013, the largest height changes was - 0.4 mm. In the VLJ loop, the most active deformation is related to the control benchmarks of GPS9. In 2012, these benchmarks were 0.6 mm lower level than 2011. From 2012 to 2013, both benchmarks rebounded so that deformation from 2011 to 2013 is - 0.38 mm. The other benchmarks have deformation within ± 0.11 mm, from 2011 to 2013. In 2011, a new GPS station GPS16 was established. The GPS station has three control benchmarks on bedrock and one benchmark is part of a pillar. The height of the control benchmark fastened to pillar changed one millimetre, from 2011 to 2013, relative to the control benchmarks on bedrock. (orig.)

  20. Biosphere analysis - a complementary assessment of dose conversion factors for the Olkiluoto site

    International Nuclear Information System (INIS)

    Kylloenen, J.; Keto, V.


    The Olkiluoto site is currently the primary candidate for the final disposal site for spent nuclear fuel from the Olkiluoto and Loviisa NPPs. Safety analysis calculations must be performed to verify the compliance with the long-term safety requirements. The behaviour and distribution of radionuclides in the biosphere is of high importance in these calculations. The aim of this study was to perform a complementary assessment of dose conversion factors for the Olkiluoto site. Posiva has performed extensive analysis on the different ecosystems. In this work the biosphere analysis model of Fortum Nuclear Services (FNS) is used to give an independent estimate of biosphere dose conversion factors for the Olkiluoto site. The following nuclides are analysed: Cl-36, Ni-59, Se-79, Mo-93, Nb-94, Sn-126, I-129 and Cs-135. The FNS model is an equilibrium compartment model in which a steady annual release of 1 Bq of each radionuclide is distributed in different scenarios. The scenarios are the well scenario, which models a small agricultural ecosystem, the lake scenario which models a larger ecosystem with both agriculture and lake use, and sea and transition scenario, which models the behaviour of the radionuclides in marine environments. The scenarios are described and the transfer equations written for the lake scenario. The parameter values are taken from the FNS biosphere database, which has been used in the Finnish L/ILW waste repository safety analyses since mid 1990's. The results of the FNS analysis are compared to those presented in Posiva working report 2000-20 (POSIVA-WR-00-20). The results are of the same order of magnitude for all nuclides except I-129. Since the Posiva and FNS models were independently constructed, the results can be considered as convincing, and the compliance of the results give confidence to the modelling results. (orig.)

  1. Local seismic network at the Olkiluoto site. Annual report for 2013

    International Nuclear Information System (INIS)

    Saari, J.; Malm, M.


    This report gives the results of microseismic monitoring during 2013. Excavation of the underground rock characterisation facility called ONKALO started in 2004. Before that, in February 2002, Posiva Oy established a local seismic network of six stations on the island of Olkiluoto, where there are currently 17 seismic stations and 21 triaxial sensors. The network has operated continuously in 2013. The purpose of the microearthquake measurements at Olkiluoto is to improve understanding of the structure, behaviour and long term stability of the bedrock. The investigation area includes two target areas, of which the larger one, the seismic semiregional area, includes the Olkiluoto island and its surroundings. The purpose is to monitor explosions and tectonic earthquakes in regional scale inside that area. All the expected excavation induced events are assumed to occur inside the smaller target area, the seismic ONKALO block, which is a 2 km x 2 km x 2 km cube surrounding the ONKALO and includes 13 seismic stations. An additional task of monitoring is related to safeguarding of the construction of ONKALO. Upgrade and unification of the whole seismic network was done in August 2013. The upgrade included communication, data acquisition, server equipment in Olkiluoto, network configuration and software. The bedrock models and the ONKALO design model applied in the visualisation of the seismicity remained the same in 2013. The number of located events was much smaller than during previous years due to break in the excavation. Altogether 436 events have been located in the Olkiluoto area, in the reported time period. Nearly half of the observed explosions (237) in 2013 occurred inside the seismic semi-regional area and especially inside the seismic ONKALO block (137). The magnitudes of the explosions inside the semi-regional area range from M L = -1.6 to M L = 1.5 (M L = magnitude in local Richter's scale). One small induced earthquake (ML = -1.8) was detected on 9 May 2013

  2. Local seismic network at the Olkiluoto site. Annual Report for 2007

    International Nuclear Information System (INIS)

    Saari, J.; Lakio, A.


    In February 2002, Posiva Oy established a local seismic network of six stations on the island of Olkiluoto. Later, in June 2004, the seismic network was expanded with two new seismic stations. At that time started the excavation of the underground characterisation facility (the ONKALO) and the basic operation procedure was changed more suitable for the demands of the new situation. In the beginning of 2006, the target area of the seismic monitoring expanded to semiregional scale. Four new seismic stations started in the beginning of February 2006 and the focus of interpretation was expanded to an area, called the seismic semi-regional area. At the end of 2006, two new borehole geophones were installed in order to improve the sensitivity and the depth resolution of the measurements inside the ONKALO block. The purpose of the microearthquake measurements at Olkiluoto is to improve understanding of the structure, behaviour and long term stability of the bedrock. The studies include both tectonic and excavation-induced microearthquakes. An additional task of monitoring is related to safeguarding of the ONKALO. This report gives the results of microseismic monitoring during the year 2007. Also the changes in the structure and the operation procedure of the network are described. The true orientation of the borehole sensor OL-OS13 was calculated. The correct orientation of triaxial seismometer is essential when the fault plane solution of an earthquake is calculated. The other borehole sensor OL-OS14 was permanently disconnected in October 2007. The network has operated continuously in 2007. Altogether 2207 events have been located in the Olkiluoto area, in reported time period. Altogether 2207 events have been located in 2007. Most of them (1912) are explosions occurred inside the seismic semiregional area and especially inside the ONKALO block (1891 events). The magnitudes of the observed events inside the semi-regional area range from ML = -2.1 to ML = 1.5 (ML

  3. Refraction seismic surveys in the investigation trench TK3 area in Olkiluoto, Eurajoki 2004

    Energy Technology Data Exchange (ETDEWEB)

    Ihalainen, M. [Suomen Malmi Oy, Espoo (Finland)


    Posiva Oy submitted an application for the Decision in Principle to the Finnish Government in May 1999. A positive decision was made at the end of 2000 by the Government. The Finnish Parliament ratified the Decision in Principle on the final disposal facility for spent nuclear fuel at Olkiluoto, Eurajoki in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, the ONKALO, will be constructed. As a part of the investigations Suomen Malmi Oy (Smoy) conducted refraction seismic surveys at Olkiluoto site in Eurajoki. The work was ordered by Posiva Oy. The field work was carried out during May and June 2004. On five profiles S70-S74 totally 1002.5 m was surveyed. The purpose of the work was to determine the overburden thickness and to study bedrock properties, e.g. eventual fractured zones. The work consisted of staking, levelling, seismic measurements, interpretation and reporting. Fieldwork and interpretation were concluded by May and June 2004. Previously in 2000 and 2002 Smoy has carried out 33.0 km of seismic surveys in the area. (orig.)

  4. Detection of environmental change using hyperspectral remote sensing at Olkiluoto repository site

    International Nuclear Information System (INIS)

    Tuominen, J.; Lipping, T.


    In this report methods related to hyperspectral monitoring of Olkiluoto repository site are described. A short introduction to environmental remote sensing is presented, followed by more detailed description of hyperspectral imaging and a review of applications of hyperspectral remote sensing presented in the literature. The trends of future hyperspectral imaging are discussed exploring the possibilities of long-wave infrared hyperspectral imaging. A detailed description of HYPE08 hyperspectral flight campaign at the Olkiluoto region in 2008 is presented. In addition, related pre-processing and atmospheric correction methods, necessary in monitoring use, and the quality control methods applied, are described. Various change detection methods presented in the literature are described, too. Finally, a system for hyperspectral monitoring is proposed. The system is based on continued hyperspectral airborne flight campaigns and precisely defined data processing procedure. (orig.)

  5. EDZ09 project and related EDZ studies in ONKALO 2008-2010

    Energy Technology Data Exchange (ETDEWEB)

    Mellanen, S. [Genpro Solutions Oy, Helsinki (Finland); Lehtimaeki, T. [Svensk Kaernbraenslehantering AB, Stockholm (Sweden); Heikkinen, E. [Poeyry Finland Oy, Espoo (Finland) Water and Environment; Mustonen, S.; Norokallio, J.


    The EDZ (Excavation Damaged Zone) is one of the issues in the evaluation of the long term safety concerning the underground rock surfaces of the final disposal facility. There have been various research and development tasks relating to the EDZ (among other items the EDZ300 Project) completed both before starting the excavation of the ONKALO underground facility and during the construction work. The EDZ09 Project was established to improve the drill and blast excavation method to control the EDZ and to verify the feasibility of Ground Penetrating Radar as a characterisation tool for the EDZ. The project was divided into two parts: Work Package (WP1), which managed the control of the excavation; and Work Package 2 (WP2), which concentrated on the geophysical tests. Long term safety issues were not included into EDZ09 Project. The project work was undertaken in a specific EDZ niche (Tutkimustila 3, ONK-TKU- 3620) with Work Package 1 being concerned with the research niche excavation and Work Package 2 with activities conducted in the niche. In Work Package 2 (WP2), a series of investigations under controlled conditions for EDZ assessment was conducted before and after the excavation. These measurements were performed in drillholes and on the tunnel surface. The investigations carried out before excavation of the EDZ-tunnel define the undisturbed, baseline conditions in the surrounding rock (behind the planned tunnel wall); and the investigations carried out after excavation of EDZ-tunnel define the conditions when the EDZ already exists. The induced change in the conditions before and after excavation indicate the EDZ. The results of measurements from tunnel surfaces and from drillholes were reviewed with petrophysical sample data taken and analysed from the same location. Baseline investigations included: (1) a reflection seismic single-hole survey in a drillhole parallel to the planned tunnel outside the tunnel contour; (2) seismic tomography between two drillholes

  6. EDZ09 project and related EDZ studies in ONKALO 2008-2010

    International Nuclear Information System (INIS)

    Mellanen, S.; Lehtimaeki, T.; Heikkinen, E.; Mustonen, S.; Norokallio, J.


    The EDZ (Excavation Damaged Zone) is one of the issues in the evaluation of the long term safety concerning the underground rock surfaces of the final disposal facility. There have been various research and development tasks relating to the EDZ (among other items the EDZ300 Project) completed both before starting the excavation of the ONKALO underground facility and during the construction work. The EDZ09 Project was established to improve the drill and blast excavation method to control the EDZ and to verify the feasibility of Ground Penetrating Radar as a characterisation tool for the EDZ. The project was divided into two parts: Work Package (WP1), which managed the control of the excavation; and Work Package 2 (WP2), which concentrated on the geophysical tests. Long term safety issues were not included into EDZ09 Project. The project work was undertaken in a specific EDZ niche (Tutkimustila 3, ONK-TKU- 3620) with Work Package 1 being concerned with the research niche excavation and Work Package 2 with activities conducted in the niche. In Work Package 2 (WP2), a series of investigations under controlled conditions for EDZ assessment was conducted before and after the excavation. These measurements were performed in drillholes and on the tunnel surface. The investigations carried out before excavation of the EDZ-tunnel define the undisturbed, baseline conditions in the surrounding rock (behind the planned tunnel wall); and the investigations carried out after excavation of EDZ-tunnel define the conditions when the EDZ already exists. The induced change in the conditions before and after excavation indicate the EDZ. The results of measurements from tunnel surfaces and from drillholes were reviewed with petrophysical sample data taken and analysed from the same location. Baseline investigations included: (1) a reflection seismic single-hole survey in a drillhole parallel to the planned tunnel outside the tunnel contour; (2) seismic tomography between two drillholes

  7. Results of Monitoring at Olkiluoto in 2006. Environment

    International Nuclear Information System (INIS)

    Haapanen, R.


    This Working Report presents the main results of Posiva Oy's environmental monitoring programme on Olkiluoto Island in 2006. This is the third annual report. The environmental monitoring system supervised by Posiva Oy produces input for biosphere modelling for long-term safety purposes as well as for monitoring the state of the environment during the construction (and later operation) of ONKALO underground characterization facility. Although some of the nuclear power production related monitoring studies by TVO (the power company) have been going on from the 1970s, the repository-related environmental monitoring of Olkiluoto Island has only recently been comprehensive. Consequently, the first Biosphere Description Report was written in 2006. This work further produced some analyses belonging to the environmental monitoring programme, namely the estimates of biomass in terrestrial vegetation (forests) and a preliminary estimate of the biomass in terrestrial fauna (moose). In the monitoring data, the ongoing construction work (OL3, ONKALO and related infrastructure) is seen for instance in raised noise levels and deposition of base cations and iron. The land-use continues to change, but where there is natural environment, it resembles other coastal locations. The nearby marine environment is affected by the cooling water from the nuclear power plant. (orig.)

  8. Summary report - development of laboratory tests and the stress- strain behaviour of Olkiluoto mica gneiss

    International Nuclear Information System (INIS)

    Hakala, M.; Heikkilae, E.


    This work summarizes the project aimed at developing and qualifying a suitable combination of laboratory tests to establish a statistically reliable stress-strain behaviour of the main rock types at Posiva Oy's detailed investigation sites for disposal of spent nuclear fuel. The work includes literature study of stress-strain behaviour of brittle rock, development and qualification of laboratory tests, suggested test procedures and interpretation methods and finally testing of Olkiluoto mica gneiss. The Olkiluoto study includes over 130 loading tests. Besides the commonly used laboratory tests, direct tensile tests, damage controlled tests and acoustic emission measurements were also carried out. (orig.) (54 refs.)

  9. Basic data report for drillhole H-12 (Waste Isolation Pilot Plant-WIPP)

    International Nuclear Information System (INIS)

    Mercer, J.W.; Snyder, R.P.


    Drillhole H-12 was drilled where hydraulic data were needed to better establish flow characteristics existing south-southeast of the WIPP site. The fluid-bearing zones of interest are the Magenta and Culebra dolomite units of the Rustler Formation. Dissolution of halite in the Rustler Formation has occurred in the uppermost member, but has not yet begun in the lower halite-bearing members. Cuttings and cores were taken at selected intervals and geophysical logs were run over the entire depth of the hole. 3 refs., 2 figs., 3 tabs

  10. Disposal facility in Olkiluoto, description of above ground facilities in tunnel transport alternative

    International Nuclear Information System (INIS)

    Kukkola, T.


    The above ground facilities of the disposal plant on the Olkiluoto site are described in this report as they will be when the operation of the disposal facility starts in the year 2020. The disposal plant is visualised on the Olkiluoto site. Parallel construction of the deposition tunnels and disposal of the spent fuel canisters constitute the principal design basis of the disposal plant. The annual production of disposal canisters for spent fuel amounts to about 40. Production of 100 disposal canisters has been used as the capacity basis. Fuel from the Olkiluoto plant and from the Loviisa plant will be encapsulated in the same production line. The disposal plant will require an area of about 15 to 20 hectares above ground level. The total building volume of the above ground facilities is about 75000 m 3 . The purpose of the report is to provide the base for detailed design of the encapsulation plant and the repository spaces, as well as for coordination between the disposal plant and ONKALO. The dimensioning bases for the disposal plant are shown in the Tables at the end of the report. The report can also be used as a basis for comparison in deciding whether the fuel canisters are transported to the repository by a lift or a by vehicle along the access tunnel. (orig.)

  11. Disposal facility in olkiluoto, description of above ground facilities in lift transport alternative

    International Nuclear Information System (INIS)

    Kukkola, T.


    The above ground facilities of the disposal plant on the Olkiluoto site are described in this report as they will be when the operation of the disposal facility starts in the year 2020. The disposal plant is visualised on the Olkiluoto site. Parallel construction of the deposition tunnels and disposal of the spent fuel canisters constitute the principal design basis of the disposal plant. The annual production of disposal canisters for spent fuel amounts to about 40. Production of 100 disposal canisters has been used as the capacity basis. Fuel from the Olkiluoto plant and from the Loviisa plant will be encapsulated in the same production line. The disposal plant will require an area of about 15 to 20 hectares above ground level. The total building volume of the above ground facilities is about 75000 m 3 . The purpose of the report is to provide the base for detailed design of the encapsulation plant and the repository spaces, as well as for coordination between the disposal plant and ONKALO. The dimensioning bases for the disposal plant are shown in the Tables at the end of the report. The report can also be used as a basis for comparison in deciding whether the fuel canisters are transported to the repository by a lift or by a vehicle along the access tunnel. (orig.)

  12. Local seismic network at the Olkiluoto site. Annual report for 2011

    International Nuclear Information System (INIS)

    Saari, J.; Malm, M.


    This report gives the results of microseismic monitoring during 2011. Excavation of the underground characterisation facility called ONKALO started in 2004. Before that, in February 2002, Posiva Oy established a local seismic network of six stations on the island of Olkiluoto. After that the number of seismic stations has increased gradually. In 2011 Posiva's permanent seismic network consists of 15 seismic stations and 20 triaxial sensors. The purpose of the microearthquake measurements at Olkiluoto is to improve understanding of the structure, behaviour and long term stability of the bedrock. The investigation area includes two target areas. The larger target area, called seismic semiregional area, covers the Olkiluoto Island and its surroundings. The purpose is to monitor explosions and tectonic earthquakes in regional scale inside that area. The smaller target area is called the seismic ONKALO block, which is a 2 km x 2 km x 2 km cube surrounding ONKALO. It is assumed that all the expected excavation induced events occur within this volume. At the moment the seismic ONKALO block includes ten seismic stations. An additional task of monitoring is related to safeguarding of the construction of ONKALO. The configuration of the seismic network as well as the software packages applied in data processing and analyses have remained during the previous year. The design model of ONKALO and the brittle fault zone model of the Olkiluoto of the seismic visualization package Jdi were upgraded in 2011. The network has operated nearly continuously. There was a 14 minutes and 30 second long operation failure in December 2011. That was the first network operation failure in five years. Altogether 1223 events have been located in the Olkiluoto area, in the reported time period. Most of them (1098) are explosions that occurred inside the seismic semiregional area and especially inside the seismic ONKALO block (1064 events). The magnitudes of the observed explosions inside the semi

  13. Local seismic network at the Olkiluoto site. Annual report for 2011

    Energy Technology Data Exchange (ETDEWEB)

    Saari, J.; Malm, M. [AF-Consult Oy, Espoo (Finland)


    This report gives the results of microseismic monitoring during 2011. Excavation of the underground characterisation facility called ONKALO started in 2004. Before that, in February 2002, Posiva Oy established a local seismic network of six stations on the island of Olkiluoto. After that the number of seismic stations has increased gradually. In 2011 Posiva's permanent seismic network consists of 15 seismic stations and 20 triaxial sensors. The purpose of the microearthquake measurements at Olkiluoto is to improve understanding of the structure, behaviour and long term stability of the bedrock. The investigation area includes two target areas. The larger target area, called seismic semiregional area, covers the Olkiluoto Island and its surroundings. The purpose is to monitor explosions and tectonic earthquakes in regional scale inside that area. The smaller target area is called the seismic ONKALO block, which is a 2 km x 2 km x 2 km cube surrounding ONKALO. It is assumed that all the expected excavation induced events occur within this volume. At the moment the seismic ONKALO block includes ten seismic stations. An additional task of monitoring is related to safeguarding of the construction of ONKALO. The configuration of the seismic network as well as the software packages applied in data processing and analyses have remained during the previous year. The design model of ONKALO and the brittle fault zone model of the Olkiluoto of the seismic visualization package Jdi were upgraded in 2011. The network has operated nearly continuously. There was a 14 minutes and 30 second long operation failure in December 2011. That was the first network operation failure in five years. Altogether 1223 events have been located in the Olkiluoto area, in the reported time period. Most of them (1098) are explosions that occurred inside the seismic semiregional area and especially inside the seismic ONKALO block (1064 events). The magnitudes of the observed explosions inside the

  14. Geological discrete-fracture network model (version 1) for the Olkiluoto site, Finland

    International Nuclear Information System (INIS)

    Fox, A.; Buoro, A.; Dahlbo, K.; Wiren, L.


    This report describes the methods, analyses, and conclusions of the modelling team in the production of a discrete-fracture network (DFN) model for the Olkiluoto Site in Finland. The geological DFN is a statistical model for stochastically simulating rock fractures and minor faults at a scale ranging from approximately 0.05 m to approximately 500 m; an upper scale limit is not expressly defined, but the DFN model explicitly excludes structures at deformation-zone scales (∼ 500 m) and larger. The DFN model is presented as a series of tables summarizing probability distributions for several parameters necessary for fracture modelling: fracture orientation, fracture size, fracture intensity, and associated spatial constraints. The geological DFN is built from data collected during site characterization (SC) activities at Olkiluoto, which is currently planned to function as a final deep geological repository for spent fuel and nuclear waste from the Finnish nuclear power program. Data used in the DFN analyses include fracture maps from surface outcrops and trenches (as of July 2007), geological and structural data from cored boreholes (as of July 2007), and fracture information collected during the construction of the main tunnels and shafts at the ONKALO laboratory (January 2008). The modelling results suggest that the rock volume at Olkiluoto surrounding the ONKALO tunnel can be separated into three distinct volumes (fracture domains): an upper block, an intermediate block, and a lower block. The three fracture domains are bounded horizontally and vertically by large deformation zones. Fracture properties, such as fracture orientation and relative orientation set intensity, vary between fracture domains. The rock volume at Olkiluoto is dominated by three distinct fracture sets: subhorizontally-dipping fractures striking north-northeast and dipping to the east, a subvertically-dipping fracture set striking roughly north-south, and a subverticallydipping fracture set

  15. Summary report - development of laboratory tests and the stress- strain behaviour of Olkiluoto mica gneiss

    Energy Technology Data Exchange (ETDEWEB)

    Hakala, M.; Heikkilae, E. [Helsinki Univ. of Technology, Espoo (Finland). Lab. of Rock Engineering


    This work summarizes the project aimed at developing and qualifying a suitable combination of laboratory tests to establish a statistically reliable stress-strain behaviour of the main rock types at Posiva Oy`s detailed investigation sites for disposal of spent nuclear fuel. The work includes literature study of stress-strain behaviour of brittle rock, development and qualification of laboratory tests, suggested test procedures and interpretation methods and finally testing of Olkiluoto mica gneiss. The Olkiluoto study includes over 130 loading tests. Besides the commonly used laboratory tests, direct tensile tests, damage controlled tests and acoustic emission measurements were also carried out. (orig.) (54 refs.).

  16. Site and Regional Data for Biosphere Assessment BSA-2009 Supplement to Olkiluoto Biosphere Description 2009

    International Nuclear Information System (INIS)

    Aro, L.; Haapanen, R.; Puhakka, L.; Hjerpe, T.; Kirkkala, T.; Koivunen, S.; Lahdenperae, A.-M.; Salo, T.; Ikonen, A.T.K.; Helin, J.


    The safety case for a spent nuclear fuel repository at Olkiluoto includes a computational safety assessment. A site-specific biosphere assessment is an integral part of them both. In 2009 an assessment was conducted to demonstrate preparedness to apply for construction license to the repository in 2012. As a part of the biosphere assessment, the present conditions at the site are described in Olkiluoto biosphere description report for an analogue of the future conditions being simulated in the safety assessment. This report is a supplement to the biosphere description report of 2009 and documents the site and regional data used in the biosphere assessment 'BSA-2009' with respective rationales. (orig.)

  17. Forest soil survey and mapping of the nutrient status of the vegetation on Olkiluoto island. Results from the first inventory on the FEH plots

    International Nuclear Information System (INIS)

    Tamminen, P.; Aro, A.; Salemaa, M.


    The aim of the inventory was to determine the status of the forest soils and to map the current nutrient status of forest vegetation on Olkiluoto Island in order to create a basis for monitoring future changes in the forests and to provide data for a biospheric description of the island. The study was carried out on 94 FEH plots, which were selected from the forest extensive monitoring network (FET plots) on the basis of the forest site type distribution and tree stand characteristics measured on the island during 2002 - 2004. Forest soils on Olkiluoto are very young and typical of soils along the Finnish coast, i.e. stony or shallow soils overlying bedrock, but with more nutrients than the forest soils inland. In addition to nutrients, the heavy metal concentrations are clearly higher on Olkiluoto than the average values for Finnish forest soils. The soil in the alder stands growing along the seashore is different from the other soils on Olkiluoto and the control soils inland. These soils are less acidic and have large reserves of sodium, magnesium and nitrogen. Macronutrient concentrations in vascular plant species were relatively similar to those reported for Southern Finland. However, it is obvious that the accumulation of particulate material on the vegetation, especially on forest floor bryophytes, has increased due to emissions derived from the construction of roads, drilling and rock crushing, as well as the other industrial activities on Olkiluoto Island. Leaf and needle analysis indicated that the tree stands had, in the main, a good nutrient status on Olkiluoto Island. The surveying methods used on Olkiluoto are better suited to detect systematic changes over a larger area or within a group of sample plots than the changes on individual plots. (orig.)

  18. TURVA-2012 safety case for licensing a spent fuel repository at Olkiluoto, Finland

    International Nuclear Information System (INIS)

    Vira, Juhani; Snellman, Margit


    In 2001, the Finnish Parliament endorsed a decision-in-principle (DiP) whereby the spent nuclear fuel produced by the operating nuclear reactors at Olkiluoto and Loviisa will be disposed of in a geological repository at Olkiluoto, on the south-western coast of Finland. Subsequently, additional DiPs were issued allowing the extension of the repository to accommodate spent nuclear fuel from additional reactors that are under construction or in planning at Olkiluoto, which means a total of 9 000 tU of spent nuclear fuel to be disposed of. In accordance with the decision of the Ministry of Trade and Industry (KTM) in 2003, Posiva submitted an application for a license to construct a disposal facility at Olkiluoto in 2012, consisting of an encapsulation facility and an underground deep geological repository. The application included a Preliminary Safety Analysis Report (PSAR) and a long-term safety case, TURVA-2012. Assuming a positive outcome of the current licensing review, the next step would be the Final Safety Analysis Report (FSAR) in support of an operational licence application around 2020. The disposal method is based on the same KBS-3 concept that the Swedish SKB has used as basis for their license application in 2010. Accordingly, the spent nuclear fuel will be encapsulated in water- and gas-tight copper canisters equipped with a load-bearing insert and emplaced in a deep geological repository constructed in the bedrock. The canisters will be surrounded by a swelling clay buffer material that isolates them from the bedrock. The deposition tunnels and the central tunnels and the other underground openings will be backfilled with materials of low permeability. The repository will be at a depth of about 400-450 m below ground. The primary role of the bedrock is to provide sufficiently stable conditions for the engineered barrier system and to make inadvertent human intrusion unlikely. In case of EBS failure, the bedrock shall also retain and retard the possible

  19. Raise Boring of the ventilation shaft in Olkiluoto, 17. - 23.5.2006. Preliminary analysis of seismic signal

    Energy Technology Data Exchange (ETDEWEB)

    Saari, J.; Lakio, A. [AaF-Enprima Oy, Vantaa (Finland)


    In Olkiluoto, Posiva Oy has operated a local seismic network since February 2002. The purpose of the microearthquake measurements at Olkiluoto is to improve understanding of the structure, behaviour and long term stability of the bedrock. The studies include both tectonic and excavation-induced microearthquakes. An additional task of monitoring is related to safeguarding of the ONKALO. The possibility to excavate an illegal access to the ONKALO, have been concerned when the safeguards are discussed. Therefore all recorded explosions in the Olkiluoto area and in the ONKALO are located. If a concentration of explosions is observed, the origin of that is found out. Also a concept of hidden illegal explosions, detonated at the same time as the real excavation blasts, has been examined. According to the experience gained in Olkiluoto, it can be concluded that, as long the seismic network is in operation and the results are analysed by a skilled person, it is practically impossible to do illegal excavation by blasts. In this report a possibility of seismic monitoring of illegal excavation done by tunnel boring machine has been investigated. Characteristics of the seismic signal generated by the raise boring machine are analysed. According to this study, it can be concluded that the generated seismic signal can be detected and the source of the signal can be located. However, this task calls for different kind of monitoring system than that, which is currently used for monitoring microearthquakes and explosions. (orig.)

  20. Raise Boring of the ventilation shaft in Olkiluoto, 17. - 23.5.2006. Preliminary analysis of seismic signal

    International Nuclear Information System (INIS)

    Saari, J.; Lakio, A.


    In Olkiluoto, Posiva Oy has operated a local seismic network since February 2002. The purpose of the microearthquake measurements at Olkiluoto is to improve understanding of the structure, behaviour and long term stability of the bedrock. The studies include both tectonic and excavation-induced microearthquakes. An additional task of monitoring is related to safeguarding of the ONKALO. The possibility to excavate an illegal access to the ONKALO, have been concerned when the safeguards are discussed. Therefore all recorded explosions in the Olkiluoto area and in the ONKALO are located. If a concentration of explosions is observed, the origin of that is found out. Also a concept of hidden illegal explosions, detonated at the same time as the real excavation blasts, has been examined. According to the experience gained in Olkiluoto, it can be concluded that, as long the seismic network is in operation and the results are analysed by a skilled person, it is practically impossible to do illegal excavation by blasts. In this report a possibility of seismic monitoring of illegal excavation done by tunnel boring machine has been investigated. Characteristics of the seismic signal generated by the raise boring machine are analysed. According to this study, it can be concluded that the generated seismic signal can be detected and the source of the signal can be located. However, this task calls for different kind of monitoring system than that, which is currently used for monitoring microearthquakes and explosions. (orig.)

  1. Results of monitoring at Olkiluoto in 2008. Environment

    International Nuclear Information System (INIS)

    Haapanen, A.


    This Working Report presents the main results of Posiva Oy's environmental monitoring programme on Olkiluoto Island in 2008. These summary reports have been published since 2005 (target year 2004). The environmental monitoring system supervised by Posiva Oy produces input for biosphere modelling for long-term safety purposes as well as for monitoring the state of the environment during the construction (and later operation) of ONKALO underground characterization facility. Although some of the nuclear power production related monitoring studies by TVO (the power company) have been going on from the 1970s, the repository-related environmental monitoring of Olkiluoto Island has only recently been comprehensive. However, the monitoring programme evolves according to experiences from modelling work and increasing knowledge of most important site data. For example, in addition to the originally planned activities, in 2008 several studies on fauna were carried out, some soil and vegetation transects running from land to sea were established, a separate survey of water quality with automatic detectors was carried out and zooplankton and organic carbon studies were started in context of sea monitoring. In the monitoring data, the ongoing construction work (OL3, ONKALO and related infrastructure) is seen for instance in raised levels of noise and some deposited elements. The land-use continues to change, but where there is natural environment is affected by the cooling water from the nuclear power plant. (orig.)

  2. On KNBK for the preparation of shafts of drill-holes for the sinking casing strings

    Energy Technology Data Exchange (ETDEWEB)

    Sukhanov, V B; Shchukin, R K


    An experimental preparation of drill-holes for reinforcement performed by the Kubanomor neftagazprom firm is given based on the use of traditional KNBK of increasing rigidity after the interval has been completely drilled and KNBK inserted into the superchisel part of the flywheel, UBTS or rotary stabilizer, the outer diameters of which are determined computationally and help in preparation of the shaft for reinforcement in the process of rotary drilling.

  3. Mise-a-la-masse surveys at Olkiluoto, 2006

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.


    Suomen Malmi Oy conducted Mise-a-la-masse surveys at Olkiluoto site in Eurajoki during November and December 2006. The surveys are a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included field work, data processing and technical raporting. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. Data is delivered digitally in xyz-format. (orig.)

  4. Environmental Radioactivity Data of Olkiluoto in 1984-2001

    International Nuclear Information System (INIS)

    Ikonen, A.T.K.


    In this report, data of the environmental radiation surveillance programme of the Olkiluoto nuclear power plant is published in a collected format for further reference. The data reported consists of analysis results of selected environmental media and indicator organisms representing human food web, and it covers a period of 1984-2001. In addition to sampling and analysis results, also a concise description of data acquisition methods - when still traceable - and handling is provided as well as locations of sampling sites. (orig.)

  5. Safety case for the disposal of spent nuclear fuel at Olkiluoto - Synthesis 2012

    International Nuclear Information System (INIS)


    TURVA-2012 is Posiva's safety case in support of the Preliminary Safety Analysis Report (PSAR 2012) and application for a construction licence for a spent nuclear fuel repository. Consistent with the Government Decisions-in- Principle, this foresees a repository developed in bedrock at the Olkiluoto site according to the KBS-3 method, designed to accept spent nuclear fuel from the lifetime operations of the Olkiluoto and Loviisa reactors. Synthesis 2012 presents a synthesis of Posiva Oy's Safety Case 'TURVA-2012' portfolio. It summarises the design basis for the repository at the Olkiluoto site, the assessment methodology and key results of performance and safety assessments. It brings together all the lines of argument for safety, evaluation of compliance with the regulatory requirements, and statement of confidence in long-term safety and Posiva's safety analyses. The TURVA-2012 safety case demonstrates that the proposed repository design provides a safe solution for the disposal of spent nuclear fuel, and that the performance and safety assessments are fully consistent with all the legal and regulatory requirements related to long-term safety as set out in Government Decree 736/2008 and in guidance from the nuclear regulator - the STUK. Moreover, Posiva considers that the level of confidence in the demonstration of safety is appropriate and sufficient to submit the construction licence application to the authorities. The assessment of long-term safety includes uncertainties, but these do not affect the basic conclusions on the long-term safety of the repository. (orig.)

  6. Basic data report for drillholes at the H-11 complex (Waste Isolation Pilot Plant-WIPP)

    International Nuclear Information System (INIS)

    Mercer, J.W.; Snyder, R.P.


    Drillholes H-11b1, H-11b2, and H-11b3 were drilled from August to December 1983 for site characterization and hydrologic studies of the Culebra Dolomite Member of the Upper Permian Rustler Formation at the Waste Isolation Pilot Plant (WIPP) site in southeastern New Mexico. In October 1984, the three wells were subjected to a series of pumping tests designed to develop the wells, provide information on hydraulic communication between the wells, provide hydraulic properties information, and to obtain water samples for quality of water measurements. Based on these tests, it was determined that this location would provide an excellent pad to conduct a convergent-flow non-sorbing tracer test in the Culebra dolomite. In 1988, a fourth hole (H-11b4) was drilled at this complex to provide a tracer-injection hole for the H-11 convergent-flow tracer test and to provide an additional point at which the hydraulic response of the Culebra H-11 multipad pumping test could be monitored. A suite of geophysical logs was run on the drillholes and was used to identify different lithologies and aided in interpretation of the hydraulic tests. 4 refs., 6 figs., 6 tabs

  7. Basic data report for drillholes at the H-11 complex (Waste Isolation Pilot Plant-WIPP)

    Energy Technology Data Exchange (ETDEWEB)

    Mercer, J.W. (Sandia National Labs., Albuquerque, NM (USA)); Snyder, R.P. (Geological Survey, Denver, CO (USA))


    Drillholes H-11b1, H-11b2, and H-11b3 were drilled from August to December 1983 for site characterization and hydrologic studies of the Culebra Dolomite Member of the Upper Permian Rustler Formation at the Waste Isolation Pilot Plant (WIPP) site in southeastern New Mexico. In October 1984, the three wells were subjected to a series of pumping tests designed to develop the wells, provide information on hydraulic communication between the wells, provide hydraulic properties information, and to obtain water samples for quality of water measurements. Based on these tests, it was determined that this location would provide an excellent pad to conduct a convergent-flow non-sorbing tracer test in the Culebra dolomite. In 1988, a fourth hole (H-11b4) was drilled at this complex to provide a tracer-injection hole for the H-11 convergent-flow tracer test and to provide an additional point at which the hydraulic response of the Culebra H-11 multipad pumping test could be monitored. A suite of geophysical logs was run on the drillholes and was used to identify different lithologies and aided in interpretation of the hydraulic tests. 4 refs., 6 figs., 6 tabs.

  8. Microbiology of transitional groundwater of the porous overburden and underlying fractured bedrock aquifers in Olkiluoto 2004, Finland

    International Nuclear Information System (INIS)

    Pedersen, K.


    The subsurface biosphere on Earth appears to be far more expansive and metabolically and phylogenetically complex than previously thought. A diverse suite of subsurface environments have been reported to support microbial ecosystems, extending from a few meters below the surface to several hundred meters. The discovery of a deep biosphere will have several important effects on underground repositories for radioactive wastes. The main potential effects of microorganisms in the context of a KBS-3 type repository for spent fuel in the bedrock of Olkiluoto are: Oxygen reduction and maintenance of anoxic and reduced conditions; Bio-immobilisation and bio-mobilisation of radionuclides, and the effects from microbial metabolism on radionuclide mobility; Sulphate reduction to sulphide and the potential for copper sulphide corrosion. The first main objective of this study was to characterize the geochemistry, biomass and microbial diversity of shallow subsurface groundwater at Olkiluoto, from 4.0 m down to 24.5 m. This objective also permitted the determination of whether or not there is any transition in the shallow depths at Olkiluoto to microbial conditions associated with the deep subsurface. The second main objective was to continue the study of biomass and microbial metabolic diversity in deep groundwater of Olkiluoto to a maximal depth of 525 m, using cultivation methods similar to those applied to the shallow groundwater. This was the first investigation that covered both shallow and deep groundwater microbiology. The analysis of microbiology is very important for proper understanding of the evolution of geochemical processes in and around the underground research facility ONKALO being constructed at Olkiluoto by Posiva since autumn 2004, as well as for the planned KBS-3 type spent fuel repository at Olkiluoto. There are several conclusions and hypotheses with respect to the microbiology that are of great importance for ONKALO and for the spent fuel repository. The

  9. 18O, 2H and 3H isotopic composition of precipitation and shallow groundwater in Olkiluoto

    International Nuclear Information System (INIS)

    Hendriksson, N.; Karhu, J.; Niinikoski, P.


    The isotopic composition of oxygen and hydrogen in local precipitation is a key parameter in the modelling of local water circulation. This study was initiated in order to provide systematic monthly records of the isotope content of atmospheric precipitation in the Olkiluoto area and to establish the relation between local rainfall and newly formed groundwater. During January 2005 - December 2012, a total of 85 cumulative monthly rainfall samples and 68 shallow groundwater samples were collected and the isotopic composition of oxygen and hydrogen was recorded for all those samples. Tritium values are available for 79 precipitation and 65 groundwater samples. Based on the 8-year monitoring, the long-term weighted annual mean isotope values of precipitation and the mean values of shallow groundwater are -11.59 per mille and -11.27 per mille for δ 18 O, - 82.3 per mille and -80.3 per mille for δ 2 H and 9.8 and 9.1 TU for tritium, respectively. Based on these data, the mean stable isotope ratios of groundwater represent the long-term mean annual isotopic composition of local precipitation. The precipitation data were used to establish the local meteoric water line (LMWL) for the Olkiluoto area. The line is formulated as: δ 2 H = 7.45 star δ 18 O + 3.82. The isotope time series reveal a change in time. The increasing trend for the δ 18 O and δ 2 H values may be related to climatic variability while the gradual decline observed in the 3 H data is attributed to the still continuing decrease in atmospheric 3 H activity in the northern hemisphere. The systematic seasonal and long-term tritium trends suggest that any potential ground-level tritium release from the Olkiluoto nuclear power plants is insignificant. The d-excess values of Olkiluoto precipitation during the summer period indicated that a notable amount of re-cycled Baltic Sea water may have contributed to precipitation in the Finnish southern coast. Preliminary estimates of the evaporated Baltic Sea water

  10. Local seismic network at the Olkiluoto site. Annual Report for 2006

    International Nuclear Information System (INIS)

    Saari, J.; Lakio, A.


    In February 2002, Posiva Oy established a local seismic network of six stations on the island of Olkiluoto. Later, in June 2004, the seismic network was expanded with two new seismic stations. At that time started the excavation of the underground characterisation facility (the ONKALO) and the basic operation procedure was changed more suitable for the demands of the new situation. The purpose of the microearthquake measurements at Olkiluoto is to improve understanding of the structure, behaviour and long term stability of the bedrock. The studies include both tectonic and excavation-induced microearthquakes. An additional task of monitoring is related to safeguarding of the ONKALO. This report gives the results of microseismic monitoring during the year 2006. Also the changes in the structure and the operation procedure of the network are described. The network has operated continuously in 2006. In the beginning of 2006, the target area of the seismic monitoring expanded to semi-regional scale. Four new seismic stations started in the beginning of February 2006. At the end of the year, two new borehole geophones were installed in order to improve the sensitivity and the depth resolution of the measurements inside the ONKALO block. This report presents also new interpretations of the excavation induced earthquakes that occurred in the ONKALO in 2005. Altogether 2041 events have been located in the Olkiluoto area, in reported time period. The magnitudes of the observed events range from ML = -1.1 to ML = 3.1 (ML magnitude in local Richter's scale). Most of them are explosions. Two of the observed events are be classified as microearthquakes. Evidence of activity that would have influence on the safety of the ONKALO, have not been found. The observed earthquakes occurred in 2006 were small, ML = -0.6 and ML= -0.9. The earthquakes relate to small movements in brittle deformation zones OL-BFZ043 and OL-BFZ034 presented in the geological model of the Olkiluoto site

  11. Game statistics for the island of Olkiluoto in 2008-2009

    Energy Technology Data Exchange (ETDEWEB)

    Jussila, I. (Turku Univ., Satakunta Environmental Research Inst., Pori (Finland)); Nieminen, M. (Faunatica Oy, Espoo (Finland))


    The game statistics for the island of Olkiluoto were updated in April 2009, and compared with earlier studies. Population size estimates are based on interviews of local hunters, and other available material. Conclusions of changes in game populations are based on rough estimates primarily from interviews, only in Elk and Deer also on inventories. Elk population is still slightly decreasing. The growth of the White-tailed Deer population is slowing down. The changes in the Roe Deer population are not precisely known, but it is seemingly varying to some extent in different years. The populations of small predators (American Mink, Raccoon Dog and Red Fox) are still strong in Olkiluoto, partly because of very dense population of voles during the hunting season. The Raccoon Dog population has been diminished due to shooting several individuals during the Elk and Deer hunting. The Red Fox population is obviously increasing. The Mountain Hare population is strong and it increased in 2008. However, the Brown Hare population is apparently decreasing, probably due to kills by mammalian predators, eagles and traffic. Currently, other game animals (e.g. waterfowl) are hardly ever hunted. (orig.)

  12. Game statistics for the island of Olkiluoto in 2008-2009

    International Nuclear Information System (INIS)

    Jussila, I.; Nieminen, M.


    The game statistics for the island of Olkiluoto were updated in April 2009, and compared with earlier studies. Population size estimates are based on interviews of local hunters, and other available material. Conclusions of changes in game populations are based on rough estimates primarily from interviews, only in Elk and Deer also on inventories. Elk population is still slightly decreasing. The growth of the White-tailed Deer population is slowing down. The changes in the Roe Deer population are not precisely known, but it is seemingly varying to some extent in different years. The populations of small predators (American Mink, Raccoon Dog and Red Fox) are still strong in Olkiluoto, partly because of very dense population of voles during the hunting season. The Raccoon Dog population has been diminished due to shooting several individuals during the Elk and Deer hunting. The Red Fox population is obviously increasing. The Mountain Hare population is strong and it increased in 2008. However, the Brown Hare population is apparently decreasing, probably due to kills by mammalian predators, eagles and traffic. Currently, other game animals (e.g. waterfowl) are hardly ever hunted. (orig.)

  13. The combinatorial PP1-binding consensus Motif (R/Kx( (0,1V/IxFxx(R/Kx(R/K is a new apoptotic signature.

    Directory of Open Access Journals (Sweden)

    Angélique N Godet

    Full Text Available BACKGROUND: Previous studies established that PP1 is a target for Bcl-2 proteins and an important regulator of apoptosis. The two distinct functional PP1 consensus docking motifs, R/Kx((0,1V/IxF and FxxR/KxR/K, involved in PP1 binding and cell death were previously characterized in the BH1 and BH3 domains of some Bcl-2 proteins. PRINCIPAL FINDINGS: In this study, we demonstrate that DPT-AIF(1, a peptide containing the AIF(562-571 sequence located in a c-terminal domain of AIF, is a new PP1 interacting and cell penetrating molecule. We also showed that DPT-AIF(1 provoked apoptosis in several human cell lines. Furthermore, DPT-APAF(1 a bi-partite cell penetrating peptide containing APAF-1(122-131, a non penetrating sequence from APAF-1 protein, linked to our previously described DPT-sh1 peptide shuttle, is also a PP1-interacting death molecule. Both AIF(562-571 and APAF-1(122-131 sequences contain a common R/Kx((0,1V/IxFxxR/KxR/K motif, shared by several proteins involved in control of cell survival pathways. This motif combines the two distinct PP1c consensus docking motifs initially identified in some Bcl-2 proteins. Interestingly DPT-AIF(2 and DPT-APAF(2 that carry a F to A mutation within this combinatorial motif, no longer exhibited any PP1c binding or apoptotic effects. Moreover the F to A mutation in DPT-AIF(2 also suppressed cell penetration. CONCLUSION: These results indicate that the combinatorial PP1c docking motif R/Kx((0,1V/IxFxxR/KxR/K, deduced from AIF(562-571 and APAF-1(122-131 sequences, is a new PP1c-dependent Apoptotic Signature. This motif is also a new tool for drug design that could be used to characterize potential anti-tumour molecules.

  14. Results of monitoring at Olkiluoto in 2010 - Environment

    Energy Technology Data Exchange (ETDEWEB)

    Haapanen, A. (ed.) [Haapanen Forest Consulting, Vanhakylae (Finland)


    This Working Report presents the main results of Posiva Oy's environmental monitoring programme on Olkiluoto Island in 2010. These summary reports have been published since 2005. The environmental monitoring system supervised by Posiva Oy produces input for biosphere modelling for long-term safety purposes as well as for monitoring the state of the environment during the construction (and later operation) of ONKALO underground rock characterization facility. Part of the monitoring is performed by the company running the nuclear power plants on the island, Teollisuuden Voima Oy (TVO). Monitoring has been carried out for varying periods of time depending on the sector: some monitoring activities performed by TVO originate from the 1970s and the repository-related environmental monitoring of Olkiluoto from the early 2000s. The monitoring programme evolves according to experiences gained from the modelling work and increased understanding of the site. Augmentations in 2010 include one previously unmonitored private drilled well, and sampling of crop plants, aquatic macrophytes, and bottom fauna, as well as soil and water in order to obtain more data on site-specific concentration ratios. In addition to Olkiluoto Island, two so called reference lakes have been included in the sampling. Studies have been going on on one reference mire, as well. Bottom fauna studies of River Eurajoki exist from late 1970s, but have not been presented here before. Dust produced during construction of the third nuclear power unit (OL3), ONKALO and related infrastructure can be seen in the analysis results of needle litter. The construction works and road traffic have a raising effect on the noise levels of the immediate surroundings. The land-use continues to change, but the remaining natural environment resembles other coastal locations. The young age of the soils and the closeness of the sea are reflected in the soil properties. Mammalian fauna on the island is typical of coastal

  15. Results of monitoring at Olkiluoto in 2010 - Environment

    International Nuclear Information System (INIS)

    Haapanen, A.


    This Working Report presents the main results of Posiva Oy's environmental monitoring programme on Olkiluoto Island in 2010. These summary reports have been published since 2005. The environmental monitoring system supervised by Posiva Oy produces input for biosphere modelling for long-term safety purposes as well as for monitoring the state of the environment during the construction (and later operation) of ONKALO underground rock characterization facility. Part of the monitoring is performed by the company running the nuclear power plants on the island, Teollisuuden Voima Oy (TVO). Monitoring has been carried out for varying periods of time depending on the sector: some monitoring activities performed by TVO originate from the 1970s and the repository-related environmental monitoring of Olkiluoto from the early 2000s. The monitoring programme evolves according to experiences gained from the modelling work and increased understanding of the site. Augmentations in 2010 include one previously unmonitored private drilled well, and sampling of crop plants, aquatic macrophytes, and bottom fauna, as well as soil and water in order to obtain more data on site-specific concentration ratios. In addition to Olkiluoto Island, two so called reference lakes have been included in the sampling. Studies have been going on on one reference mire, as well. Bottom fauna studies of River Eurajoki exist from late 1970s, but have not been presented here before. Dust produced during construction of the third nuclear power unit (OL3), ONKALO and related infrastructure can be seen in the analysis results of needle litter. The construction works and road traffic have a raising effect on the noise levels of the immediate surroundings. The land-use continues to change, but the remaining natural environment resembles other coastal locations. The young age of the soils and the closeness of the sea are reflected in the soil properties. Mammalian fauna on the island is typical of coastal areas in

  16. KBS-3H layout adaptation 2007 for the Olkiluoto site

    International Nuclear Information System (INIS)

    Johansson, Erik; Hagros, Annika; Autio, Jorma; Kirkkomaeki, Timo


    As part of the KBS-3H design an Olkiluoto-specific layout of a KBS-3H repository has been produced based on the latest Olkiluoto data and the bedrock model. One of the main goals of this work was to support the evaluation of the feasibility of the one layer KBS-3H concept and to compare the layouts based on the KBS-3H and KBS-3V disposal concepts. The layout presented in this work can be considered only preliminary and involves a number of uncertainties. The percentage of unusable host rock was assumed to be 25% in this work but can change due to the further design of the different components of the KBS-3H disposal system and further development of the host rock criteria. The layout is also significantly affected by the layout-determining fracture zones. In this work 11 major (highly transmissive) fracture zones interpreted to intersect the -420 m level were considered deterministically. The KBS-3H layout requires a larger area than the KBS-3V repository and takes up most of the available area between the major fracture zones HZ20 and HZ21. This is mainly due to the long drift sections occupied by the compartment plugs (30 m) and the bentonite blocks in the blank zones (10 m), which reduces the usability of the host rock and results in larger canister spacings than in the KBS-3V concept, where the positioning of the deposition holes is very flexible and narrow zones with a moderate transmissivity usually have only a minor effect on the locations of the canisters. According to the results, there is enough bedrock in the current investigation area at central Olkiluoto for KBS-3H layout in one layer. However the layout takes up nearly all of the potential bedrock resource and therefore the result is quite sensitive to possible changes in the design bases

  17. Results of forest monitoring on Olkiluoto island in 2009

    Energy Technology Data Exchange (ETDEWEB)

    Aro, L.; Helmisaari, H.S.; Hoekkae, H.; Lindroos, A.-J.; Rautio, P.; Derome, J. (Finnish Forest Research Institute, Vantaa (Finland))


    Forest investigations carried out on Olkiluoto aim to monitor the state of the forest ecosystems, quantify Olkiluoto-specific processes taking place in the forests producing input data for the safety assessment of spent nuclear fuel disposal, and follow possible changes in the forest condition resulting from the intensive construction activities currently being carried out in the area. The forest investigations form a part of the monitoring programme being carried out on Olkiluoto Island under the management of Posiva Oy. This report focuses on activities performed on bulk deposition and forest intensive monitoring plots (MRK and FIP plots) in 2009. In general, the deposition levels in 2009 in the open area and in stand throughfall were quite comparable to those in earlier years, although sulphur and calcium depositions were somewhat higher in the open area than in earlier years. The soil solution quality in 2009 was also quite comparable to that in earlier years. The NH{sub 4}-N and NO{sub 3}-N concentrations were low at all depths in the mineral soil of the FIP plots. There appeared to be a gradual decrease in sulphate concentrations in the mineral soil during the monitoring period. In 2009 the monthly level of transipiration in the Scots pine dominated stand was comparable to previous years (2007-2008). Instead, monthly transpiration in the Norway spruce dominated stand was clearly lower in 2009 than in 2007-2008. Annual total litterfall production was smaller in 2008 than in 2007. The most notable differences between the plots were detected in Al and N concentrations. The Al concentration was higher in living pine needles than in spruce needles. High Al and Fe concentrations were found in remaining litter, and are most likely due to soil dust. The average defoliation level of the pines was 4.6 % and of the spruces 24.1 %, indicating a good crown condition: the pines were classified as non-defoliated and the spruces as slightly defoliated. The minirhizotrone

  18. Results of forest monitoring on Olkiluoto island in 2009

    International Nuclear Information System (INIS)

    Aro, L.; Helmisaari, H.S.; Hoekkae, H.; Lindroos, A.-J.; Rautio, P.; Derome, J.


    Forest investigations carried out on Olkiluoto aim to monitor the state of the forest ecosystems, quantify Olkiluoto-specific processes taking place in the forests producing input data for the safety assessment of spent nuclear fuel disposal, and follow possible changes in the forest condition resulting from the intensive construction activities currently being carried out in the area. The forest investigations form a part of the monitoring programme being carried out on Olkiluoto Island under the management of Posiva Oy. This report focuses on activities performed on bulk deposition and forest intensive monitoring plots (MRK and FIP plots) in 2009. In general, the deposition levels in 2009 in the open area and in stand throughfall were quite comparable to those in earlier years, although sulphur and calcium depositions were somewhat higher in the open area than in earlier years. The soil solution quality in 2009 was also quite comparable to that in earlier years. The NH 4 -N and NO 3 -N concentrations were low at all depths in the mineral soil of the FIP plots. There appeared to be a gradual decrease in sulphate concentrations in the mineral soil during the monitoring period. In 2009 the monthly level of transipiration in the Scots pine dominated stand was comparable to previous years (2007-2008). Instead, monthly transpiration in the Norway spruce dominated stand was clearly lower in 2009 than in 2007-2008. Annual total litterfall production was smaller in 2008 than in 2007. The most notable differences between the plots were detected in Al and N concentrations. The Al concentration was higher in living pine needles than in spruce needles. High Al and Fe concentrations were found in remaining litter, and are most likely due to soil dust. The average defoliation level of the pines was 4.6 % and of the spruces 24.1 %, indicating a good crown condition: the pines were classified as non-defoliated and the spruces as slightly defoliated. The minirhizotrone images

  19. Safety case for the disposal of spent nuclear fuel at Olkiluoto - Synthesis 2012

    Energy Technology Data Exchange (ETDEWEB)



    TURVA-2012 is Posiva's safety case in support of the Preliminary Safety Analysis Report (PSAR 2012) and application for a construction licence for a spent nuclear fuel repository. Consistent with the Government Decisions-in- Principle, this foresees a repository developed in bedrock at the Olkiluoto site according to the KBS-3 method, designed to accept spent nuclear fuel from the lifetime operations of the Olkiluoto and Loviisa reactors. Synthesis 2012 presents a synthesis of Posiva Oy's Safety Case 'TURVA-2012' portfolio. It summarises the design basis for the repository at the Olkiluoto site, the assessment methodology and key results of performance and safety assessments. It brings together all the lines of argument for safety, evaluation of compliance with the regulatory requirements, and statement of confidence in long-term safety and Posiva's safety analyses. The TURVA-2012 safety case demonstrates that the proposed repository design provides a safe solution for the disposal of spent nuclear fuel, and that the performance and safety assessments are fully consistent with all the legal and regulatory requirements related to long-term safety as set out in Government Decree 736/2008 and in guidance from the nuclear regulator - the STUK. Moreover, Posiva considers that the level of confidence in the demonstration of safety is appropriate and sufficient to submit the construction licence application to the authorities. The assessment of long-term safety includes uncertainties, but these do not affect the basic conclusions on the long-term safety of the repository. (orig.)

  20. Preliminary modelling of the 2010 MAM survey data

    International Nuclear Information System (INIS)

    Ahokas, T.


    Posiva Oy prepares for disposal of spent nuclear fuel into bedrock focusing in Olkiluoto, Eurajoki. This is in accordance of the Decision-in-Principle of the State Council in 2000, and ratification by the Parliament in 2001. The ONKALO underground characterization premises have been constructed since 2004. Posiva Oy is aiming for submitting the construction licence application in 2012. To support the compilation of the safety case and repository and ONKALO underground characterisation facility design and construction, a series of Olkiluoto Site Descriptive Model including six parts: the surface system geology, rock mechanics, hydrogeology and hydrogeochemistry and migration, have been compiled. To support the next update of the Olkiluoto Site Description and especially, the geological and hydrogeological sub-models, the preliminary modelling of the recent mise-a-la-masse (MAM) surveys has been carried out. This report discusses the mise-a-la-masse (MAM) surveys carried out in the Olkiluoto area in 2010 and aims to find out the continuation of some electrically conductive zones intersected by drillholes OL-KR49 ...OL-KR53 in the eastern part of the Olkiluoto island. Several electrically conductive zones were modelled from the examined data, many of them coincide with the brittle deformation zones presented in the geological model, but also indications of some so far unknown zones were detected. The complexity and the extent of the group of zones including the hydraulically conductive zones HZ19A, HZ19B and HZ19C (Vaittinen et al. 2009) emerged from the data during this work. Modelling of this group in detail needs more information from both geological and hydrogeological investigations. (orig.)

  1. Results of forest monitoring on Olkiluoto island in 2010

    International Nuclear Information System (INIS)

    Aro, L.; Huhta, A.-P.; Hoekkae, H.; Lindroos, A.-J.; Rautio, P.; Helmisaari, H.-S.


    Forest investigations carried out on Olkiluoto aim to monitor the state of the forest ecosystems, quantify Olkiluoto-specific processes taking place in the forests producing input data for the safety assessment of spent nuclear fuel disposal, and follow possible changes in the forest condition resulting from the intensive construction activities currently being carried out in the area. The forest investigations form a part of the monitoring programme being carried out on Olkiluoto Island under the management of Posiva Oy. This report focuses on activities performed on bulk deposition and forest intensive monitoring plots (MRK and FIP plots) in 2010. In general, the deposition levels in 2010 in the open area and in stand throughfall were quite comparable to those in earlier years, although sulphur and calcium depositions were somewhat higher in the open area than in earlier years (2004-2008). The soil solution quality in 2010 was also quite comparable to that in earlier years. The NH 4 -N and NO 3 -N concentrations were low at all depths in the mineral soil of the FIP plots 4, 10 and 11. Instead, nitrate concentrations were high in the soil solution on FIP14. There appeared to be a clear overall increase in sulphate concentrations with increasing depth on FIP4 and FIP10. Chloride concentrations in the soil solution were extremely high at all depths on all FIP plots throughout the monitoring period; it is clear that there is a considerable input of NaCl in the deposition derived from the sea. The concentrations of heavy metals (Cd, Cr, Ni, Pb) in the soil solution at all depths at Olkiluoto during 2004-2010 continued in many cases to be close to or below the limit of quantification. In 2010 the monthly level of transpiration in the Scots pine dominated stand was smaller in May and bigger in July than during previous years (2007-2009). Monthly transpiration in the Norway spruce dominated stand was clearly lower in 2010 than in 2007-2009, and there is a decreasing

  2. Results of forest monitoring on Olkiluoto island in 2010

    Energy Technology Data Exchange (ETDEWEB)

    Aro, L.; Huhta, A.-P.; Hoekkae, H.; Lindroos, A.-J.; Rautio, P. [Finnish Forest Research Institute, Vantaa (Finland); Helmisaari, H.-S. [Helsinki Univ. (Finland)


    Forest investigations carried out on Olkiluoto aim to monitor the state of the forest ecosystems, quantify Olkiluoto-specific processes taking place in the forests producing input data for the safety assessment of spent nuclear fuel disposal, and follow possible changes in the forest condition resulting from the intensive construction activities currently being carried out in the area. The forest investigations form a part of the monitoring programme being carried out on Olkiluoto Island under the management of Posiva Oy. This report focuses on activities performed on bulk deposition and forest intensive monitoring plots (MRK and FIP plots) in 2010. In general, the deposition levels in 2010 in the open area and in stand throughfall were quite comparable to those in earlier years, although sulphur and calcium depositions were somewhat higher in the open area than in earlier years (2004-2008). The soil solution quality in 2010 was also quite comparable to that in earlier years. The NH{sub 4}-N and NO{sub 3}-N concentrations were low at all depths in the mineral soil of the FIP plots 4, 10 and 11. Instead, nitrate concentrations were high in the soil solution on FIP14. There appeared to be a clear overall increase in sulphate concentrations with increasing depth on FIP4 and FIP10. Chloride concentrations in the soil solution were extremely high at all depths on all FIP plots throughout the monitoring period; it is clear that there is a considerable input of NaCl in the deposition derived from the sea. The concentrations of heavy metals (Cd, Cr, Ni, Pb) in the soil solution at all depths at Olkiluoto during 2004-2010 continued in many cases to be close to or below the limit of quantification. In 2010 the monthly level of transpiration in the Scots pine dominated stand was smaller in May and bigger in July than during previous years (2007-2009). Monthly transpiration in the Norway spruce dominated stand was clearly lower in 2010 than in 2007-2009, and there is a

  3. Colloids or artefacts? A TVO/SKB cooperation project in Olkiluoto, Finland

    International Nuclear Information System (INIS)

    Laaksoharju, M.; Vuorinen, U.; Snellman, M.; Helenius, J.; Allard, B.; Pettersson, C.; Hinkkanen, H.


    TVO (Teollisuuden Voima Oy, Finland) initiated a co-operative task with SKB (Swedish Nuclear Fuel and Waste Management Co.) to critically evaluate colloid sampling methods at the test site in Olkiluoto, SW Finland. Three different colloid sampling methods were compared when sampling borehole OL-KR1 at 613-618 m depth. One possible way to make a conservative in-situ colloid estimation is to omit the contribution from calcite precipitation which is considered to be the main artefact. When this is made the inorganic colloid content (size 1-1000 nm) in Olkiluoto is 184 ±177 ppb consisting of clay minerals, silica, pyrite, goethite and magnesium oxide; the concentration of organic substances are around 100 ppb. The in-situ colloid concentration seems to be low which is in good agreement with experiences from years of sampling in similar environment and depths. The exercise shows the many difficulties encountered when sampling colloids. Small error in the planning, pump rate selection, a lack of precautionary measures, artefact sensitivity of the method etc have a tendency to affect significantly the results on the measured ppb colliod level

  4. Assessment of potential perturbations to Posiva's SF repository at Olkiluoto from the ONKALO Facility

    International Nuclear Information System (INIS)

    Alexander, W.R.; Neall, F.B.


    Although the site of the proposed spent fuel repository at Olkiluoto in southwest Finland has been extensively investigated over the last fifteen years, Posiva decided to construct a rock characterisation facility (RCF) at the site to collect more detailed information on the host rock. The data provided by the ONKALO RCF will support the detailed repository design and safety assessment (SA) and will allow construction and disposal methods to be tested under relevant in situ conditions. ONKALO has been so designed that it can act as access routes and auxiliary rooms for the SF repository and so may be in use for the entire operational phase of the repository (currently up to 100 years). Extensive experience from deep mining suggests that such an extended period of operation could have a major impact on both the host rock formation and any nearby facilities, such as the SF repository, and, consequently, Posiva decided to investigate potential perturbations to the repository caused by the existence of ONKALO. A preliminary assessment was carried out in 2003, before construction of the RCF began, and this was recently partially updated in early 2006. This current report represents the most recent update of these reports and has the primary aims of: checking if the previous reports have missed any essential issues; evaluating whether the identified issues have been treated in an appropriate manner; updating the reports in the light of new information. This is carried out based on data from ONKALO itself and on improved understanding of some of the perturbation mechanisms identified in the original studies along with a consideration of newly identified processes. This report differs from the previous studies in addressing the issues in a more SA-oriented manner (for example, focussing the examination of potential perturbations on a re-worked FEP list), allowing the work reported here to be more easily dovetailed with future SA studies on the Olkiluoto repository

  5. Optical imaging of borehole PR10 at Olkiluoto 2006

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.


    Suomen Malmi Oy carried out optical imaging of borehole PR10 at Olkiluoto site in Eurajoki during December 2006. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and the data processing. This report describes the field operation, the equipment as well as the processing procedures and shows the obtained results and their quality. The raw and processed data are delivered digitally in WellCAD and PDF format. (orig.)

  6. Precise levelling campaigns at Olkiluoto in 2006 - 2007

    International Nuclear Information System (INIS)

    Lehmuskoski, P.


    The GPS observation network of Olkiluoto was constructed in 1994 for monitoring crustal deformations in the investigation area. To fulfil a better vertical control of the GPS network, precise levellings were started in the area in autumn 2003. The GPS network was first connected at Lapijoki to the precise levelling network of Finland to control the vertical movements of the whole island of Olkiluoto. Then the GPS network was levelled. It consisted of the reserve marks of eight GPS pillars and five levelling bench marks, two of which constituted the nodal bench mark pair. The second precise levelling campaign on the area was carried out in autumn 2005. Now only the GPS network added with the antenna platforms of nine GPS pillars were levelled. Compared to the other points, the elevation difference of two reserve mark pairs had changed significantly during two years, about one millimetre. The reason may be the blasting of the rock in the neighbourhood of these points and deformation of the rock after the blasting. Inspired by the observed elevation changes in 2005, micro loops were established and levelled onto the ONKALO and the VLJ Repository in autumn 2006. The micro loops consisted of seven and five bench marks the mean interval being about 300 metres. The campaign in autumn 2007 consisted of the levellings of all measured and undestroyed points of the earlier campaigns. The most interesting results were: (1) Compared to the mean theoretical land uplift the nodal bench mark 03216 near the crossing of Olkiluodontie and Satamatie had risen in four years 2.6 mm more than the nodal bench mark of Lapijoki and 1.9 mm of this occurred within the 0.8 mm long interval which separates the island and the continent. (2) During four years the northern part of the island had risen about one millimetre more than the middle part, where the before mentioned 03216 is located. (3) The elevation differences between the bench marks of the ONKALO micro loop were changed even one

  7. Local seismic network at the Olkiluoto site. Annual report for 2010

    International Nuclear Information System (INIS)

    Saari, J.; Malm, M.


    Excavation of the underground characterisation facility (the ONKALO) started in 2004. Before that, in February 2002, Posiva Oy established a local seismic network of six stations on the island of Olkiluoto. After that the number of seismic stations has increased gradually. In 2010 Posiva's permanent seismic network consists of 15 seismic stations and 20 triaxial sensors. The purpose of the microearthquake measurements at Olkiluoto is to improve understanding of the structure, behaviour and long term stability of the bedrock. The investigation area includes two target areas. The larger target area, called seismic semiregional area, covers the Olkiluoto Island and its surroundings. The purpose is to monitor explosions and tectonic earthquakes in regional scale inside that area. The smaller target area is called the seismic ONKALO block, which is a 2 km *2 km *2 km cube surrounding the ONKALO. It is assumed that all the expected excavation induced events occur within this volume. At the moment the seismic ONKALO block includes ten seismic stations. An additional task of monitoring is related to safeguarding of the ONKALO. This report gives the results of microseismic monitoring during 2010. In March 2010, the seismic network was upgraded by a new triaxial borehole seismometer in order to improve the sensitivity and the depth resolution inside the ONKALO block. The sensor is the second one inside the ONKALO. New PC for data processing and analysis with the new version of Linux operating system was installed. Also all software packages for data processing and analysis and for visualization were upgraded. The network has operated continuously in 2010. Altogether 1089 events have been located in the Olkiluoto area, in reported time period. Most of them (943) are explosions occurred inside the seismic semi-regional area and especially inside the seismic ONKALO block (895 events). The magnitudes of the observed explosions inside the semi-regional area range from M L = -1

  8. Chemical and physical properties of the surface sea sediments at the Olkiluoto offshore, South-Western Finland

    International Nuclear Information System (INIS)

    Lahdenperae, A.-M.; Keskinen, A.


    Due to land uplift, the present sea sediments near Olkiluoto will be future land areas, and thus important for the transport of possible releases from nuclear waste repositories at the site. Coastal areas are the transition zones between land and sea, and also potential sites for deep groundwater discharge. The geochemical properties of the surface sediments at the Olkiluoto sea area are summarised in this report. Thirteen sediment samples were cored during the R/V Geomari cruise in autumn 2008. In addition, surface sediment samples from six transects, altogether 57 cores, were taken near the Olkiluoto shoreline by diving in the summer of 2008. The analysis procedure included pH, moisture, dry matter, ash and LOI contents, grain size distribution, carbon and nitrogen analyses and the total concentrations of thirtythree elements. The lateral and vertical distribution of element concentrations, especially heavy metals, is caused by variations in transport and sedimentation patterns of particulate matter, in the occurrence of migration processes and bonding types. The distribution pattern in most of the elements is strongly linked to that of organic matter, carbon and fine-grained material contents. The sediments are strongly enriched by some of the studied elements possibly due to anthropogenic load, while others are only moderately or slightly present. However, the source of different natural and anthropogenic loads is not easy to point out. (orig.)

  9. Exploration of joint systems and major horizontal stress direction in HDR drillholes of the Soultz site (Alsace, France)

    Energy Technology Data Exchange (ETDEWEB)

    Genter, A [BRGM/GIG, Orleans (France); Tenzer, H [Stadtwerke Bad Urach (Germany)


    Borehole imaging logs enable continuous recording of natural and artificial planar discontinuities on the drillhole wall and data of the drillhole geometry to be made. Efforts were made to resolve the orientation and characterization of the natural joint system, the active fault pattern, the alteration zones, the orientation of microcracks and the direction of maximum horizontal stress. Intense logging operations and measurements were carried out in the HDR drillholes GPK1 and EPS1 between 1000 and 3600 m depth in the Muschelkalk, Bunter and Granite at Soultz sous Forets. With the help of investigations on subvertical fractures the orientation of the maximum horizontal stress direction was determined as N175 E{+-}17 . These results are consistent with previous investigations performed in the horeholes GPK-1 and EPS-1. (orig./AKF) [Deutsch] Bohrlochmessungen mit dem akustschen Borehole Televiewer und elektrischen Formation MicroScanner (Imager) sowie dem Azimuthal Resistivity Imager und verschiedenen Sonic-Sonden ermoeglichen eine kontinuierliche Aufnahme sowohl von natuerlichen und kuenstlich erzeugten planaren Diskontinuitaeten an der Bohrlochwand als auch der Bohrlochgeometrie. Es wurden die Orientierung und Charakterisierung des natuerlichen Kluftsystems, das aktive Stoerungsmuster, die Alterationszonen, die Orientierung von Mikrorissen und die Orientierung der maximalen horizontalen Hauptspannungsrichtung ermittelt. Die Verfuegbarkeit von Strukturdaten aus Bohrloechern durch Bohrlochmessungen und hydraulischen Testen ermoeglicht die Bestimmung von hydraulisch aktiven Klueften und deren Beziehung zum regionalen Spannungsfeld. Mit Hilfe spezieller Bohrloch-Logs wurden die Orientierung und Haeufigkeit planarer Diskontinuitaeten und ihre scheinbare Oeffnungsweite sowie die Vorzugsrichtung der verschiedenen scheinbaren Weiten bestimmt. Innerhalb des gemeinsamen europaeischen Hot-Dry-Rock-Geothermal-Forschungsprogramms wurden vielfaeltige Bohrlochmessungen in den

  10. Meteorological data at Olkiluoto in period of 2002-2004

    International Nuclear Information System (INIS)

    Ikonen, A.T.


    In this working report the data of some routine field observations of Posiva Oy and automatic measurements of the Olkiluoto nuclear power plant weather station owned and operated by Teollisuuden Voima Oy is published for further reference. The data reported here covers observations from 2002 to 2004. First, a concise description of data acquisition methods and handling is provided. Thereafter the actual data is presented in the appendices. Weather measurements (e.g. temperature, wind speed and direction, humidity) and snow, ground frost and ditch flow rate observations are reported. (orig.)

  11. {sup 18}O, {sup 2}H and {sup 3}H isotopic composition of precipitation and shallow groundwater in Olkiluoto

    Energy Technology Data Exchange (ETDEWEB)

    Hendriksson, N. [Geological Survey of Finland, Espoo (Finland); Karhu, J.; Niinikoski, P. [Univ. of Helsinki (Finland)


    The isotopic composition of oxygen and hydrogen in local precipitation is a key parameter in the modelling of local water circulation. This study was initiated in order to provide systematic monthly records of the isotope content of atmospheric precipitation in the Olkiluoto area and to establish the relation between local rainfall and newly formed groundwater. During January 2005 - December 2012, a total of 85 cumulative monthly rainfall samples and 68 shallow groundwater samples were collected and the isotopic composition of oxygen and hydrogen was recorded for all those samples. Tritium values are available for 79 precipitation and 65 groundwater samples. Based on the 8-year monitoring, the long-term weighted annual mean isotope values of precipitation and the mean values of shallow groundwater are -11.59 per mille and -11.27 per mille for δ{sup 18}O, - 82.3 per mille and -80.3 per mille for δ{sup 2}H and 9.8 and 9.1 TU for tritium, respectively. Based on these data, the mean stable isotope ratios of groundwater represent the long-term mean annual isotopic composition of local precipitation. The precipitation data were used to establish the local meteoric water line (LMWL) for the Olkiluoto area. The line is formulated as: δ{sup 2}H = 7.45 star δ{sup 18}O + 3.82. The isotope time series reveal a change in time. The increasing trend for the δ{sup 18}O and δ{sup 2}H values may be related to climatic variability while the gradual decline observed in the {sup 3}H data is attributed to the still continuing decrease in atmospheric {sup 3}H activity in the northern hemisphere. The systematic seasonal and long-term tritium trends suggest that any potential ground-level tritium release from the Olkiluoto nuclear power plants is insignificant. The d-excess values of Olkiluoto precipitation during the summer period indicated that a notable amount of re-cycled Baltic Sea water may have contributed to precipitation in the Finnish southern coast. Preliminary estimates

  12. Understanding brittle deformation at the Olkiluoto site. Literature compilation for site characterization and geological modelling

    International Nuclear Information System (INIS)

    Millnes, A.G.


    The present report arose from the belief that geological modelling at Olkiluoto, Finland, where an underground repository for spent nuclear fuel is at present under construction, could be significantly improved by an increased understanding of the phenomena being modelled, in conjunction with the more sophisticated data acquisition and processing methods which are now being introduced. Since the geological model is the necessary basis for the rock engineering and hydrological models, which in turn provide the foundation for identifying suitable rock volumes underground and for demonstrating longterm safety, its scientific basis is of critical importance. As a contribution to improving this scientific basis, the literature on brittle deformation in the Earth's crust has been reviewed, and key references chosen and arranged, with the particular geology of the Olkiluoto site in mind. The result is a compilation of scientific articles, reports and books on some of the key topics, which are of significance for an improved understanding of brittle deformation of hard, crystalline rocks, such as those typical for Olkiluoto. The report is subdivided into six Chapters, covering (1) background information, (2) important aspects of the fabric of intact rock, (3) fracture mechanics and brittle microtectonics, (4) fracture data acquisition and processing, for the statistical characterisation and modelling of fracture systems, (5) the characterisation of brittle deformation zones for deterministic modelling, and (6) the regional geological framework of the Olkiluoto site. The Chapters are subdivided into a number of Sections, and each Section into a number of Topics. The citations are mainly collected under each Topic, embedded in a short explanatory text or listed chronologically without comment. The systematic arrangement of Chapters, Sections and Topics is such that the Table of Contents can be used to focus quickly on the theme of interest without the necessity of looking

  13. Olkiluoto site description 2006

    International Nuclear Information System (INIS)

    Andersson, J.; Ahokas, H.; Hudson, J.A.


    This second version of the Olkiluoto Site Report, produced by the OMTF (Olkiluoto Modelling Task Force), updates the Olkiluoto Site Report 2004 (Posiva 2005) with the data and knowledge obtained up to December 2005. The main product of the modelling has been to develop a descriptive model of the site (the Site Descriptive Model), i.e. a model describing the geometry, properties of the bedrock and the water and the associated interacting processes and mechanisms. For practical reasons, the Site Descriptive Model is divided into five parts: surface system, geology, rock mechanics, hydrogeology and hydrogeochemistry, which are presented in individual chapters. Four separated models are presented: the geological, rock mechanics, hydrogeological and hydrogeochemical models. The consistency between the hydrogeological and hydrogeochemical models is assessed in a joint chapter. Chapter 1 presents an outline of the report, explains the background to its development and sets out its objectives and scope. It is also introduces and explains the integrated modelling methodology, the nomenclature used in the descriptions of the models and the prediction/outcome studies. Chapter 2 provides a brief overview of the data used for producing the Site Description. Chapters 3 to 8 present the descriptive modelling, which involves interpreting data, interpolating or extrapolating between measurement points and calibrating the model against data, based on the various assumptions made about each conceptual model. Chapter 9 presents the results of the prediction/outcome studies performed during 2005 and Chapter 10 the overall consistency and confidence assessment. Overall conclusions are provided in Chapter 11. The main advances since Site Report 2004 are: A new geological model is presented in Chapter 4, representing a significant change from Bedrock Model 2003/1. There has been extensive use of geological data, whereas hydrogeological data have deliberately not been used and more

  14. Plan for safety case of spent fuel repository at Olkiluoto

    International Nuclear Information System (INIS)

    Vieno, T.; Ikonen, A.T.K.


    Posiva aims to present the Safety Case supporting the construction license application of the spent fuel repository at Olkiluoto by 2012. An outline and preliminary assessments will be presented in 2009. Interim reporting and an update of the Safety Case plan will be presented in 2006, as required by the authorities. The KBS-3 disposal concept aims at long-term isolation and containment of spent fuel assemblies in durable copper-iron canisters emplaced in a repository to be constructed at a depth between 400 and 600 metres in crystalline bedrock. By 2012, studies on the KBS-3 disposal concept and site investigations at Olkiluoto will have been continued over about thirty years. The construction of an underground rock characterisation facility (called ONKALO) was started in June 2004. The investigations are carried out in close cooperation with the Swedish SKB developing and assessing the same disposal concept at candidate sites, resembling Olkiluoto, at the other side of the Baltic Sea. A safety case is the synthesis of evidence, analyses and arguments that quantify and substantiate the safety, and the level of expert confidence in the safety, of a planned repository. Posiva's Safety Case will be organised in a portfolio including ten main reports, which will be periodically updated according the overall schedule presented in the plan. The Site report describing the present state and past evolution of the Olkiluoto site, as well as the disturbances caused by the construction of ONKALO and the first stage of the repository, forms the geoscientific basis of the Safety Case. The engineering basis is provided by the reports on the Characteristics of spent fuel, Canister design, and Repository design. The Process report containing descriptions and analyses of features, events and processes potentially affecting the disposal system, and the report on the Evolution of site and repository form the scientific basis of the Safety Case. The latter report will describe and

  15. Geological ductile deformation mapping at the Olkiluoto site, Eurajoki, Finland

    Energy Technology Data Exchange (ETDEWEB)

    Engstroem, J. [Geological Survey of Finland, Espoo (Finland)


    During 2010-2012 eight larger excavated and cleaned outcrops were investigated to study the polyphase nature of the ductile deformation within the Olkiluoto Island. A detailed structural geological mapping together with a thin section study was performed to get a broader and better understanding of the nature and occurrence of these different ductile deformation phases. These outcrops were selected to represent all different ductile deformation phases recognized earlier during the site investigations. The relicts of primary sedimentary structures and products of the earliest deformations (D{sub 0}-D{sub 1}) are mostly obscured by later deformation events. The D{sub 2}-D{sub 4} is the most significant ductile deformation phases occurring on the Olkiluoto Island and almost all structural features can be labeled within these three phases. The outcrops for this investigation were selected mostly from the eastern part of the Olkiluoto Island because that part of the Island has been less investigated previously. As a reference, one outcrop was selected in the western part of the Island where it was previously known that this location had especially well preserved structures of the second deformation phase (D{sub 2}). The S{sub 2} foliation is E-W orientated with moderate dip towards south. A few folds can be associated with this deformational event, mostly having a tight to isoclinal character. During D{sub 3} the migmatites were re-deformed and migrated leucosomes, were intruded mainly parallel to S{sub 3} axial surfaces having a NE-SW orientation. Generally the dip of the S{sub 3} axial surfaces is slightly more steeper (55- 65 deg C) than that of the S{sub 2} axial surfaces, which shows a more moderate dip (40-65 deg C). F{sub 3} fold structures are quite common in the eastern part of Island showing asymmetrical, overturned, shear folds usually with a dextral sense of shear. Large scale D{sub 3} shear structures contain blastomylonites as characteristic fault rocks

  16. Basic Data Report for Drillhole SNL-9 (C-2950)

    International Nuclear Information System (INIS)

    Powers, Dennis W.


    SNL-9 (permitted by the State Engineer as C-2950) was drilled to provide geological data and hydrological testing of the Culebra Dolomite Member of the Permian Rustler Formation within a proposed re-entrant of the margin of halite dissolved from the upper part of the Salado near Livingston Ridge. SNL-9 is located in the southeast quarter of section 23, T22S, R30E, in eastern Eddy County, New Mexico. SNL-9 was drilled to a total depth of 845 ft below the ground surface. Below surface dune sand and the Berino soil, SNL-9 encountered, in order, the Mescalero caliche, Gatuna, Dewey Lake, Rustler, and uppermost Salado Formations. Two intervals were cored: (1) from the lower Forty-niner Member through the Magenta Dolomite and into the upper Tamarisk Member; and (2) from the lower Tamarisk Member through the Culebra Dolomite and Los Medanos Members and into the uppermost Salado Formation. Geophysical logs were acquired from the open hole to total depth, and the drillhole was successfully completed with a screened interval open across the Culebra.

  17. Basic Data Report for Drillhole SNL-9 (C-2950)

    Energy Technology Data Exchange (ETDEWEB)

    Dennis W. Powers; Washington Regulatory and Environmental Services


    SNL-9 (permitted by the State Engineer as C-2950) was drilled to provide geological data and hydrological testing of the Culebra Dolomite Member of the Permian Rustler Formation within a proposed re-entrant of the margin of halite dissolved from the upper part of the Salado near Livingston Ridge. SNL-9 is located in the southeast quarter of section 23, T22S, R30E, in eastern Eddy County, New Mexico. SNL-9 was drilled to a total depth of 845 ft below the ground surface. Below surface dune sand and the Berino soil, SNL-9 encountered, in order, the Mescalero caliche, Gatuna, Dewey Lake, Rustler, and uppermost Salado Formations. Two intervals were cored: 1) from the lower Forty-niner Member through the Magenta Dolomite and into the upper Tamarisk Member; and 2) from the lower Tamarisk Member through the Culebra Dolomite and Los Meda?os Members and into the uppermost Salado Formation. Geophysical logs were acquired from the open hole to total depth, and the drillhole was successfully completed with a screened interval open across the Culebra.

  18. Ground water chemistry and water-rock interaction at Olkiluoto

    International Nuclear Information System (INIS)

    Pitkaenen, P.; Front, K.


    Bedrock investigations for the final repository for low- and intermediate level wastes (VLJ repository) generated at the Olkiluoto (TVO-I and TVO-II) nuclear power plant, stareted in 1980. Since 1988 the area has been investigated for the final disposal of spent nuclear fuel. In the report the geochemistry at the nuclear waste investigation site, Olkiluoto, is evaluated. The hydrogeological data are collected from boreholes drilled down to 1000-m depth into Proterozoic crystalline bedrock. The interpretation is based on groundwater chemistry and isotope data, mineralogical data, and the structure and hydrology of the bedrock, using correlation diagrams and thermodynamic calculations (PHREEQE). The hydrogeochemistry and major processes controlling the groundwater chemistry are discussed. The groundwater types are characterized by water-rock interaction but they also show features of other origins. The fresh and brackish waters are contaminated by varying amounts of young meteoric water and brackish seawater. The saline water contains residues of possibly ancient hydrothermal waters, imprints of which are occasionally seen in the rock itself. Different mixing phenomenas are indicated by the isotope contents (O-l8/H-2, H-3) and the Ca/Cl, Na/Cl, HCO 3 /Cl, SO 4 /Cl, Br/Cl, SI(calcite)/SI(dolomite) ratios. The interaction between bedrock and groundwater is reflected by the behaviour of pH, Eh, Ca, Mg, Na, K, Fe, HCO 3 and S0 4 . Dissolution and precipitation of calcite and pyrite, and aluminosilicate hydrolysis play the major role in defining the groundwater composition of the above components

  19. Eurajoki Olkiluoto study on species of ground beetles and ants 2008

    International Nuclear Information System (INIS)

    Santaharju, J.; Helminen, S.-L.; Yrjoelae, R.


    The species of ants and Ground beetles at Olkiluoto in Eurajoki were studied in the summer of 2008 during two trapping periods: in June and August. The research goal was to clarify the species on Olkiluoto island of the earlier mentioned groups, at least at the family level, and to collect samples for further examination by Posiva. The trapping areas were selected at Olkiluoto in Posiva test monitoring sectors, a part of the trapping areas was the same as the earlier study. Species of ants, depending on their particular species, are a very dominating group of insects. The ants are the most important predators, scavengers and soil movers in Finnish forests. It looks as if the biomass of ants may be more than 10% of the biomass of all animals in certain areas of Finnish forests. In Finland there are about 60 species of ants that have been observed. They have been divided into four sub-groups, which are Myrmicinae, Formicinae, Ponerinae and Dolichoderinae. In Finland there are close to 300 species of ground beetles (Carabidae), which are divided into dozens of different families. The species, to a great extent, consist mostly of predatory insects that prey on microbes in field layers, but a part of them are specialized in feeding on flora. Ground beetles are usually divided into three groups according to their choice of habitat: Species that favour open biotopes, species that favour forests, and generalist species that can thrive in a variety of environments. Ground beetles also reflect changes in their living environment, and possibly they can be significant as socalled bio-indicators. Pitfall traps were used as the method of research. The preservative fluid used was ethanol (50%) with dishwashing liquid to remove surface tension. The points were located in various different biotopes in fields, meadows and forests. The data collected was defined as a minimum for the family level of Ground beetles and for ants to the species or species pairs. The species of Ground

  20. Eurajoki Olkiluoto study on species of ground beetles and ants 2008

    Energy Technology Data Exchange (ETDEWEB)

    Santaharju, J.; Helminen, S.-L.; Yrjoelae, R. (Environmental Research Yrjoelae Ltd, Helsinki (Finland))


    The species of ants and Ground beetles at Olkiluoto in Eurajoki were studied in the summer of 2008 during two trapping periods: in June and August. The research goal was to clarify the species on Olkiluoto island of the earlier mentioned groups, at least at the family level, and to collect samples for further examination by Posiva. The trapping areas were selected at Olkiluoto in Posiva test monitoring sectors, a part of the trapping areas was the same as the earlier study. Species of ants, depending on their particular species, are a very dominating group of insects. The ants are the most important predators, scavengers and soil movers in Finnish forests. It looks as if the biomass of ants may be more than 10% of the biomass of all animals in certain areas of Finnish forests. In Finland there are about 60 species of ants that have been observed. They have been divided into four sub-groups, which are Myrmicinae, Formicinae, Ponerinae and Dolichoderinae. In Finland there are close to 300 species of ground beetles (Carabidae), which are divided into dozens of different families. The species, to a great extent, consist mostly of predatory insects that prey on microbes in field layers, but a part of them are specialized in feeding on flora. Ground beetles are usually divided into three groups according to their choice of habitat: Species that favour open biotopes, species that favour forests, and generalist species that can thrive in a variety of environments. Ground beetles also reflect changes in their living environment, and possibly they can be significant as socalled bio-indicators. Pitfall traps were used as the method of research. The preservative fluid used was ethanol (50%) with dishwashing liquid to remove surface tension. The points were located in various different biotopes in fields, meadows and forests. The data collected was defined as a minimum for the family level of Ground beetles and for ants to the species or species pairs. The species of Ground

  1. Foliation: Geological background, rock mechanics significance, and preliminary investigations at Olkiluoto

    International Nuclear Information System (INIS)

    Milnes, A.G.; Hudson, J.; Wikstroem, L.; Aaltonen, I.


    A well developed, pervasive foliation is a characteristic feature of the migmatites and gneisses in the Olkiluoto bedrock, and is expected to have a significant influence on the underground construction, the design and layout and the groundwater flow regime of a deep spent nuclear fuel repository. This Working Report reviews the geological background and rock mechanics significance of foliation, and develops a methodology for the systematic acquisition of foliation data in cored boreholes and in tunnels at the Olkiluoto site, to provide the necessary basis for future geological, rock mechanics and hydrogeological modelling. The first part of the methodology concerns foliation characterisation, and develops a characterisation scheme based on two variables: the foliation type (G = gneissic, B = banded, S = schistose), which is a function of mineral composition and degree of smallscale heterogeneity, and the foliation intensity (1 = low, 2 = intermediate, 3 = high), which is a function of the type and intensity of the deformation by which it was produced (under high-grade metamorphic conditions in the core of the Svecofennian orogenic belt). At the suggested reference scales (1 m length of core, 10 m 2 area of tunnel wall), the most representative foliation type and intensity is assessed using a standard set of core photographs, which are included as an Appendix at the end of the report, providing a systematic description in terms of 9 descriptive types (G1, G2, G3, B1, B2, B3, S1, S2, S3). As a further step, the rock mechanics significance of these types is assessed and a rock mechanics foliation (RMF) number is assigned (RMF 0 = no significance, RMF 1, RMF 2 and RMF 3 = low, intermediate and high significance, respectively). The second part of the methodology concerns the orientations of the foliation within the same 1 m core lengths or 10 m2 wall areas, which have been characterised as above. This combined analysis of foliation character and foliation orientation

  2. Fracture toughness properties of rocks in Olkiluoto: Laboratory measurements 2008-2009

    Energy Technology Data Exchange (ETDEWEB)

    Siren, T.


    In Olkiluoto an underground rock characterization facility (ONKALO) for the final disposal site of spent nuclear fuel has been under thorough research many years, but further knowledge is needed on fracture toughness parameters. Fracture toughness parameters are important for example in fracture mechanics prediction for Posiva's Olkiluoto Spalling Experiment (POSE). This working report describes a laboratory campaign that was done between 2008 and 2009. The campaign aimed at determining the fracture mechanics parameters as well as density and ultrasonic velocities for Olkiluoto rocks. The specimens delivered were selected by Posiva; the core showed no damage and the quality of the delivered cores was good with varying sample diameter. Most of the test samples (9 out of 12) are gneissic rock. The Mode I fracture toughness was determined using two different methods to account for two different fracturing directions. The methods are the Chevron Bend (CB) test as proposed in the ISRM Suggested Method and a method based on the Brazilian Disk (BD) experiment. The Mode II fracture toughness was determined using the Punch-Through Shear with Confining Pressure experiment on the remaining pieces from the CB testing. The scatter in the results is very large, even within one piece of core sample. Usually the scatter of results is less than 5 %. The high scatter in the data at hand is believed to be due to the very inhomogeneous nature of the rock material. The magnitude of the determined Mode I fracture toughness compares well with available reported data for medium to coarse grained granitoide rocks. However the scatter of the mode II fracture toughness values is higher than experienced on other rock types, but the variability is reasonable for the inhomogeneous rock type. Distinguishing the fracture toughness values for different anisotropy directions would require more thorough testing with quality samples at different anisotropy directions. However since fracture

  3. Chlorine isotopes and their application to groundwater dating at Olkiluoto

    International Nuclear Information System (INIS)

    Gascoyne, M.


    The chlorine isotopes 36 Cl and 37 Cl have been shown to be useful tracers of groundwater, and for investigations of sources of dissolved Cl, mixing of fluids, water-rock interactions in sedimentary environments and in identifying solute sources and transport mechanisms. In addition, the radioactive isotope, 36 Cl, is a useful tracer for determining the residence time of groundwater. This report examines the results of Cl isotopic analysis of groundwaters from as deep as 1000 m at the Olkiluoto site in southwest Finland. Thirty-four samples were analysed for 36 Cl/Cl and 29 were analysed for 37 Cl (expressed as δ 37 Cl). The value δ 37 Cl was found to stabilize at higher salinities and the maximum range of δ 37 Cl was from about - 0.6 to +0.6 per mille. Because of this limited range and the relatively large error margins associated with the δ 37 Cl measurement, the usefulness of this ratio appears to be limited. Therefore, the main part of this report is largely focused on 36 Cl. Estimation of residence time of 36 Cl gives results that support the presence of at least five groundwater types at Olkiluoto. The consistency of 36 Cl/Cl ratios in groundwaters of several widely separated, deep locations and different rock compositions, suggests that these deeper groundwaters are in secular equilibrium and, therefore, likely to be older than 1.5 million years. (orig.)

  4. Electromagnetic Sampo monitoring soundings at Olkiluoto 2010

    International Nuclear Information System (INIS)

    Korhonen, K.; Korpisalo, A.; Ojamo, H.


    The Geological Survey of Finland has carried out electromagnetic frequency-domain depth soundings at fixed measurement stations in Olkiluoto annually since 2004. The purpose of the soundings is to monitor the groundwater conditions in the vicinity of the ONKALO rock characterization facility which will ultimately be part of the final nuclear waste disposal facility for the Finnish nuclear power companies. A new monitoring survey was carried out at the turn of May-June 2010. The survey resulted in 38 successfully performed soundings at 10 stations. The data set spanning the time period of 2004 to 2010 was interpreted with layered-earth models. Most of the interpretations indicate no systematic changes in the level of deep saline groundwater. However, at one station there are indications of a systematic rise in the groundwater level. (orig.)

  5. Safety case for the disposal of spent nuclear fuel at Olkiluoto. Complementary considerations 2012

    Energy Technology Data Exchange (ETDEWEB)



    Complementary Considerations sits within Posiva Oy's Safety Case 'TURVA-2012' report portfolio and has the objective of enhancing confidence in the outcomes of the safety assessment for a spent nuclear fuel repository to be constructed at Olkiluoto, Finland. The main emphasis in this report is on the evidence and understanding that can be gained from observations at the site, including its regional geological environment, and from natural and anthropogenic analogues for the repository, its components and the processes that affect safety. In particular, the report addresses diverse and less quantifiable types of evidence and arguments that are enclosed to enhance confidence in the outcome of the safety assessment. These complementary considerations have been described as evaluations, evidence and qualitative supporting arguments that lie outside the scope of the other reports of the quantitative safety assessment. The experience with natural analogues for the long-term durability of the materials involved and the extent of processes provides high confidence in our understanding of the disposal system and its evolution. For each engineered barrier and key process, there is increasing analogue evidence to support the conceptual models and parameters. Regarding the suitability of the Olkiluoto site to host a spent fuel repository, a number of factors have been identified that indicate the suitability of crystalline host rock in general, and that of the Olkiluoto site in particular. The report also provides radiation background information for the use of complementary indicators, which aid in putting the results of the safety analysis presented in Assessment of Radionuclide Release Scenarios for the Repository System and Biosphere Assessment in a broader perspective to show that the radiation originating from a spent nuclear fuel repository remains in most cases much below natural background radiation or that caused by non-nuclear industries. (orig.)

  6. Safety case for the disposal of spent nuclear fuel at Olkiluoto. Complementary considerations 2012

    International Nuclear Information System (INIS)


    Complementary Considerations sits within Posiva Oy's Safety Case 'TURVA-2012' report portfolio and has the objective of enhancing confidence in the outcomes of the safety assessment for a spent nuclear fuel repository to be constructed at Olkiluoto, Finland. The main emphasis in this report is on the evidence and understanding that can be gained from observations at the site, including its regional geological environment, and from natural and anthropogenic analogues for the repository, its components and the processes that affect safety. In particular, the report addresses diverse and less quantifiable types of evidence and arguments that are enclosed to enhance confidence in the outcome of the safety assessment. These complementary considerations have been described as evaluations, evidence and qualitative supporting arguments that lie outside the scope of the other reports of the quantitative safety assessment. The experience with natural analogues for the long-term durability of the materials involved and the extent of processes provides high confidence in our understanding of the disposal system and its evolution. For each engineered barrier and key process, there is increasing analogue evidence to support the conceptual models and parameters. Regarding the suitability of the Olkiluoto site to host a spent fuel repository, a number of factors have been identified that indicate the suitability of crystalline host rock in general, and that of the Olkiluoto site in particular. The report also provides radiation background information for the use of complementary indicators, which aid in putting the results of the safety analysis presented in Assessment of Radionuclide Release Scenarios for the Repository System and Biosphere Assessment in a broader perspective to show that the radiation originating from a spent nuclear fuel repository remains in most cases much below natural background radiation or that caused by non-nuclear industries. (orig.)

  7. Safety case for the disposal of spent nuclear fuel at Olkiluoto. Complementary considerations 2012

    Energy Technology Data Exchange (ETDEWEB)



    Complementary Considerations sits within Posiva Oy's Safety Case 'TURVA-2012' report portfolio and has the objective of enhancing confidence in the outcomes of the safety assessment for a spent nuclear fuel repository to be constructed at Olkiluoto, Finland. The main emphasis in this report is on the evidence and understanding that can be gained from observations at the site, including its regional geological environment, and from natural and anthropogenic analogues for the repository, its components and the processes that affect safety. In particular, the report addresses diverse and less quantifiable types of evidence and arguments that are enclosed to enhance confidence in the outcome of the safety assessment. These complementary considerations have been described as evaluations, evidence and qualitative supporting arguments that lie outside the scope of the other reports of the quantitative safety assessment. The experience with natural analogues for the long-term durability of the materials involved and the extent of processes provides high confidence in our understanding of the disposal system and its evolution. For each engineered barrier and key process, there is increasing analogue evidence to support the conceptual models and parameters. Regarding the suitability of the Olkiluoto site to host a spent fuel repository, a number of factors have been identified that indicate the suitability of crystalline host rock in general, and that of the Olkiluoto site in particular. The report also provides radiation background information for the use of complementary indicators, which aid in putting the results of the safety analysis presented in Assessment of Radionuclide Release Scenarios for the Repository System and Biosphere Assessment in a broader perspective to show that the radiation originating from a spent nuclear fuel repository remains in most cases much below natural background radiation or that caused by non-nuclear industries. (orig.)

  8. Environmental radioactivity data of Olkiluoto in 1977-1983 and 2002-2003

    International Nuclear Information System (INIS)

    Roiviainen, P.


    In this report, data of the environmental radiation surveillance programme of the Olkiluoto nuclear power plant is published in a collected format for further reference. The data reported consists of analysis results of selected environmental media and indicator organisms representing human food web, and it covers periods of 1977-1983 and 2002-2003. In addition to sampling and analysis results, also a concise description of data acquisition methods - when still traceable - and handling is provided as well as locations of sampling sites. (orig.)

  9. Evaluation of the radioactive waste characterisation at the Olkiluoto nuclear power plant

    International Nuclear Information System (INIS)

    Kekki, T.; Titta, A.


    The aim of this study is to evaluate the physical, chemical and radiological characterisation, handling and documentation of the radioactive waste packages to be disposed of in the VLJ-repository at the Olkiluoto NPP. A comparison with the current practices in Europe, based on information from Sweden, Spain and Czech Republic, is made. The report presents recommendations for STUK to harmonise the LILW waste management practises in Finland with those in Europe. (orig.)

  10. Regional distribution of microbes in groundwater from Haestholmen, Kivetty, Olkiluoto and Romuvaara, Finland

    Energy Technology Data Exchange (ETDEWEB)

    Haveman, S.A.; Nilsson, E.L.; Pedersen, K. [Goeteborg University (Sweden)


    Groundwater was sampled with the PAVE groundwater sampling system from eight boreholes at Haestholmen, Kivetty, Olkiluoto and Romuvaara, Finland, in 1998 and 1999, for investigation of microbial populations. The groundwater samples had a wide range of salinity and chemistry and contained 104-105 cells per ml, which is typical for subsurface groundwater. In preparing culture media, two approaches were used and compared. Natural, groundwater-based media were prepared from groundwater from the same section of each borehole tested, and synthetic media were prepared based on groundwater chemistry data. No significant difference was observed between the two types of media for brackish and saline groundwater. The groundwater to a depth of 750 m contained mainly sulphate-reducing bacteria (SRB), ironreducing bacteria (IRB) and heterotrophic acetogenic (HA) bacteria. Autotrophic acetogenic (AA) bacteria and methanogenic archaea were found in some samples. Iron-reducing and HA bacteria predominated in brackish groundwater from Haestholmen, with SRB present in smaller numbers. A different microbial population was found in deep saline groundwater from Haestholmen and Olkiluoto that consists of a large proportion of a saline or brine end member. No SRB or AA bacteria were cultured; instead, the microbial population consisted of HA bacteria and either IRB or methanogens. In Olkiluoto, SRB predominated in the brackish and saline groundwater at depths to about 500 m, while methanogens were found in deeper saline groundwater. Stable isotope data (C-13) indicated that the methanogens are part of an autotrophic population consuming dissolved inorganic carbon (DIC) and hydrogen and producing methane and organic carbon. This deep ecosystem may be independent of surface life processes. A high-level radioactive waste (HLW) repository at 500 m depth in the Fennoscandian Shield will be inhabited by SRB, IRB and acetogens. Methanogens may also be present. These anaerobic micro

  11. Groundwater salinity at Olkiluoto and its effects on a spent fuel repository

    Energy Technology Data Exchange (ETDEWEB)

    Vieno, T. [VTT Energy, Espoo (Finland)


    The Olkiluoto island rose from the Baltic Sea 2500 to 3000 years ago. The layered sequence of groundwaters can be related to climatic and shoreline changes from modern tune through former Baltic stages to the deglaciation phase about 10 000 years ago and even to preglacial times. Fresh groundwater is found to the depth of about 150 metres, brackish between 100 and 400 metres, deeper groundwaters are saline. At the depth of 500 meters, the content of Total Dissolved Solids (TDS) varies between 10 and 25 g/l. The most saline waters at depths greater than 800 metres have TDS values between 30 and 75 g/l. These deep saline waters seem to have been undisturbed during the most recent glaciation and even much longer in the past. Today fresh water infiltrating at the surface gradually displaces brackish and saline groundwater in the bedrock. Due to the still ongoing postglacial land uplift, Olkiluoto is likely to become an inland site with brackish or fresh groundwater at the depth of 500 metres within the next 10 000 years. During the construction and operation phases groundwater will be drawn into the repository from the surrounding bedrock. As a consequence, more saline groundwaters, presently laying 100 to 200 metres below the repository level, may rise to the disposal level. After the closing of the repository the salinity distribution will gradually return towards the natural state. During the glacial cycle groundwater salinity may increase, for example, during freezing of groundwater into permafrost, when dissolved solids concentrate in the remaining water phase, and in a situation where deep saline groundwaters from under the centre of the glacier are pushed to the upper parts of the bedrock at the periphery of the glacier. The most significant open issue related to saline groundwater is the performance of the tunnel backfill which in the BS-3 concept has been planned to consist of a mixture of crushed rock and 10-30% of bentonite. Saline groundwater may

  12. Characterization of Olkiluoto bacterial and archaeal communities by 454 pyrosequencing

    Energy Technology Data Exchange (ETDEWEB)

    Bomberg, M.; Nyyssoenen, M.; Itaevaara, M. [VTT Technical Research Centre of Finland, Espoo (Finland)


    Recent advancement in sequencing technologies, 'Next Generation Sequencing', such as FLX 454 pyrosequencing has made it possible to obtain large amounts of sequence data where previously only few sequences could be obtained. This technique is especially useful for the study of community composition of uncultured microbial populations in environmental samples. In this project, the FLX 454 pyrosequencing technique was used to obtain up to 20 000 16S rRNA sequences or 10 000 mRNA sequences from each sample for identification of the microbial species composition as well as for comparison of the microbial communities between different samples. This project focused on the characterization of active microbial communities in the groundwater at the final disposal site of high radioactive wastes in Olkiluoto by FLX 454 pyrosequencing of the bacterial and archaeal ribosomal RNA as well as of the mRNA transcripts of the dsrB gene and mcrA gene of sulphate reducing bacteria and methanogenic archaea, respectively. Specific emphasis was put on studying the relationship of active and latent sulphate reducers and methanogens by qPCR due to their important roles in deep geobiochemical processes connected to copper corrosion. Seven packered boreholes were sampled anaerobically in Olkiluoto during 2009-2010. Groundwater was pumped from specific depths and the microbial cells werecollected by filtration on a membrane. Active microbial communities were studied based on RNA extracted from the membranes and translated to copy DNA, followed by sequencing by 454 Tag pyrosequencing. A total of 27 different bacterial and 17 archaeal taxonomic groups were detected.

  13. Characterization of Olkiluoto bacterial and archaeal communities by 454 pyrosequencing

    Energy Technology Data Exchange (ETDEWEB)

    Bomberg, M; Nyyssoenen, M; Itaevaara, M [VTT Technical Research Centre of Finland, Espoo (Finland)


    Recent advancement in sequencing technologies, 'Next Generation Sequencing', such as FLX 454 pyrosequencing has made it possible to obtain large amounts of sequence data where previously only few sequences could be obtained. This technique is especially useful for the study of community composition of uncultured microbial populations in environmental samples. In this project, the FLX 454 pyrosequencing technique was used to obtain up to 20 000 16S rRNA sequences or 10 000 mRNA sequences from each sample for identification of the microbial species composition as well as for comparison of the microbial communities between different samples. This project focused on the characterization of active microbial communities in the groundwater at the final disposal site of high radioactive wastes in Olkiluoto by FLX 454 pyrosequencing of the bacterial and archaeal ribosomal RNA as well as of the mRNA transcripts of the dsrB gene and mcrA gene of sulphate reducing bacteria and methanogenic archaea, respectively. Specific emphasis was put on studying the relationship of active and latent sulphate reducers and methanogens by qPCR due to their important roles in deep geobiochemical processes connected to copper corrosion. Seven packered boreholes were sampled anaerobically in Olkiluoto during 2009-2010. Groundwater was pumped from specific depths and the microbial cells werecollected by filtration on a membrane. Active microbial communities were studied based on RNA extracted from the membranes and translated to copy DNA, followed by sequencing by 454 Tag pyrosequencing. A total of 27 different bacterial and 17 archaeal taxonomic groups were detected.

  14. Characterization of Olkiluoto bacterial and archaeal communities by 454 pyrosequencing

    International Nuclear Information System (INIS)

    Bomberg, M.; Nyyssoenen, M.; Itaevaara, M.


    Recent advancement in sequencing technologies, 'Next Generation Sequencing', such as FLX 454 pyrosequencing has made it possible to obtain large amounts of sequence data where previously only few sequences could be obtained. This technique is especially useful for the study of community composition of uncultured microbial populations in environmental samples. In this project, the FLX 454 pyrosequencing technique was used to obtain up to 20 000 16S rRNA sequences or 10 000 mRNA sequences from each sample for identification of the microbial species composition as well as for comparison of the microbial communities between different samples. This project focused on the characterization of active microbial communities in the groundwater at the final disposal site of high radioactive wastes in Olkiluoto by FLX 454 pyrosequencing of the bacterial and archaeal ribosomal RNA as well as of the mRNA transcripts of the dsrB gene and mcrA gene of sulphate reducing bacteria and methanogenic archaea, respectively. Specific emphasis was put on studying the relationship of active and latent sulphate reducers and methanogens by qPCR due to their important roles in deep geobiochemical processes connected to copper corrosion. Seven packered boreholes were sampled anaerobically in Olkiluoto during 2009-2010. Groundwater was pumped from specific depths and the microbial cells werecollected by filtration on a membrane. Active microbial communities were studied based on RNA extracted from the membranes and translated to copy DNA, followed by sequencing by 454 Tag pyrosequencing. A total of 27 different bacterial and 17 archaeal taxonomic groups were detected

  15. Meteorological data and update of climate statistics of Olkiluoto 2005 - 2006

    International Nuclear Information System (INIS)

    Ikonen, A.T.K.


    In this working report the data of some routine field observations of Posiva Oy and automatic measurements of the Olkiluoto nuclear power plant weather station owned and operated by Teollisuuden Voima Oy is published for further reference. The data reported here covers observations in 2005-2006. First, a concise description of data acquisition methods and handling is provided. Thereafter the actual data is presented in the appendices. Weather measurements (e.g. temperature, wind speed and direction, humidity) and snow and ground frost observations are reported. (orig.)

  16. Geological model of the ONKALO area version 0

    International Nuclear Information System (INIS)

    Paananen, M.; Paulamaeki, S.; Gehoer, S.; Kaerki, A.


    The geological model of the ONKALO area is composed of four submodels: ductile deformation model, lithological model, brittle deformation model and alteration model. The ductile deformation model describes and models the products of polyphase ductile deformation, which facilitates the definition of dimensions and geometrical properties of individual lithological units determined in the lithological model. The lithological model describes the properties of rock units that can be defined on the basis the migmatite structures, textures and modal compositions. The brittle deformation model describes the products of multiple phases of brittle deformation, and the alteration model describes the types, occurrence and the effects of the hydrothermal alteration. On the basis of refolding and crosscutting relationships, the metamorphic supracrustal rocks have been subject to five stages of ductile deformation. This resulted in a pervasive, composite foliation which shows a rather constant attitude in the ONKALO area. Based on observations in outcrops, investigation trenches and drill cores, 3D modelling of the lithological units is carried out assuming that the contacts are quasiconcordant. Using this assumption, the strike and dip of the foliation has been used as a tool to correlate the lithologies between the drillholes, and from surface and tunnel outcrops to drillholes. Consequently, the strike and dip of the foliation has been used as a tool, through which the lithologies have been correlated between the drillholes and from surface to drillholes. The rocks at Olkiluoto can be divided into two major groups: (1) supracrustal high-grade metamorphic rocks including various migmatitic gneisses, homogeneous tonaliticgranodioritic- granitic gneisses, mica gneisses and quartzitic gneisses, and mafic gneisses, (2) igneous rocks, including pegmatitic granites and diabase dykes. The migmatitic gneisses can further be divided into three subgroups in terms of the type of migmatite

  17. Olkiluoto hydrogeochemistry. A 3-D modelling approach for sparce data set

    International Nuclear Information System (INIS)

    Luukkonen, A.; Partamies, S.; Pitkaenen, P.


    Olkiluoto at Eurajoki has been selected as a candidate site for final disposal repository for the used nuclear waste produced in Finland. In the long term safety assessment, one of the principal evaluation tools of safe disposal is hydrogeochemistry. For assessment purposes Posiva Oy excavates in the Olkiluoto bedrock an underground research laboratory (ONKALO). The complexity of the groundwater chemistry is characteristic to the Olkiluoto site and causes a demand to examine and visualise these hydrogeochemical features in 3-D together with the structural model. The need to study the hydrogeochemical features is not inevitable only in the stable undisturbed (pre-excavational) conditions but also in the disturbed system caused by the construction activities and open-tunnel conditions of the ONKALO. The present 3-D approach is based on integrating the independently and separately developed structural model and the results from the geochemical mixing calculations of the groundwater samples. For spatial geochemical regression purposes the study area is divided into four primary sectors on the basis of the occurrence of the samples. The geochemical information within the four primary sector are summed up in the four sector centroids that sum-up the depth distributions of the different water types within each primary sector area. The geographic locations of the centroids are used for secondary division of the study area into secondary sectors. With the aid of secondary sectors spatial regressions between the centroids can be calculated and interpolation of water type fractions within the centroid volume becomes possible. Similarly, extrapolations outside the centroid volume are possible as well. The mixing proportions of the five detected water types in an arbitrary point in the modelling volume can be estimated by applying the four centroids and by using lateral linear regression. This study utilises two separate data sets: the older data set and the newer data set. The

  18. Investigation plan for infiltration experiment in Olkiluoto

    International Nuclear Information System (INIS)

    Lehtinen, A.; Lindgren, S.; Ikonen, A.


    A three-year field experiment to investigate potential changes in pH and redox conditions, and in buffering capacity as well as the hydrogeochemical processes related to groundwater infiltration is designed for implementation in the vicinity of ONKALO. The idea is to monitor the major infiltration flow path from the ground surface into the upper part of ONKALO at about 50 to 100 m depth depending on the observations made during the experiment. The geochemical evolution of the groundwater is strongly affected by infiltration from the surface. In natural conditions in Olkiluoto most of the geochemical reactions occur along the first few tens of metres of the flow path, in an interface between anaerobic and aerobic conditions. The dissolved aggressive agents, CO 2 and O 2 , of the infiltrating water are consumed and the hydrogeochemistry stabilises on neutral and anaerobic conditions due to weathering processes. As a consequence of this evolution, reaction fronts are formed in the flow channels between acid-neutral and aerobic-anaerobic interfaces. The construction of ONKALO may, however, increase the hydraulic gradient and flow into bedrock, which can move these fronts to deeper depths and decrease the buffering capacity of the rock fractures against surficial water infiltration. Detailed integration of hydrogeochemical (including microbiology), geological and hydrogeological studies is essential for a successful experiment. Accurate hydrogeochemical and hydrogeological data that will be collected during this experiment are used in coupled modelling exercises (P/O studies in site reports), which will be carried out to evaluate the movements of the reaction fronts and the buffering capacity of Olkiluoto bedrock against surficial water infiltration. Good quality information is also necessary for calibrating predictive calculations for the safety case estimating future evolution of the site. In addition to the geochemical targets, the experiment can be used in

  19. Paleohydrogeological implications from fracture calcites and sulfides in a major hydrogeological zone HZ19 at Olkiluoto

    International Nuclear Information System (INIS)

    Sahlstedt, E.; Karhu, J.; Rinne, K.


    30 samples of fracture mineral fillings in or near water conducting fractures at Olkiluoto were collected from 10 drill cores for fracture mineral studies. The aim of the study was to obtain information about past hydrogeochemical conditions at Olkiluoto using the calcite morphology, the chemical characteristics and the isotopic composition of carbon and oxygen in calcite. The chemical composition of fracture calcites at Olkiluoto is nearly stoichiometric CaCO 3 . Most variation in the composition of calcite is due to differences in the Mn content, which could indicate variations in groundwater redox conditions. Meaningful REE patterns were obtained for the calcites. REE patterns showed generally negative Eu anomalies, but one fracture calcite specimen had a distinct positive Eu anomaly. This positive anomaly could be related to ancient hydrothermal conditions, although derivation of the anomaly from the host rock cannot be excluded. Preliminary results for calcite U-Th dating of fracture calcites are reported. The isotopic composition of U and Th were analysed by a new multiple collector LA-ICPMS instrument. U and Th concentrations in fracture calcites are generally 18 O values of calcite range from -17 to -7 per mille. Most of the calcites may have been precipitated in the presence of waters with oxygen isotope ratios similar to those in the present-day groundwaters at Olkiluoto. Two samples with an oxygen isotopic composition highly depleted in 18 O were interpreted to have been precipitated at elevated temperatures. The δ 13 C values of calcite showed a wide range of values from -26 to +35 per mille. Multiple sources for carbon are implied. The highest δ 13 C values indicate methanic conditions in the fracture at the time of calcite precipitation. It appears that the methanic environment has earlier extended to shallower depths compared to the location of the methanic environment in the present-day fracture system (> 300 m). Ten pyrite samples were analysed

  20. pp and ̄pp elastic scattering

    Directory of Open Access Journals (Sweden)

    A. Donnachie


    Full Text Available We present an analysis of pp and ̄pp elastic scattering in terms of various exchanges. Three-gluon exchange dominates at large t, and single-pomeron exchange at small t. The dip seen in high-energy pp scattering is provided by the interference of both of these with double-pomeron exchange. We predict that this dip will not be found in high-energy ̄pp scattering. The dip that is seen in low-energy ̄pp scattering is the result of the additional presence of reggeon-pomeron exchange.

  1. Local seismic network at the Olkiluoto site. Annual report for 2009

    International Nuclear Information System (INIS)

    Saari, J.; Malm, M.


    Excavation of the underground characterisation facility (the ONKALO) started in 2004. Before that, in February 2002, Posiva Oy established a local seismic network of six stations on the island of Olkiluoto. After that the number of seismic stations has increased gradually. In 2009 Posiva's seismic network consists of 14 seismic stations and 19 triaxial sensors. The purpose of the microearthquake measurements at Olkiluoto is to improve understanding of the structure, behaviour and long term stability of the bedrock. The investigation area includes two target areas. The larger target area, called seismic semiregional area, covers the Olkiluoto Island and its surroundings. The purpose is to monitor explosions and tectonic earthquakes in regional scale inside that area. The smaller target area is called the seismic ONKALO block, which is a 2 km *2 km *2 km cube surrounding the ONKALO. It is assumed that all the expected excavation induced events occur within this volume. At the moment the seismic ONKALO block includes ten seismic stations. An additional task of monitoring is related to safeguarding of the ONKALO. This report gives the results of microseismic monitoring during 2009. Also the changes in the structure and the operation procedure of the network are described. The upgrades in 2009 are limited to the processing, interpretation and reporting practices. The latest upgrades of the equipment were done in November 2008. The final technical tuning and tests related to the upgrade were done in the beginning of 2009. The network has operated continuously in 2009. Altogether 1256 events have been located in the Olkiluoto area, in reported time period. Most of them (1161) are explosions occurred inside the seismic semi-regional area and especially inside the seismic ONKALO block (1135 events). The magnitudes of the observed events inside the semi-regional area range from ML = -1.5 to ML = 1.6 (ML = magnitude in local Richter's scale). Most of them are explosions. Two

  2. Final disposal of spent nuclear fuel in Finnish bedrock. Olkiluoto site report

    Energy Technology Data Exchange (ETDEWEB)

    Anttila, P. [Fortum Engineering Oy, Vantaa (Finland); Ahokas, H. [Fintact Oy, Helsinki (Finland); Front, K. [VTT Communication and Infrastructure, Espoo (Finland)] [and others


    Posiva Oy is studying the Finnish bedrock for the geological disposal of spent nuclear fuel. The study is based on the site selection research programme started originally in 1983. The programme is in accordance with the decision in principle by the Council of State in 1983 and aims at the selection of one site in 2000. Four sites, Haestholmen in Loviisa, Kivetty in Aeaenekoski, Olkiluoto in Eurajoki and Romuvaara in Kuhmo, have been studied in detail. This report summarises the results of the site investigations carried out at Olkiluoto. The bedrock of the Olkiluoto site consists of Svecofennian metasediments and platonic rocks, 1800-1900 million years in age. Migmatitic mica gneiss is the most abundant rock type, and is intruded by foliated tonalites and granodiorites and massive coarse-grained granites and pegmatites. Five successive plastic deformation phases have been defined. In total, 30 bedrock structures (R-structures) have been modelled at the site. Most of these represent steeply dipping fracture zones, but several sub-horizontal zones, gently dipping to the SE, have also been identified. The rock mass between the fracture zones represents what is termed `intact rock`, which is typically hard, unweathered and sparsely fractured. The R-structures are generally hydraulically more conductive than the intact rock and their mean transmissivity is 3 x 10{sup -7} m{sup 2}/s. The corresponding mean of the hydraulic conductivity values for the intact rock measured using a 2 m packer interval, is 8 x 10{sup -13} m/s, if a lognormal distribution for all measured values is assumed. A clear decrease in hydraulic conductivity with depth has been found for the intact rock, and there seems to be a parallel decrease in the transmissivity of structures. In addition, the hydraulically conductive fractures seem to be more frequent and their transmissivities higher in the uppermost 100 - 200 m of the bedrock than at greater depths. The groundwater chemistry reflects the

  3. Final disposal of spent nuclear fuel in Finnish bedrock. Olkiluoto site report

    International Nuclear Information System (INIS)

    Anttila, P.; Ahokas, H.; Front, K.


    Posiva Oy is studying the Finnish bedrock for the geological disposal of spent nuclear fuel. The study is based on the site selection research programme started originally in 1983. The programme is in accordance with the decision in principle by the Council of State in 1983 and aims at the selection of one site in 2000. Four sites, Haestholmen in Loviisa, Kivetty in Aeaenekoski, Olkiluoto in Eurajoki and Romuvaara in Kuhmo, have been studied in detail. This report summarises the results of the site investigations carried out at Olkiluoto. The bedrock of the Olkiluoto site consists of Svecofennian metasediments and platonic rocks, 1800-1900 million years in age. Migmatitic mica gneiss is the most abundant rock type, and is intruded by foliated tonalites and granodiorites and massive coarse-grained granites and pegmatites. Five successive plastic deformation phases have been defined. In total, 30 bedrock structures (R-structures) have been modelled at the site. Most of these represent steeply dipping fracture zones, but several sub-horizontal zones, gently dipping to the SE, have also been identified. The rock mass between the fracture zones represents what is termed 'intact rock', which is typically hard, unweathered and sparsely fractured. The R-structures are generally hydraulically more conductive than the intact rock and their mean transmissivity is 3 x 10 -7 m 2 /s. The corresponding mean of the hydraulic conductivity values for the intact rock measured using a 2 m packer interval, is 8 x 10 -13 m/s, if a lognormal distribution for all measured values is assumed. A clear decrease in hydraulic conductivity with depth has been found for the intact rock, and there seems to be a parallel decrease in the transmissivity of structures. In addition, the hydraulically conductive fractures seem to be more frequent and their transmissivities higher in the uppermost 100 - 200 m of the bedrock than at greater depths. The groundwater chemistry reflects the postglacial

  4. World-class outage performance of the Olkiluoto nuclear power plant

    International Nuclear Information System (INIS)

    Paavola, M.


    The production of the Olkiluoto power plant units covered 17% of the electricity consumption in Finland in 1997; the total share of nuclear energy was 27% of the electricity consumed in the country. Based on Finnish experience, nuclear energy is a safe, environmentally friendly and economic way to produce electricity provided that the plants and their personnel are well taken care of. TVO's policy is to keep the plant units in good condition and technically modern. This requires continuous investments in the plant. In maintenance, attention is paid to monitoring the condition of the plant and to preventive maintenance aiming at avoiding disturbances in production. TVO has chosen continuous development as the operational line develops the plant by annual investments and performs the necessary modifications during planned annual outages trying to avoid long production interruptions. The load factors of the Olkiluoto nuclear power plant have been high. The average load factor during the last decade was over 93%. The most significant single factor in the production deficits is the amount or electricity, which has not been produced because of the annual outages. Due to this, special attention has been paid to the performance of the annual outages. TVO aims at continuous development of the annual outage procedure. A centralized task management system makes it possible to perform simultaneously more tasks than before. The company has also invested in equipment and systems, which ease and speed up servicing. Normal outage length varies between 10 and 16 days. By keeping the plant units as modern as possible and in good condition we facilitate reaching TVO's target, which is also stated in TVO's slogan 'always 40 years lifetime'. (author)

  5. 7 CFR 1260.122 - Promotion. (United States)


    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Promotion. 1260.122 Section 1260.122 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE BEEF PROMOTION AND RESEARCH Beef Promotion and Research Order Definitions § 1260.122 Promotion. Promotion means any action, including paid...

  6. 34 CFR 300.122 - Evaluation. (United States)


    ... 34 Education 2 2010-07-01 2010-07-01 false Evaluation. 300.122 Section 300.122 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND... DISABILITIES State Eligibility Additional Eligibility Requirements § 300.122 Evaluation. Children with...

  7. Nuclear power plant Olkiluoto 3. Containment leakage test under extreme conditions

    Energy Technology Data Exchange (ETDEWEB)

    Fleckenstein, Tobias [TUEV SUED Industrie Service GmbH, Munich (Germany). Measaruement Technology Dept.


    Modern nuclear power plants place high demands on the design and execution of safety checks. TUEV SUED supported the containment leakage test for the largest- capacity third generation nuclear power plant in the world - Olkiluoto 3 in Finland. The experts successfully met the challenges presented by exceptional parameters of the project. The containment of Olkiluoto 3 is unique in that the vessel's volume is 80,000 m{sup 3} while measurements were carried out over a period of ten days. To execute the test, 75 temperature and 15 humidity sensors had to be installed and correctly interlinked by more than ten kilometres of cable. These instruments also needed to withstand an absolute pressure of 6 bar, ambient temperatures of 30 C and high levels of humidity. These conditions required comprehensive preparation and a high amount of qualification tests. Parts of the qualifications were carried out at the autoclave system of the Technical University in Munich, Germany, where the project test conditions could be simulated. The software required to determine the tests was developed by TUEV SUED and verified by German's national accreditation body DAkkS under ISO 17025. TUEV SUED enabled the test schedule to continue without delay by analysing all recorded data continuously on site, including pressure, temperature, humidity and leakage mass flow curves. With the comprehensive preparation, data acquisition system recording measurements continuously and the on-time result calculation, all components of the leak-tightness assessment were successfully completed in accordance with requirements.

  8. Study of pp{yields}pp{eta} reaction at threshold; Etude de la reaction pp{yields}pp{eta} au seuil

    Energy Technology Data Exchange (ETDEWEB)

    Taleb, A


    The {eta} production has been studied through the pp {yields} pp{eta} reaction at threshold. Data were taken at the Synchrotron of the ``Laboratoire National Saturne``. The detection in coincidence of the two protons scattered near 0 deg and analysed with the magnetic spectrometer SPES3 allows the reconstruction of missing mass spectra for the {eta} signature. A simulation program which takes into account all the experimental set up characteristics has been realized and tested through the pp {yields} d{pi}{sup +} reaction detected simultaneously with pp {yields} pp{eta}. The generated proton momentum spectra for pp {yields} pp{eta} show a pronounced {eta} mass dependence. This characteristic, connected to the kinematical properties of pp {yields} pp{eta} at threshold, is used to extract the mass of the meson {eta}. The obtained value, m{sub {eta}} = 547.65 {+-} 0.18 MeV, is in good agreement with measurement done recently through the pd {yields} {sup H}e{eta} reaction. The total cross section {sigma}{sub t} of pp {yields} pp{eta} measured at 1260, 1265 and 1300 MeV presents a strong energy dependence. This cross section increases less with energy than the phase-space. The influence of p-p and {eta}-p final state interactions in our measurements is studied. Our results are compared with theoretical predictions and assess the dominant character of the baryonic resonance N{sup *}(1535) in the {eta} mechanism production at threshold. These experimental results give an energy dependence which is not well reproduced by the theoretical predictions. This discrepancy could be an incorrect description of the {eta}-p interaction in the models. (author). 48 refs., 60 figs., 15 tabs.

  9. 7 CFR 1.22 - Authentication. (United States)


    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Authentication. 1.22 Section 1.22 Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Official Records § 1.22 Authentication. When a request is received for an authenticated copy of a document that the agency determines to make...

  10. Operating experience feedback program at Olkiluoto NPP

    International Nuclear Information System (INIS)

    Kosonen, Mikko


    Recent review and development of the operating experience feedback program will be described. The development of the program has been based on several reviews by outside organizations. Main conclusions from these review reports and from the self assessment of safety performance, safety problems and safety culture on the basis of the operational events made by ASSET-method will be described. An approach to gather and analyze small events - so-called near misses - will be described. The operating experience program has been divided into internal and external operating experience. ASSET-methodology and a computer program assisting the analysis are used for the internal operating experience events. Noteworthy incidents occurred during outage are analyzed also by ASSET-method. Screening and pre analysis of the external operating experience relies on co-operation with ERFATOM, an organization of Nordic utilities for the exchange of nuclear industry experience. A short presentation on the performance of the Olkiluoto units will conclude the presentation. (author)

  11. Ecosystem characterization strategy at a repository site - Olkiluoto as a case study

    Energy Technology Data Exchange (ETDEWEB)

    Pere, Tuomas [Posiva Oy, Olkiluoto, 27160 Eurajoki (Finland); Kangasniemi, Ville [Environmental Research and Assessment EnviroCase, Ltd., Hallituskatu 1 D 4, 28100 Pori (Finland); Lahdenperae, Anne-Maj [Saanio and Riekkola Oy, Laulukuja 4, 00420 Helsinki (Finland); Aro, Lasse [Finnish Forest Research Institute, Kaironiementie 15, 39700 Parkano (Finland)


    Posiva Oy is constructing an underground research facility ONKALO in Olkiluoto, located in the municipality of Eurajoki, Finland. This is part of the plan for final disposal of spent nuclear fuel produced by Posiva's owners: Teollisuuden Voima Oyj and Fortum Power and Heat Oyj. Posiva has applied for construction license for an underground repository, which is planned to start its operation around the year 2020. The final disposal of high-level radioactive waste poses questions of long-term safety and possible processes of radionuclide release in the EBS (Engineered Barrier System) and the geosphere are also modelled as well as possible transport routes in the bedrock. Posiva has also established a monitoring program for the environment and is also conducting modelling of the surface environment and biosphere in Olkiluoto and the surrounding reference area. These serve the purpose of both, site description and modelling of the transport and accumulation of possible radionuclide releases in the surface environment and biosphere. The process of modelling used by Posiva requires the division of the surface environment and biosphere into several categories. In Posiva's classification, ecosystems are divided to two categories: terrestrial and aquatic with terrestrial divided to forests and agricultural areas. These categories are further divided to ecosystem types which include: lake, river, forest, cropland and sea (with coastal sea as a separate type). These types are even further divided to 14 ecosystem sub-types and behind these sub-types, a total of 24 biotopes exist. Soil and sediment types are also classified to 7 classes. The methodology behind the selection of these biotopes and their connection to the modelling of radionuclide transport in the surface environment is further described in the text. Some of the ecosystem types and biotopes are absent in present-day Olkiluoto area, which necessitates the use of reference targets, such as lakes, rivers

  12. 25 CFR 122.7 - Budget. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Budget. 122.7 Section 122.7 Indians BUREAU OF INDIAN... § 122.7 Budget. (a) By August 1 of each year, the Osage Tribal Education Committee will submit a proposed budget to the Assistant Secretary or to his/her designated representative for formal approval...

  13. Disposal of spent fuel in Olkiluoto bedrock. Programme for research, development and technical design for the pre-construction phase

    Energy Technology Data Exchange (ETDEWEB)



    The spent fuel from the nuclear power plants at Olkiluoto and Loviisa will be disposed of in Finnish bedrock. Posiva aims at starting the construction of the disposal facility in the 2010's and the actual disposal operations in 2020. In May 1999 Posiva submitted an application for the so-called Decision-in-Principle (DiP) on the facility to the Finnish Government. According to the application the repository would be based on a KBS-3 type concept and sited at Olkiluoto. The application was approved by the Government in December 2000 and will go next to the Parliament for final approval. However, Posiva has already started the planning for the next programme phase on the assumption that a positive decision will be made. The purpose of the present document is to describe the objectives and major items of research, development, technical planning and design work for the period preceding the construction license. According to the current official guidelines Posiva should prepare for submitting the application for the license in 2010. For the technical development and design work the main target for the starting programme phase is to reach the maturity of design and technical plans that allows the specification of work packages for bid calls and gives sufficient confidence in the technical feasibility of planned operations at the encapsulation facility and in the repository. The main objectives for the complementary characterisation work at Olkiluoto consist of the verification of the present conclusions on site suitability, the definition and identification of suitable rock volumes for repository space and the characterisation of the target host rock for repository design, safety assessment and planning of construction work. The technical design and demonstration work together with the results of complementary site characterisation will provide the basis of the safety case prepared as the support for the construction license application. An integrated safety

  14. Disposal of spent fuel in Olkiluoto bedrock. Programme for research, development and technical design for the pre-construction phase

    International Nuclear Information System (INIS)


    The spent fuel from the nuclear power plants at Olkiluoto and Loviisa will be disposed of in Finnish bedrock. Posiva aims at starting the construction of the disposal facility in the 2010's and the actual disposal operations in 2020. In May 1999 Posiva submitted an application for the so-called Decision-in-Principle (DiP) on the facility to the Finnish Government. According to the application the repository would be based on a KBS-3 type concept and sited at Olkiluoto. The application was approved by the Government in December 2000 and will go next to the Parliament for final approval. However, Posiva has already started the planning for the next programme phase on the assumption that a positive decision will be made. The purpose of the present document is to describe the objectives and major items of research, development, technical planning and design work for the period preceding the construction license. According to the current official guidelines Posiva should prepare for submitting the application for the license in 2010. For the technical development and design work the main target for the starting programme phase is to reach the maturity of design and technical plans that allows the specification of work packages for bid calls and gives sufficient confidence in the technical feasibility of planned operations at the encapsulation facility and in the repository. The main objectives for the complementary characterisation work at Olkiluoto consist of the verification of the present conclusions on site suitability, the definition and identification of suitable rock volumes for repository space and the characterisation of the target host rock for repository design, safety assessment and planning of construction work. The technical design and demonstration work together with the results of complementary site characterisation will provide the basis of the safety case prepared as the support for the construction license application. An integrated safety assessment

  15. Production of pions, kaons and protons in pp collisions at √ s = 900 GeV with ALICE at the LHC

    Czech Academy of Sciences Publication Activity Database

    Aamodt, K.; Abel, N.; Abeysekara, U.; Quintana, A.A.; Adamová, Dagmar; Bielčík, J.; Bielčíková, Jana; Kushpil, Svetlana; Kushpil, Vasilij; Mareš, Jiří A.; Polák, Karel; Šumbera, Michal; Tlustý, D.; Wagner, V.; Závada, Petr


    Roč. 71, č. 6 (2011), 1-22 ISSN 1434-6044 R&D Projects: GA MŠk LA08015 Institutional research plan: CEZ:AV0Z10100502; CEZ:AV0Z10480505 Keywords : CERN * ALICE * LHC * pp collisions Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.631, year: 2011

  16. 21 CFR 168.122 - Lactose. (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Lactose. 168.122 Section 168.122 Food and Drugs... § 168.122 Lactose. (a) Lactose is the carbohydrate normally obtained from whey. It may be anhydrous or... the following specifications: (1) The lactose content is not less than 98.0 percent, mass over mass (m...

  17. An approach to palaeoseismicity in the Olkiluoto (sea) area during the early holocene

    International Nuclear Information System (INIS)

    Hutri, K.L.


    Olkiluoto Island is situated in the northern Baltic Sea, near the southwestern coast of Finland, and is the proposed location of a spent nuclear fuel repository. This study examined Holocene palaeoseismicity in the Olkiluoto area and in the surrounding sea areas by computer simulations together with acoustic-seismic, sedimentological and dating methods. The most abundant rock type on the island is migmatic mica gneiss, intruded by tonalites, granodiorites and granites. The surrounding Baltic Sea seabed consists of Palaeoproterozoic crystalline bedrock, which is to a great extent covered by younger Mesoproterozoic sedimentary rocks. The area contains several ancient deep-seated fracture zones that divide it into bedrock blocks. The response of bedrock at the Olkiluoto site was modelled considering four future ice-age scenarios. Each scenario produced shear displacements of fractures with different times of occurrence and varying recovery rates. Generally, the larger the maximum ice load, the larger were the permanent shear displacements. For a basic case, the maximum shear displacements were a few centimetres at the proposed nuclear waste repository level, at proximately 500 m b.s.l. high-resolution, low-frequency echo-sounding was used to examine the Holocene submarine sedimentary structures and possible direct and indirect indicators of palaeoseismic activity in the northern Baltic Sea. Echo-sounding profiles of Holocene submarine sediments revealed slides and slumps, normal faults, debris flows and turbidite-type structures. The profiles also showed pockmarks and other structures related to gas or groundwater seepages, which might be related to fracture zone activation. Evidence of postglacial reactivation in the study area was derived from the spatial occurrence of some of the structures, especial the faults and the seepages, in the vicinity of some old bedrock fracture zones. Palaeoseismic event(s) (a single or several events) in the Olkiluoto area were dated

  18. Results of monitoring at Olkiluoto in 2009. Environment

    Energy Technology Data Exchange (ETDEWEB)

    Haapanen, A. (ed.) (Haapanen Forest Consulting, Vanhakylae (Finland))


    This Working Report presents the main results of Posiva Oy's environmental monitoring programme on Olkiluoto Island in 2009. These summary reports have been published since 2005. The environmental monitoring system supervised by Posiva Oy produces input for biosphere modelling for long-term safety purposes as well as for monitoring the state of the environment during the construction (and later operation) of ONKALO underground characterization facility. Part of the monitoring is performed by the company running the nuclear power plants on the island, Teollisuuden Voima Oy (TVO). Monitoring has been carried out for varying periods of time depending on the sector: some monitoring activities performed by TVO originate from the 1970s and the repository-related environmental monitoring of Olkiluoto from the early 2000s. The monitoring programme evolves according to the experiences gained from the modelling work and an increased understanding of the site. Augmentations in 2009 include e.g. establishment of a new forest intensive monitoring plot (FIP14), continuation of studies on fine roots and on the species composition and abundances of small mammals. Line transect samplings of ants, terrestrial snails and earthworms were carried out and a systematic monitoring of island birds was started. In addition, a project was started where the sediment load and factors affecting the sediment transportation into Eurajoensalmi bay is examined. Dust produced during construction of the third nuclear power unit (OL3), ONKALO and related infrastructure can be seen in the soil solution and deposition results. Furthermore, the construction works and road traffic have a raising effect on the noise levels of the immediate surroundings. The land-use continues to change, but the remaining natural environment resembles other coastal locations. The young age of the soils and the closeness of the sea are reflected in the soil properties. Mammalian fauna on the island is typical of coastal

  19. Results of monitoring at Olkiluoto in 2009. Environment

    International Nuclear Information System (INIS)

    Haapanen, A.


    This Working Report presents the main results of Posiva Oy's environmental monitoring programme on Olkiluoto Island in 2009. These summary reports have been published since 2005. The environmental monitoring system supervised by Posiva Oy produces input for biosphere modelling for long-term safety purposes as well as for monitoring the state of the environment during the construction (and later operation) of ONKALO underground characterization facility. Part of the monitoring is performed by the company running the nuclear power plants on the island, Teollisuuden Voima Oy (TVO). Monitoring has been carried out for varying periods of time depending on the sector: some monitoring activities performed by TVO originate from the 1970s and the repository-related environmental monitoring of Olkiluoto from the early 2000s. The monitoring programme evolves according to the experiences gained from the modelling work and an increased understanding of the site. Augmentations in 2009 include e.g. establishment of a new forest intensive monitoring plot (FIP14), continuation of studies on fine roots and on the species composition and abundances of small mammals. Line transect samplings of ants, terrestrial snails and earthworms were carried out and a systematic monitoring of island birds was started. In addition, a project was started where the sediment load and factors affecting the sediment transportation into Eurajoensalmi bay is examined. Dust produced during construction of the third nuclear power unit (OL3), ONKALO and related infrastructure can be seen in the soil solution and deposition results. Furthermore, the construction works and road traffic have a raising effect on the noise levels of the immediate surroundings. The land-use continues to change, but the remaining natural environment resembles other coastal locations. The young age of the soils and the closeness of the sea are reflected in the soil properties. Mammalian fauna on the island is typical of coastal

  20. Understanding brittle deformation at the Olkiluoto site. Literature Supplement 2010: an Update of Posiva Working Report 2006-25

    Energy Technology Data Exchange (ETDEWEB)

    Milnes, A. (GEA Consulting, Corcelles (CH))


    Posiva Working Report 2006-25 arose from the belief that geological modelling at Olkiluoto, Finland, where an underground repository for spent nuclear fuel is at present under construction, could be significantly improved by an increased understanding of the phenomena being modelled, in conjunction with the more sophisticated data acquisition and processing methods which are now being introduced. Since the geological model is the necessary basis for the rock engineering and hydrological models, which in turn provide the foundation for identifying suitable rock volumes underground and for demonstrating long-term safety, its scientific basis is of critical importance. As a contribution to improving this scientific basis, the literature on brittle deformation in the Earth's crust was reviewed up to and including year 2005. The result was a compilation of scientific articles, reports and books on some of the key topics of significance for an improved understanding of brittle deformation of hard, crystalline rocks, particularly heterogeneous migmatitic and metamorphic rocks like those that make up the Olkiluoto bedrock. The present report is a supplement to WR 2006-25, covering the 5-year period 2006-2010, with some key earlier references and an Annotated Bibliography. The present report is subdivided into five chapters, listing recent literature on (1) background subjects and basic principles, (2) the fabric of Olkiluoto-type intact rock (gneisses, migmatites, fault rocks), (3) formation and characteristics of brittle deformation features (fracture mechanics, brittle microtectonics), (4) fracture data acquisition and processing (statistical characterisation and modelling of fracture systems), and (5) the characterisation of brittle deformation zones (for deterministic and dynamic modelling), corresponding to the first five chapters of the earlier report

  1. Understanding brittle deformation at the Olkiluoto site. Literature Supplement 2010: an Update of Posiva Working Report 2006-25

    International Nuclear Information System (INIS)

    Milnes, A.


    Posiva Working Report 2006-25 arose from the belief that geological modelling at Olkiluoto, Finland, where an underground repository for spent nuclear fuel is at present under construction, could be significantly improved by an increased understanding of the phenomena being modelled, in conjunction with the more sophisticated data acquisition and processing methods which are now being introduced. Since the geological model is the necessary basis for the rock engineering and hydrological models, which in turn provide the foundation for identifying suitable rock volumes underground and for demonstrating long-term safety, its scientific basis is of critical importance. As a contribution to improving this scientific basis, the literature on brittle deformation in the Earth's crust was reviewed up to and including year 2005. The result was a compilation of scientific articles, reports and books on some of the key topics of significance for an improved understanding of brittle deformation of hard, crystalline rocks, particularly heterogeneous migmatitic and metamorphic rocks like those that make up the Olkiluoto bedrock. The present report is a supplement to WR 2006-25, covering the 5-year period 2006-2010, with some key earlier references and an Annotated Bibliography. The present report is subdivided into five chapters, listing recent literature on (1) background subjects and basic principles, (2) the fabric of Olkiluoto-type intact rock (gneisses, migmatites, fault rocks), (3) formation and characteristics of brittle deformation features (fracture mechanics, brittle microtectonics), (4) fracture data acquisition and processing (statistical characterisation and modelling of fracture systems), and (5) the characterisation of brittle deformation zones (for deterministic and dynamic modelling), corresponding to the first five chapters of the earlier report

  2. Irradiation effect on PP/PMMA and PP/PP-g-PMMA matrices

    International Nuclear Information System (INIS)

    Marsongko; Soebianto, Yanti S.


    The effects of PMMA and PP-g-PMMA on the oxidation of polypropylene (PP) have been studied. The mixing was done in Laboplastomill at the temperature of 200 o C, and screw speed of 20 rpm, for 5 minutes. The PMMA concentrations were 1, 2, 5, and 10% by weight, and PP-g-PMMA (12% grafting) 5, 10, and 20% by weight. Mechanical properties (tensile strength (Tb) and elongation at break (Eb)( of the mixture decreased with the increase of PMMA content over 5%. The addition of PMMA over 3% produced non-transparent film. Electron beam irradiation at the dose of 5, 10, 30, and 50 kGy was carried out to accelerate the matrix oxidation is accelerated. The optimum properties of PP/PMMA blends can be achieved by addition of maximum 2% PMMA either direct as PMMA or as compatibilizer (PP-g-PMMA). (authors)

  3. Basic Data Report for Drillhole SNL-12 (C-2954)

    Energy Technology Data Exchange (ETDEWEB)

    Powers, Dennis W. [Washington Regulatory and Environmental Services (United States)


    SNL-12 (permitted by the New Mexico State Engineer as C-2954) was drilled to provide geological data and hydrological testing of the Culebra Dolomite Member of the Permian Rustler Formation near the margin of dissolution of halite in the upper part of the Salado south of the Waste Isolation Pilot Plant (WIPP). SNL-12 is located in the southeast quarter of section 20, T23S, R31E, in eastern Eddy County, New Mexico. SNL-12 was drilled to a total depth of 905 ft below the ground level. Below surface dune sand and the Berino soil, SNL-12 encountered, in order, the Mescalero caliche, Gatu?a, Dewey Lake, Rustler, and uppermost Salado Formations. Two intervals were cored: (1) from the lower Forty-niner Member through the Magenta Dolomite and into the upper Tamarisk Member; and (2) from the lower Tamarisk Member through the Culebra Dolomite and Los Meda?os Members and into the uppermost Salado Formation. Geophysical logs were acquired from the open hole to total depth, and the drillhole was successfully completed with a screened interval open across the Culebra. At SNL-12, the uppermost Salado cores display displacive halite crystals in clastic-rich units below an amalgamated sulfate at the top of the formation. There is no indication of thinning of the upper Salado due to postdepositional dissolution, and this is consistent with predrilling expectations.

  4. Core drilling of deep borehole OL-KR39 at Olkiluoto in Eurajoki 2005

    Energy Technology Data Exchange (ETDEWEB)

    Niinimaeki, R. [Suomen Malmi Oy, Espoo (Finland)


    Posiva Oy submitted an application to the Finnish Government in May 1999 for the Decision in Principle to choose Olkiluoto in the municipality of Eurajoki as the site of the final disposal facility for spent nuclear fuel. A positive decision was made at the end of 2000 by the Government. The Finnish Parliament ratified the decision in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, ONKALO, will be constructed. As a part of the investigations Suomen Malmi Oy (Smoy) core drilled 502.97 m and 45.11 m deep boreholes with a diameter of 75.7 mm at Olkiluoto in August- October 2005. The identification numbers of the boreholes are OL-KR39 and OL-KR39B, respectively. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. Both the volume and the electric conductivity of the drilling water and the returning water were recorded. The drill rig was computer controlled and during drilling the computer recorded drilling parameters. The objective of all these measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The total volumes of the used drilling and flushing water were 415m{sup 3} and 25 m{sup 3} and the measured volumes of the returning water were 175 m{sup 3} and 7 m{sup 3} in boreholes OLKR39 and OL-KR39B, respectively. The deviation of the borehole was measured with the deviation measuring instruments EMS and Maxibor. Uniaxial compressive strength, Young's Modulus and Poisson' s ratio were measured from the core samples. The average uniaxial compressive strength is about 110 MPa, the average Young's Modulus is 49 GP a and the average Poisson' s ratio is 0.25. The main rock types are migmatitic mica gneiss and granite. Filled fracture is the most common

  5. Core drilling of deep borehole OL-KR34 at Olkiluoto in Eurajoki 2005

    Energy Technology Data Exchange (ETDEWEB)

    Rautio, T. [Suomen Malmi Oy, Espoo (Finland)


    Posiva Oy submitted an application for the Decision in Principle to the Finnish Government in May 1999. A positive decision was made at the end of 2000 by the Government. The Finnish Parliament ratified the Decision in Principle on the final disposal facility for spent nuclear fuel at Olkiluoto, Eurajoki in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, ONKALO, will be constructed. As a part of the investigations Suomen Malmi Oy (Smoy) core drilled 100.07 m deep borehole with a diameter of 75.7 mm at Olkiluoto in April 2005. This borehole was aimed to get additional information of the quality of bedrock and the anomalous part of the bedrock and quality and the location of the fractured zones R19A and R19B. The identification number of the borehole is OL-KR34. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. Both the volume and the electric conductivity of the drilling water and the returning water were recorded. The drill rig was computer controlled and during drilling the computer recorded information about drilling parameters. The objective of all measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The volume of the used drilling water was about 37m{sup 3} and the measured volume of the returning water was about 18m{sup 3} in borehole OL-KR34. The deviation of the borehole was measured with the deviation measuring instruments EMS and Maxibor. The results of the Maxibor measurements indicate that borehole OLKR34 deviates 0.84 m right and 0.15 m up at the borehole depth of 99 m. Uniaxial compressive strength, Young's Modulus and Poisson' s ratio were measured from the core samples. The average uniaxial compressive strength is about 142 MPa, the

  6. Core drilling of deep borehole OL-KR36 at Olkiluoto in Eurajoki 2005

    Energy Technology Data Exchange (ETDEWEB)

    Niinimaeki, R.; Rautio, T. [Suomen Malmi Oy, Espoo (Finland)


    Posiva Oy submitted an application for the Decision in Principle to the Finnish Government in May 1999. A positive decision was made at the end of 2000 by the Government. The Finnish Parliament ratified the Decision in Principle on the final disposal facility for spent nuclear fuel at Olkiluoto, Eurajoki in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, ONKALO, will be constructed. As a part of the investigations Suomen Malmi Oy (Smoy) core drilled 205.17 m deep borehole with a diameter of 75.7 mm at Olkiluoto in May 2005. This borehole was aimed to get additional information of the quality of bedrock and the anomalous part of the bedrock and quality and the location of the fractured zones R19A and R19B. The identification number of the borehole is OL-KR36. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. Both the volume and the electric conductivity of the drilling water and the returning water were recorded. The drill rig was computer controlled and during drilling the computer recorded information about drilling measurements. The objective of all these measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The volume of the used drilling water was about 117 m{sup 3} and the measured volume of the returning water was about 51m{sup 3} in borehole OL-KR36. The deviation of the borehole was measured with the deviation measuring instruments EMS and Maxibor. The results of the Maxibor measurements indicate that borehole OL-KR36 deviates 10.34 m left and 7.11 m up at the borehole depth of 204 m. Uniaxial compressive strength, Young's Modulus and Poisson' s ratio were measured from the core samples. The average uniaxial compressive strength is about 126

  7. Core drilling of deep borehole OL-KR35 at Olkiluoto in Eurajoki 2005

    Energy Technology Data Exchange (ETDEWEB)

    Rautio, T. [Suomen Malmi Oy, Espoo (Finland)


    Posiva Oy submitted an application for the Decision in Principle to the Finnish Government in May 1999. A positive decision was made at the end of 2000 by the Government. The Finnish Parliament ratified the Decision in Principle on the final disposal facility for spent nuclear fuel at Olkiluoto, Eurajoki in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, ONKALO, will be constructed. As a part of the investigations Suomen Malmi Oy (Smoy) core drilled 100.87 m deep borehole with a diameter of 75.7 mm at Olkiluoto in May 2005. This borehole was aimed to get additional information of the quality of bedrock and the anomalous part of the bedrock and quality and the location of the fractured zones R19A and R19B. The identification number of the borehole is OL-KR35. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. Both the volume and the electric conductivity of the drilling water and the returning water were recorded. The drill rig was computer controlled and during drilling the computer recorded information about drilling parameters. The objective of all measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The volume of the used drilling water was about 53 m{sup 3} and the measured volume of the returning water was about 25 m{sup 3} in borehole OL-KR35. The deviation of the borehole was measured with the deviation measuring instruments EMS and Maxibor. The results of the Maxibor measurements indicate that borehole OL-KR35 deviates 0.49 m right and 0.30 m up at the borehole depth of 99 m. Uniaxial compressive strength, Young's Modulus and Poisson' s ratio were measured from the core samples. The average uniaxial compressive strength is about 90 MPa, the

  8. Core drilling of deep borehole OL-KR37 at Olkiluoto in Eurajoki 2005

    Energy Technology Data Exchange (ETDEWEB)

    Niinimaeki, R. [Suomen Malmi Oy, Espoo (Finland)


    Posiva Oy submitted an application to the Finnish Government in May 1999 for the Decision in Principle to choose Olkiluoto in the municipality of Eurajoki as the site of the final disposal facility for spent nuclear fuel. A positive decision was made at the end of 2000 by the Government. The Finnish Parliament ratified the decision in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, ONKALO, will be constructed. As a part of the investigations Suomen Malmi Oy (Smoy) core drilled 350.00 m and 45.10 m deep boreholes with a diameter of 75.7 mm at Olkiluoto in June- August 2005. The identification numbers of the boreholes are OL-KR37 and OL-KR37B, respectively. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. Both the volume and the electric conductivity of the drilling water and the returning water were recorded. The drill rig was computer controlled and during drilling the computer recorded information about drilling parameters. The objective of all these measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The total volumes of the used drilling and flushing water were 273 m{sup 3} and 21m{sup 3} and the measured volumes of the returning water were 221m{sup 3} and 16m{sup 3} in boreholes OL-KR37 and OL-KR37B, respectively. The deviation of the borehole was measured with the deviation measuring instruments EMS and Maxibor. Uniaxial compressive strength, Young's Modulus and Poisson' s ratio were measured from the core samples. The average uniaxial compressive strength is about 106 MPa, the average Young's modulus is 40 GPa and the average Poisson's ratio is 0.20. The main rock types are migmatitic mica gneiss, granite and tonalite. Filled

  9. Core drilling of deep borehole OL-KR39 at Olkiluoto in Eurajoki 2005

    International Nuclear Information System (INIS)

    Niinimaeki, R.


    Posiva Oy submitted an application to the Finnish Government in May 1999 for the Decision in Principle to choose Olkiluoto in the municipality of Eurajoki as the site of the final disposal facility for spent nuclear fuel. A positive decision was made at the end of 2000 by the Government. The Finnish Parliament ratified the decision in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, ONKALO, will be constructed. As a part of the investigations Suomen Malmi Oy (Smoy) core drilled 502.97 m and 45.11 m deep boreholes with a diameter of 75.7 mm at Olkiluoto in August- October 2005. The identification numbers of the boreholes are OL-KR39 and OL-KR39B, respectively. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. Both the volume and the electric conductivity of the drilling water and the returning water were recorded. The drill rig was computer controlled and during drilling the computer recorded drilling parameters. The objective of all these measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The total volumes of the used drilling and flushing water were 415m 3 and 25 m 3 and the measured volumes of the returning water were 175 m 3 and 7 m 3 in boreholes OLKR39 and OL-KR39B, respectively. The deviation of the borehole was measured with the deviation measuring instruments EMS and Maxibor. Uniaxial compressive strength, Young's Modulus and Poisson' s ratio were measured from the core samples. The average uniaxial compressive strength is about 110 MPa, the average Young's Modulus is 49 GP a and the average Poisson' s ratio is 0.25. The main rock types are migmatitic mica gneiss and granite. Filled fracture is the most common fracture type. The average fracture

  10. Core drilling of deep borehole OL-KR32 at Olkiluoto in Eurajoki 2004

    International Nuclear Information System (INIS)

    Rautio, T.


    Posiva Oy submitted an application for the Decision in Principle to the Finnish Government in May 1999. A positive decision was made at the end of 2000 by the Government. The Finnish Parliament ratified the Decision in Principle on the final disposal facility for spent nuclear fuel at Olkiluoto, Eurajoki in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, the ONKALO, will be constructed. As a part of the investigations Suomen Malmi Oy (Smoy) core drilled a 191.81 m deep borehole with a diameter of 75.7 mm at Olkiluoto in November 2004. This borehole was aimed to get additional information of the quality and the location of the fractured zones R20A and R20B and the fractured zones near rock surface noticed in investigation trench TK8. The identification number of the borehole is OL-KR32. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. Both the volume and the electric conductivity of the drilling water and the returning water were recorded as well as the pressure of the drilling water. The objective of these measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The volume of the used drilling water was about 93 m 3 and the measured volume of the returning water was about 6 m 3 in borehole OL-KR32. The deviation of the borehole was measured with the deviation measuring instruments EMS and Maxibor. The results of the Maxibor measurements indicate that borehole OL-KR32 deviates 4.42 m right and 4.66 m up at the borehole depth of 189 m. Uniaxial compressive strength, Young's Modulus and Poisson's ratio were measured from the core samples. The average uniaxial compressive strength is about 130 MPa, the average Young's modulus is 47 GPa and the average Poisson

  11. Core drilling of deep borehole OL-KR46 at Olkiluoto in Eurajoki 2007

    International Nuclear Information System (INIS)

    Toropainen, V.


    Posiva Oy submitted an application to the Finnish Government in May 1999 for the Decision in Principle to choose Olkiluoto in the municipality of Eurajoki as the site of the final disposal facility for spent nuclear fuel. A positive decision was made at the end of 2000 by the Government. The Finnish Parliament ratified the decision in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, ONKALO, will be constructed. As a part of the investigations Suomen Malmi Oy (Smoy) core drilled 600.10 m and 45.16 m deep boreholes with a diameter of 75.7 mm at Olkiluoto in May - June 2007. The identification numbers of the boreholes are OL-KR46 and OL-KR46B, respectively. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. Both the volume and the electric conductivity of the returning water, and the volume of drilling water were recorded. The drill rig was computer controlled and during drilling the computer recorded drilling parameters. The objective of all these measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The total volumes of the used drilling and flushing water were 466 m 3 and 20 m 3 in boreholes OL-KR46 and OL-KR46B, respectively. Measured volumes of the returning water were 407 m 3 in borehole OL-KR46 and 12 m 3 in borehole OL-KR46B. The deviation of the boreholes was measured with the deviation measuring instruments EMS and Maxibor. Uniaxial compressive strength, Young's Modulus and Poisson's ratio were measured from the core samples. The average uniaxial compressive strength is 116.5 MPa, the average Young's Modulus is 31.5 GPa and the average Poisson's ratio is 0.20. The main rock types are veined gneiss, tonalitic-granodioritic-granitic gneiss and pegmatite

  12. In-situ experiments to investigate rock matrix retention properties in ONKALO, Olkiluoto, Finland

    Energy Technology Data Exchange (ETDEWEB)

    Voutilainen, Mikko; Helariutta, Kerttuli [Helsinki Univ. (Finland). Dept. of Chemistry; Poteri, Antti [Technical Research Centre of Finland VTT (Finland); and others


    Spent nuclear fuel from nuclear power plants, owned by TVO (Teollisuuden Voima Oy) and Fortum, is planned to be disposed to a repository at a depth of more than 400 meters in the bedrock of Olkiluoto (Eurajoki, Finland). The repository system of multiple release barriers consists of both manmade and natural barriers. The surrounding rock acts as the last barrier if other barriers fail during passage of the millennia. Therefore, safe disposal of spent nuclear fuel requires information on the radionuclide transport and retention properties within the porous and water-containing rock matrix along the water conducting flow paths. To this end, various types of experiments are being performed and planned within ONKALO, the underground rock characterization facility in Olkiluoto, as part of the project @''rock matrix REtention PROperties'' (REPRO). The research site is located at a depth of 420 meters close to the repository site. The aim is to study the diffusion and sorption properties of nuclear compounds in the rock matrix under real in-situ conditions. The first in-situ experiment was performed during 2012 using HTO, Na-22, Cl-36 and I-125 as tracer nuclides. Breakthrough curves show retention and asymptotic behavior that are in-line with those caused by matrix diffusion and sorption were observed in their breakthrough curves. Weak sorption was also observed in the breakthrough curves of Na-22 and I-125.

  13. Dicty_cDB: AFL122 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFL122 (Link to dictyBase) - - - Contig-U11144-1 AFL122P (Link... to Original site) AFL122F 837 AFL122Z 711 AFL122P 1538 - - Show AFL122 Library AF (Link to library) Clone ID AFL122 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11144-1 Original site URL http://dict...GPSVILLDEPTSGLDASTSFYVMSALKKLAKSGRTIICTIHQPRSNIYDM FDNLLLLGDGNTIYYGKANKALEYFNANGYHCSEKTNPADFFLDLINTQVEDQADSD...TLNFYAQLKMPRDVPLKEKLQRVQDIIDEMGLNRCADTLVGTADNKIRGISGGERR RVTISIELLTGPSVILLDEPTSGLDASTSFYVMSALKKLAKSGRTIICT

  14. Olkiluoto 3: Finland has chosen a EPR

    International Nuclear Information System (INIS)

    Brummer, S.


    According to the Finn law any nuclear project has to be declared conformed to the general interest of the country by the government and then has to be approved by the parliament. In may 2002 the Finn parliament approved the project of the TVO company: the construction of a new nuclear unit on the Olkiluoto site and the direct and definitive disposal of spent fuels in the granite underground layers of the same site. The project was agreed with 109 votes for and 92 against. In september 2002 an international invitation to tender was launched and 4 companies made proposals: Westinghouse, Atomstroexport, Framatome-ANP and General Electric. Westinghouse withdrew its offer some time later. In october 2003 TVO announced that the unit will be a 1600 MW EPR (European pressurized reactor) built by Framatome-ANP. The construction work will begin in spring 2005 and the unit is scheduled to enter into service in 2009. At that time the contribution of nuclear energy to the Finn energy production will reach 35%. (A.C.)

  15. 47 CFR 12.2 - Backup power. (United States)


    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Backup power. 12.2 Section 12.2 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL REDUNDANCY OF COMMUNICATIONS SYSTEMS § 12.2 Backup power..., must have an emergency backup power source (e.g., batteries, generators, fuel cells) for all assets...

  16. 7 CFR 4280.122 - Project eligibility. (United States)


    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Project eligibility. 4280.122 Section 4280.122 Agriculture Regulations of the Department of Agriculture (Continued) RURAL BUSINESS-COOPERATIVE SERVICE AND... Efficiency Improvements Program Section B. Guaranteed Loans § 4280.122 Project eligibility. For a project to...

  17. 19 CFR 122.1 - General definitions. (United States)


    ... such government, or passengers traveling on official business of such government; or (3) Carrying... 19 Customs Duties 1 2010-04-01 2010-04-01 false General definitions. 122.1 Section 122.1 Customs... AIR COMMERCE REGULATIONS General Definitions and Provisions § 122.1 General definitions. The following...

  18. 40 CFR Appendix J to Part 122 - NPDES Permit Testing Requirements for Publicly Owned Treatment Works (§ 122.21(j)) (United States)


    ... Publicly Owned Treatment Works (§ 122.21(j)) J Appendix J to Part 122 Protection of Environment... POLLUTANT DISCHARGE ELIMINATION SYSTEM Pt. 122, App. J Appendix J to Part 122—NPDES Permit Testing Requirements for Publicly Owned Treatment Works (§ 122.21(j)) Table 1A—Effluent Parameters for All POTWS...

  19. Modernisation of the Olkiluoto nuclear power plant increases the power production efficiency under safe limits

    International Nuclear Information System (INIS)

    Valkeapaeae, R.


    Teollisuuden Voima Oy published the efficiency increment plans as a part of the modernisation of the Olkiluoto nuclear power plant. The power of the reactor units, originally designed for 660 MW will now be increased for a second time. The former improvements were made in 1994. The power of the units was increased to 710 MW. After this new renovation the power of the both units will be 830-840 MW. (2 figs.)

  20. 29 CFR 1917.122 - Employee exits. (United States)


    ... 29 Labor 7 2010-07-01 2010-07-01 false Employee exits. 1917.122 Section 1917.122 Labor Regulations...) MARINE TERMINALS Terminal Facilities § 1917.122 Employee exits. (a) Employee exits shall be clearly marked. (b) If an employee exit is not visible from employees' work stations, directional signs...

  1. The Site Selected. The Local Decision-Making Regarding the Siting of the Spent Nuclear Fuel Repository in Olkiluoto

    International Nuclear Information System (INIS)

    Kojo, Matti


    In May 1999 Posiva, the company responsible for the final disposal of spent nuclear fuel in Finland, suggested that the Finnish Government considers only Olkiluoto in Eurajoki in its application of a decision in principle to be a final disposal site. In January 2000 the municipal council of Eurajoki made a positive statement on the decision in principle. The Government made the decision in principle in Dec 2000, and the Parliament ratified the decision in May 2001. The paper is focused on the decision making of Eurajoki municipality regarding the siting of the spent nuclear fuel repository. The paper shows how the interaction between the representatives of the candidate municipality and the nuclear energy industry was the crucial factor in the decision-making. Eurajoki serves as an example, in where the parties reached an agreement of the compensations for the final disposal repository. The negotiations between the Eurajoki municipality and the nuclear energy industry in reaching a positive decision are analysed from the beginning of the 1980s. The main emphasis is however on the years 1996-99, when the nuclear energy industry negotiated with the municipality on the compensation for the final disposal repository. The loss of income was an important reason why some of the councillors of Eurajoki were interested in having the final disposal repository in Olkiluoto. The industry's problem on the other hand was to safeguard the final disposal site. From the TVO's angle Olkiluoto was a potential final disposal site for example for its limited need for transport and for the existing infrastructure. The company used the financial benefits of the project as its trump card. The attitude of Eurajoki municipality to the final disposal of spent nuclear fuel turned positive with the Olkiluoto vision in December 1998, when still five years earlier the municipal council was prepared to act and prevent the final disposal. The future image presented by the municipality now matched

  2. The Site Selected. The Local Decision-Making Regarding the Siting of the Spent Nuclear Fuel Repository in Olkiluoto

    Energy Technology Data Exchange (ETDEWEB)

    Kojo, Matti [Univ. of Tampere (Finland). Dept. of Political Science and International Relations


    In May 1999 Posiva, the company responsible for the final disposal of spent nuclear fuel in Finland, suggested that the Finnish Government considers only Olkiluoto in Eurajoki in its application of a decision in principle to be a final disposal site. In January 2000 the municipal council of Eurajoki made a positive statement on the decision in principle. The Government made the decision in principle in Dec 2000, and the Parliament ratified the decision in May 2001. The paper is focused on the decision making of Eurajoki municipality regarding the siting of the spent nuclear fuel repository. The paper shows how the interaction between the representatives of the candidate municipality and the nuclear energy industry was the crucial factor in the decision-making. Eurajoki serves as an example, in where the parties reached an agreement of the compensations for the final disposal repository. The negotiations between the Eurajoki municipality and the nuclear energy industry in reaching a positive decision are analysed from the beginning of the 1980s. The main emphasis is however on the years 1996-99, when the nuclear energy industry negotiated with the municipality on the compensation for the final disposal repository. The loss of income was an important reason why some of the councillors of Eurajoki were interested in having the final disposal repository in Olkiluoto. The industry's problem on the other hand was to safeguard the final disposal site. From the TVO's angle Olkiluoto was a potential final disposal site for example for its limited need for transport and for the existing infrastructure. The company used the financial benefits of the project as its trump card. The attitude of Eurajoki municipality to the final disposal of spent nuclear fuel turned positive with the Olkiluoto vision in December 1998, when still five years earlier the municipal council was prepared to act and prevent the final disposal. The future image presented by the municipality

  3. 19 CFR 122.167 - Aviation smuggling. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Aviation smuggling. 122.167 Section 122.167... TREASURY AIR COMMERCE REGULATIONS Penalties § 122.167 Aviation smuggling. (a) Civil penalties. Any aircraft.... More severe penalties are provided in 19 U.S.C. 1590 if the smuggled merchandise is a controlled...

  4. 4 CFR 28.122 - Negotiability issues. (United States)


    ... 4 Accounts 1 2010-01-01 2010-01-01 false Negotiability issues. 28.122 Section 28.122 Accounts... Special Procedures; Unfair Labor Practices § 28.122 Negotiability issues. Where the GAO and an exclusive... shall review the arguments, hold a hearing if the administrative judge deems it necessary, and issue a...

  5. On detonation dynamics in hydrogen-air-steam mixtures: Theory and application to Olkiluoto reactor building

    International Nuclear Information System (INIS)

    Silde, A.; Lindholm, I.


    This report consists of the literature study of detonation dynamics in hydrogen-air-steam mixtures, and the assessment of shock pressure loads in Olkiluoto 1 and 2 reactor building under detonation conditions using the computer program DETO developed during this work at VTT. The program uses a simple 1-D approach based on the strong explosion theory, and accounts for the effects of both the primary or incident shock and the first (oblique or normal) reflected shock from a wall structure. The code results are also assessed against a Balloon experiment performed at Germany, and the classical Chapman-Jouguet detonation theory. The whole work was carried out as a part of Nordic SOS-2.3 project, dealing with severe accident analysis. The initial conditions and gas distribution of the detonation calculations are based on previous severe accident analyses by MELCOR and FLUENT codes. According to DETO calculations, the maximum peak pressure in a structure of Olkiluoto reactor building room B60-80 after normal shock reflection was about 38.7 MPa if a total of 3.15 kg hydrogen was assumed to burned in a distance of 2.0 m from the wall structure. The corresponding pressure impulse was about 9.4 kPa-s. The results were sensitive to the distance used. Comparison of the results to classical C-J theory and the Balloon experiments suggested that DETO code represented a conservative estimation for the first pressure spike under the shock reflection from a wall in Olkiluoto reactor building. Complicated 3-D phenomena of shock wave reflections and focusing, nor the propagation of combustion front behind the shock wave under detonation conditions are not modeled in the DETO code. More detailed 3-D analyses with a specific detonation code are, therefore, recommended. In spite of the code simplifications, DETO was found to be a beneficial tool for simple first-order assessments of the structure pressure loads under the first reflection of detonation shock waves. The work on assessment

  6. Safeguards for final disposal of spent nuclear fuel. Methods and technologies for the Olkiluoto site

    International Nuclear Information System (INIS)

    Okko, O.


    The final disposal of the nuclear material shall introduce new safeguards concerns which have not been addressed previously in IAEA safeguards approaches for spent fuel. The encapsulation plant to be built at the site will be the final opportunity for verification of spent fuel assemblies prior to their transfer to the geological repository. Moreover, additional safety and safeguards measures are considered for the underground repository. Integrated safeguards verification systems will also concentrate on environmental monitoring to observe unannounced activities related to possible diversion schemes at the repository site. The final disposal of spent nuclear fuel in geological formation will begin in Finland within 10 years. After the geological site investigations and according to legal decision made in 2001, the final repository of the spent nuclear fuel shall be located at the Olkiluoto site in Eurajoki. The next phase of site investigations contains the construction of an underground facility, called ONKALO, for rock characterisation purposes. The excavation of the ONKALO is scheduled to start in 2004. Later on, the ONKALO may form a part of the final repository. The plans to construct the underground facility for nuclear material signify that the first safeguards measures, e.g. baseline mapping of the site area, need to take prior to the excavation phase. In order to support the development and implementation of the regulatory control of the final disposal programme, STUK established an independent expert group, LOSKA. The group should support the STUK in the development of the technical safeguards requirements, in the implementation of the safeguards and in the evaluation of the plans of the facility operator. This publication includes four background reports produced by this group. The first of these 'NDA verification of spent fuel, monitoring of disposal canisters, interaction of the safeguards and safety issues in the final disposal' describes the new

  7. 46 CFR 122.503 - Voyage plan. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Voyage plan. 122.503 Section 122.503 Shipping COAST... Emergencies § 122.503 Voyage plan. (a) The master of the following vessels shall prepare a voyage plan: (1) A... United States Great Lakes port from a Canadian Great Lakes port. (b) The voyage plan required by...

  8. Basic Data Report for Drillhole SNL-5 (C-3002)

    Energy Technology Data Exchange (ETDEWEB)

    Dennis W. Powers; Washington Regulatory and Environmental Services


    SNL-5 (permitted by the New Mexico State Engineer as C-3002) was drilled to provide geological data and hydrological testing of the Culebra Dolomite Member of the Permian Rustler Formation in an area north of the Waste Isolation Pilot Plant (WIPP) site where data are sparse and where a pumping or monitoring well for the northern pumping test is needed. SNL-5 is located in the southeast quarter of section 6, T22S, R31E, in eastern Eddy County, New Mexico. SNL-5 was drilled to a total depth of 687 ft below ground level (bgl), based on driller's measurements. Below the caliche pad, SNL-5 encountered the Mescalero caliche, Gatu?a, Dewey Lake, and Rustler Formations. Two intervals of the Rustler were cored: (1) from the lower Forty-niner Member through the Magenta Dolomite and into the upper Tamarisk Member; and (2) from the lower Tamarisk Member through the Culebra Dolomite and into the upper Los Meda?os Members. Geophysical logs were acquired from the open hole to a depth of ~672 ft. No water was observed to flow into the open drillhole until the Culebra was penetrated. includes horizontal beds and laminae near the base, and the uppermost part shows some inclined bedding. The mudstone unit shows mostly reddish brown claystone and siltstone with some gray mottling. Clasts or intraclasts are also included in the unit. The upper Tamarisk sulfate is somewhat brecciated near the base.

  9. 7 CFR 946.122 - Reports. (United States)


    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Reports. 946.122 Section 946.122 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements...), loading point, destination and consignee. [39 FR 1972, Jan. 16, 1974] ...

  10. Core drilling of deep borehole OL-KR3B at Olkiluoto in Eurajoki 2005

    Energy Technology Data Exchange (ETDEWEB)

    Rautio, T. [Suomen Malmi Oy, Espoo (Finland)


    Posiva Oy submitted an application for the Decision in Principle to the Finnish Government in May 1999. A positive decision was made at the end of 2000 by the Government. The Finnish Parliament ratified the Decision in Principle on the final disposal facility for spent nuclear fuel at Olkiluoto, Eurajoki in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, ONKALO, will be constructed. As a part of the investigations Suomen Malmi Oy (Smoy) core drilled 530.60 m deep borehole with a diameter of 75.7 mm at Olkiluoto in summer 2005. This borehole was aimed to get additional information of the quality of bedrock in the area, where a new shaft with a diameter of 3 m is planned to be located. The identification number of the borehole is OL-KR38. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. Both the volume and the electric conductivity of the drilling water and the returning water were recorded. The drill rig was computer controlled and during drilling the computer recorded information about drilling parameters. The objective of these measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The volume of the used drilling water was about 473m{sup 3} and the measured volume of the returning water was about 38m{sup 3} in borehole OL-KR38. The deviation of the borehole was measured with the deviation measuring instruments EMS and Devitool Peewee. The results of the EMS measurements indicate that borehole OL-KR38 deviates 1.02 m south and 0.58 m west from the target point at the borehole depth of 525 m. Uniaxial compressive strength, Young's Modulus and Poisson's ratio were measured from the core samples. The average uniaxial compressive strength is about 106

  11. Surface 3-D reflection seismics - implementation at the Olkiluoto site

    Energy Technology Data Exchange (ETDEWEB)

    Saksa, P.; Lehtimaeki, T.; Heikkinen, E. [Poeyry Environment Oy, Vantaa (Finland)


    Posiva Oy takes care of the final disposal of spent nuclear fuel in Finland. In year 2001 Olkiluoto was selected for the site of final disposal. Construction of the underground research facility, ONKALO, is going on at the Olkiluoto site. The aim of this work was to study the possibilities for surface 3-D seismics and to review experiences for design before field work. The physical parameters and geometric properties of the site, as well as efficient survey layout and source arrangements, were considered in this work. Reflection seismics is most used geophysical investigation method in oil exploration and earth studies in sedimentary environment. Recently method has also been applied in crystalline bedrock for ore exploration and nuclear waste disposal site investigations. The advantage of the method is high accuracy combined with large depth of investigation. The principles of seismic 2-D and 3-D soundings are well known and advanced. 3-D sounding is a straightforward expansion of 2-D line based surveying. In investigation of crystalline bedrock, the high frequency wave sources and receivers, their right use in measurements and careful processing procedure (refraction static corrections in particular) are important. Using the site parameters in 2-D numerical modeling, two cases of faulted thin layer at depths of 200, 400 and 600 meters were studied. The first case was a layer with vertical dislocation (a ramp) and the other a layer having limited width of dislocated part. Central frequencies were 100, 200, 400 and 700 Hz. Results indicate that 10 - 20 m dislocation is recognizable, but for depths greater than 600 m, over 20 meters is required. Width of the dislocated part will affect the detectability of vertical displacement. At depths of 200 m and 400 m 10 - 50 m wide parts appear as point-like scatterers, wider areas have more continuity. Dislocations larger than 20 m can be seen. From depth of 600 m over 100 m wide parts are discernible, narrower are visible

  12. Surface 3-D reflection seismics - implementation at the Olkiluoto site

    International Nuclear Information System (INIS)

    Saksa, P.; Lehtimaeki, T.; Heikkinen, E.


    Posiva Oy takes care of the final disposal of spent nuclear fuel in Finland. In year 2001 Olkiluoto was selected for the site of final disposal. Construction of the underground research facility, ONKALO, is going on at the Olkiluoto site. The aim of this work was to study the possibilities for surface 3-D seismics and to review experiences for design before field work. The physical parameters and geometric properties of the site, as well as efficient survey layout and source arrangements, were considered in this work. Reflection seismics is most used geophysical investigation method in oil exploration and earth studies in sedimentary environment. Recently method has also been applied in crystalline bedrock for ore exploration and nuclear waste disposal site investigations. The advantage of the method is high accuracy combined with large depth of investigation. The principles of seismic 2-D and 3-D soundings are well known and advanced. 3-D sounding is a straightforward expansion of 2-D line based surveying. In investigation of crystalline bedrock, the high frequency wave sources and receivers, their right use in measurements and careful processing procedure (refraction static corrections in particular) are important. Using the site parameters in 2-D numerical modeling, two cases of faulted thin layer at depths of 200, 400 and 600 meters were studied. The first case was a layer with vertical dislocation (a ramp) and the other a layer having limited width of dislocated part. Central frequencies were 100, 200, 400 and 700 Hz. Results indicate that 10 - 20 m dislocation is recognizable, but for depths greater than 600 m, over 20 meters is required. Width of the dislocated part will affect the detectability of vertical displacement. At depths of 200 m and 400 m 10 - 50 m wide parts appear as point-like scatterers, wider areas have more continuity. Dislocations larger than 20 m can be seen. From depth of 600 m over 100 m wide parts are discernible, narrower are visible

  13. 7 CFR 966.122 - Reports. (United States)


    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Reports. 966.122 Section 966.122 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements..., loading point, destination, consignee, and, when inspection is required, the Federal-State Inspection...

  14. 5 CFR 185.122 - Discovery. (United States)


    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Discovery. 185.122 Section 185.122 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD CIVIL REMEDIES..., answers, records, accounts, papers, and other data and documentary evidence. Nothing contained herein...

  15. Geochemical modelling of the groundwater at the Olkiluoto site

    International Nuclear Information System (INIS)

    Pitkaenen, P.; Snellman, M.; Leino-Forsman, H.; Vuorinen, U.


    A preliminary model for probable processes responsible for the evolution of the groundwater at the nuclear waste investigation site Olkiluoto (in Finland) is presented. The hydrological data was collected from boreholes drilled down to 1000-m depth into crystalline bedrock. Based on chemical, isotopic, petrographic and hydrological data as well as ion plots and speciation calculations with PHREEQE the thermodynamic controls on the water composition and trends constraining these processes are evaluated. In order to determine the reactions which can explain the changes along the flow path during the evolution of groundwater system and to determine to which extent these reactions take place, mass-balance calculations with the NETPATH program were used. Mass transfer calculations with the EQ6 program were used to test the feasibility of the model derived, to predict reaction paths and composition of equilibrium solutions for the redox reactions. (57 refs., 43 figs., 10 tabs.)

  16. A test case of the deformation rate analysis (DRA) stress measurement method

    Energy Technology Data Exchange (ETDEWEB)

    Dight, P.; Hsieh, A. [Australian Centre for Geomechanics, Univ. of WA, Crawley (Australia); Johansson, E. [Saanio and Riekkola Oy, Helsinki (Finland); Hudson, J.A. [Rock Engineering Consultants (United Kingdom); Kemppainen, K.


    As part of Posiva's site and ONKALO investigations, the in situ rock stress has been measured by a variety of techniques, including hydraulic fracturing, overcoring, and convergence measurements. All these techniques involve direct measurements in a drillhole or at the rock surface. An alternative method is to test drillhole core in a way that enables estimation of the magnitudes and orientations of the in situ rock stress. The Kaiser Effect (KE) and Deformation Rate Analysis (DRA) are two ways to do this. In the work reported here, a 'blind' DRA test was conducted on core obtained from the POSE (Posiva's Olkiluoto Spalling Experiment) niche in the ONKALO. The term 'blind' means that the two first authors of this report, who conducted the tests at the Australian Centre for Geomechanics, did not know the depths below surface at which the cores had been obtained. The results of this DRA Test Case are presented, together with an explanation of the DRA procedure. Also, additional information that would help in such DRA testing and associated analysis is explained. One of the problems in comparing the DRA results with the known Olkiluoto stress field is that the latter is highly variable across the site, as experienced by the previous in situ stress measurements and as predicted by numerical analysis. The variability is mainly caused by the presence of the large brittle deformation zones which perturb the local stress state. However, this variability reduces with depth and the stress field becomes more stable at the {approx} 350 m at which the drillhole cores were obtained. Another compounding difficulty is that the stress quantity, being a second order tensor, requires six independent components for its specification. In other words, comparison of the DRA results and the known stress field requires comparison of six different quantities. In terms of the major principal stress orientation, the DRA results predict an orientation completely

  17. A test case of the deformation rate analysis (DRA) stress measurement method

    International Nuclear Information System (INIS)

    Dight, P.; Hsieh, A.; Johansson, E.; Hudson, J.A.; Kemppainen, K.


    As part of Posiva's site and ONKALO investigations, the in situ rock stress has been measured by a variety of techniques, including hydraulic fracturing, overcoring, and convergence measurements. All these techniques involve direct measurements in a drillhole or at the rock surface. An alternative method is to test drillhole core in a way that enables estimation of the magnitudes and orientations of the in situ rock stress. The Kaiser Effect (KE) and Deformation Rate Analysis (DRA) are two ways to do this. In the work reported here, a 'blind' DRA test was conducted on core obtained from the POSE (Posiva's Olkiluoto Spalling Experiment) niche in the ONKALO. The term 'blind' means that the two first authors of this report, who conducted the tests at the Australian Centre for Geomechanics, did not know the depths below surface at which the cores had been obtained. The results of this DRA Test Case are presented, together with an explanation of the DRA procedure. Also, additional information that would help in such DRA testing and associated analysis is explained. One of the problems in comparing the DRA results with the known Olkiluoto stress field is that the latter is highly variable across the site, as experienced by the previous in situ stress measurements and as predicted by numerical analysis. The variability is mainly caused by the presence of the large brittle deformation zones which perturb the local stress state. However, this variability reduces with depth and the stress field becomes more stable at the ∼ 350 m at which the drillhole cores were obtained. Another compounding difficulty is that the stress quantity, being a second order tensor, requires six independent components for its specification. In other words, comparison of the DRA results and the known stress field requires comparison of six different quantities. In terms of the major principal stress orientation, the DRA results predict an orientation completely different to the NW-SE regional

  18. 7 CFR 959.122 - Application. (United States)


    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Application. 959.122 Section 959.122 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... transportation; the consignee; the destination; the purpose for which the onions are to be used; and...

  19. 7 CFR 945.122 - Application. (United States)


    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Application. 945.122 Section 945.122 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... of transportation; the consignee; the destination; the purpose for which the potatoes are to be used...

  20. Core drilling of deep borehole OL-KR32 at Olkiluoto in Eurajoki 2004

    Energy Technology Data Exchange (ETDEWEB)

    Rautio, T. [Suomen Malmi Oy, Espoo (Finland)


    Posiva Oy submitted an application for the Decision in Principle to the Finnish Government in May 1999. A positive decision was made at the end of 2000 by the Government. The Finnish Parliament ratified the Decision in Principle on the final disposal facility for spent nuclear fuel at Olkiluoto, Eurajoki in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, the ONKALO, will be constructed. As a part of the investigations Suomen Malmi Oy (Smoy) core drilled a 191.81 m deep borehole with a diameter of 75.7 mm at Olkiluoto in November 2004. This borehole was aimed to get additional information of the quality and the location of the fractured zones R20A and R20B and the fractured zones near rock surface noticed in investigation trench TK8. The identification number of the borehole is OL-KR32. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. Both the volume and the electric conductivity of the drilling water and the returning water were recorded as well as the pressure of the drilling water. The objective of these measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The volume of the used drilling water was about 93 m{sup 3} and the measured volume of the returning water was about 6 m{sup 3} in borehole OL-KR32. The deviation of the borehole was measured with the deviation measuring instruments EMS and Maxibor. The results of the Maxibor measurements indicate that borehole OL-KR32 deviates 4.42 m right and 4.66 m up at the borehole depth of 189 m. Uniaxial compressive strength, Young's Modulus and Poisson's ratio were measured from the core samples. The average uniaxial compressive strength is about 130 MPa, the average Young's modulus is 47 GPa and

  1. Core drilling of deep borehole OL-KR43 at Olkiluoto in Eurajoki 2006

    Energy Technology Data Exchange (ETDEWEB)

    Niinimaeki, R. [Suomen Malmi Oy, Espoo (Finland)


    Posiva Oy submitted an application to the Finnish Government in May 1999 for the Decision in Principle to choose Olkiluoto in the municipality of Eurajoki as the site of the final disposal facility for spent nuclear fuel. A positive decision was made at the end of 2000 by the Government. The Finnish Parliament ratified the decision in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, ONKALO, will be constructed. As a part of the investigations Suomen Malmi Oy (Smoy) core drilled 1000.26 m and 45.01 m deep boreholes with a diameter of 75.7 mm at Olkiluoto in July - October 2006. The identification numbers of the boreholes are OL-KR43 and OL-KR43B, respectively. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. Both the volume and the electric conductivity of the drilling water and the returning water were recorded. The drill rig was computer controlled and during drilling the computer recorded drilling parameters. The objective of all these measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The total volumes of the used drilling and flushing water were 1103 m{sup 3} and 16 m{sup 3} in boreholes OL-KR43 and OL-KR43B, respectively. Measured volumes of the returning water were 916m{sup 3} in borehole OL-KR43 and 13m{sup 3} in borehole OL-KR43B. The deviation of the boreholes was measured with the deviation measuring instruments EMS and Maxibor. Uniaxial compressive strength, Young's Modulus and Poisson's ratio were measured from the core samples. The average uniaxial compressive strength is about 131 MPa, the average Young's Modulus is 37 GPa and the average Poisson's ratio is 0.19. The main rock types are veined gneiss, diatexitic gneiss

  2. Stable elements and radionuclides in shoreline alder stands at Olkiluoto in 2005

    International Nuclear Information System (INIS)

    Roivainen, P.


    In Finland, the final disposal of spent nuclear fuel from Finnish nuclear power plants is to take place in a repository, which will be built in Olkiluoto bedrock. According to the current plans, operation of the facility will start in 2020. Before this, a safety case has to be drawn up to substantiate the safety of the final disposal solution. The drawing up of the safety case also involves an assessment of impact on organisms other than human. Several radionuclides have a stable chemical analogue. Chemical analogues often display similar behaviour in the forest ecosystem. For this reason, information about radionuclides can also be obtained by studying stable elements. The purpose of this thesis was to study the migration of elements, radionuclides in particular, in the food webs of the Olkiluoto forest ecosystem. The objective was to produce concentration ratios between the various sub-components of the forest ecosystem. These ratios can be utilised in modelling. Three alder stands on the shores of Olkiluoto were used as monitoring plots. Littoral alder stands are an important biotope in terms of a recipient of the potential radionuclide contamination from the repository. Yet, research on littoral alder stands has so far been quite limited. From all the monitoring plots, a sample was taken of humus, mineral soil, understorey, plant roots and forest litter. Small mammals and earthworms were also to be caught from the monitoring plots, but no earthworms could be caught in any of the areas. All the collected samples were analysed for element concentrations using the ICP-AES method. Soil and plant samples were also analysed with a gamma spectrometer for activity concentrations of gamma active radionuclides. Activity concentrations of Cs-137 and K-40 could be determined in all soil and plant samples. The highest activity concentration of Cs-137 was found in humus, and the lowest in mineral soil. The activity concentration of K-40 was at its highest in mineral soil and

  3. 7 CFR 948.122 - Application. (United States)


    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Application. 948.122 Section 948.122 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... destination; the purpose for which the potatoes are to be used; a certification to the United States...

  4. 39 CFR 122.1 - Ancillary special services. (United States)


    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Ancillary special services. 122.1 Section 122.1 Postal Service UNITED STATES POSTAL SERVICE POST OFFICE SERVICES [DOMESTIC MAIL] SERVICE STANDARDS FOR MARKET-DOMINANT SPECIAL SERVICES PRODUCTS § 122.1 Ancillary special services. (a) For the market-dominant...

  5. 46 CFR 122.208 - Accidents to machinery. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Accidents to machinery. 122.208 Section 122.208 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS CARRYING MORE THAN 150... Voyage Records § 122.208 Accidents to machinery. The owner, managing operator, or master shall report...

  6. Development of SVAT model for computing water and energy balance of the forest intensive monitoring plots on Olkiluoto island

    International Nuclear Information System (INIS)

    Karvonen, T.


    This Working Report presents the main results of SVAT (Soil-Vegetation-Atmosphere- Transfer) model that was developed to analyze the different water and energy balance components of the Forest Intensive monitoring plots (FIP) on Olkiluoto Island. The Olkiluoto SVAT model divides above ground vegetation in two layers: overstorey (trees) and understorey. Hydrological processes that are quantified in the SVAT model of forest stands include precipitation, interception, evaporation, transpiration, snow accumulation and melt, soil and ground water movement, overland flow, horizontal subsurface flow and flow to forest ditches. In this report outlines for simplifying the existing SVAT model to a computational tool that can be used in biosphere modeling for long-term safety purposes are also given. The functioning of forest ecosystems on Olkiluoto Island is studied in Forest Intensive monitoring Plots (FIP): FIP4 (Scots pine forest), FIP10 (Norway spruce forest) and FIP11 (young Norway spruce/birch forest). Within the forest intensive monitoring plots (FIP4, 10 and 11) stand meteorological measurements are recorded once an hour. The parameters are air temperature, minimum and maximum temperature inside the crown layer and above the canopy, radiation, relative humidity, precipitation, soil moisture content, soil temperature and sap flow measurements (May 2007- June 2008). Measured versus computed cumulative stand throughfall were in good agreement with each other indicating that the SVAT model can be calibrated to reproduce very well the measured throughfall rates. Estimated stem flow was around 10% of precipitation for the Scots pine forest (FIP4), around 4 % for Norway spruce forest (FIP10) and about 3 % for young Norway spruce/birch forest (FIP11). For FIP4 the computed interception values were approximately 3-4 % bigger than the measured values but SVAT model predicted the yearly variation very well. For FIP10 average computed value was around 1 % smaller than the

  7. Xenosensor CAR mediates down-regulation of miR-122 and up-regulation of miR-122 targets in the liver

    Energy Technology Data Exchange (ETDEWEB)

    Kazantseva, Yuliya A.; Yarushkin, Andrei A.; Mostovich, Lyudmila A. [The Institute of Molecular Biology and Biophysics, Timakova str., 2/12, Novosibirsk 630117 (Russian Federation); Pustylnyak, Yuliya A. [Novosibirsk State University, Pirogova str., 2, Novosibirsk 630090 (Russian Federation); Pustylnyak, Vladimir O., E-mail: [The Institute of Molecular Biology and Biophysics, Timakova str., 2/12, Novosibirsk 630117 (Russian Federation); Novosibirsk State University, Pirogova str., 2, Novosibirsk 630090 (Russian Federation); The Institute International Tomography Center of the Russian Academy of Sciences, Institutskaya str. 3-A, Novosibirsk 630090 (Russian Federation)


    MiR-122 is a major hepatic microRNA, accounting for more than 70% of the total liver miRNA population. It has been shown that miR-122 is associated with liver diseases, including hepatocellular carcinoma. Mir-122 is an intergenic miRNA with its own promoter. Pri-miR-122 expression is regulated by liver-enriched transcription factors, mainly by HNF4α, which mediates the expression via the interaction with a specific DR1 site. It has been shown that phenobarbital-mediated activation of constitutive androstane receptor (CAR), xenobiotic nuclear receptor, is associated with a decrease in miR-122 in the liver. In the present study, we investigated HNF4α–CAR cross-talk in the regulation of miR-122 levels and promitogenic signalling in mouse livers. The level of miR-122 was significantly repressed by treatment with 1,4-bis[2-(3,5-dichloropyridyloxy)]benzene (TCPOBOP), which is an agonist of mouse CAR. ChIP assays demonstrated that TCPOBOP-activated CAR inhibited HNF4α transactivation by competing with HNF4α for binding to the DR1 site in the pri-miR-122 promoter. Such transcription factor replacement was strongly correlated with miR-122 down-regulation. Additionally, the decrease in miR-122 levels produced by CAR activation is accompanied by an increase in mRNA and cellular protein levels of E2f1 and its accumulation on the target cMyc gene promoter. The increase in accumulation of E2f1 on the target cMyc gene promoter is accompanied by an increase in cMyc levels and transcriptional activity. Thus, our results provide evidence to support the conclusion that CAR activation decreases miR-122 levels through suppression of HNF4α transcriptional activity and indirectly regulates the promitogenic protein cMyc. HNF4α–CAR cross-talk may provide new opportunities for understanding liver diseases and developing more effective therapeutic approaches to better drug treatments. - Highlights: • CAR activation decreased the level of miR-122 in mouse livers. • CAR decreases

  8. Xenosensor CAR mediates down-regulation of miR-122 and up-regulation of miR-122 targets in the liver

    International Nuclear Information System (INIS)

    Kazantseva, Yuliya A.; Yarushkin, Andrei A.; Mostovich, Lyudmila A.; Pustylnyak, Yuliya A.; Pustylnyak, Vladimir O.


    MiR-122 is a major hepatic microRNA, accounting for more than 70% of the total liver miRNA population. It has been shown that miR-122 is associated with liver diseases, including hepatocellular carcinoma. Mir-122 is an intergenic miRNA with its own promoter. Pri-miR-122 expression is regulated by liver-enriched transcription factors, mainly by HNF4α, which mediates the expression via the interaction with a specific DR1 site. It has been shown that phenobarbital-mediated activation of constitutive androstane receptor (CAR), xenobiotic nuclear receptor, is associated with a decrease in miR-122 in the liver. In the present study, we investigated HNF4α–CAR cross-talk in the regulation of miR-122 levels and promitogenic signalling in mouse livers. The level of miR-122 was significantly repressed by treatment with 1,4-bis[2-(3,5-dichloropyridyloxy)]benzene (TCPOBOP), which is an agonist of mouse CAR. ChIP assays demonstrated that TCPOBOP-activated CAR inhibited HNF4α transactivation by competing with HNF4α for binding to the DR1 site in the pri-miR-122 promoter. Such transcription factor replacement was strongly correlated with miR-122 down-regulation. Additionally, the decrease in miR-122 levels produced by CAR activation is accompanied by an increase in mRNA and cellular protein levels of E2f1 and its accumulation on the target cMyc gene promoter. The increase in accumulation of E2f1 on the target cMyc gene promoter is accompanied by an increase in cMyc levels and transcriptional activity. Thus, our results provide evidence to support the conclusion that CAR activation decreases miR-122 levels through suppression of HNF4α transcriptional activity and indirectly regulates the promitogenic protein cMyc. HNF4α–CAR cross-talk may provide new opportunities for understanding liver diseases and developing more effective therapeutic approaches to better drug treatments. - Highlights: • CAR activation decreased the level of miR-122 in mouse livers. • CAR decreases

  9. ONKALO POSE experiment. Phase 3: acoustic and ultrasonic monitoring

    International Nuclear Information System (INIS)

    Reyes-Montes, J.; Flynn, W.; Huang, J.


    The objectives of the third phase of the POSE experiment are to determine the in situ state of stress at Olkiluoto and the spalling strength of Olkiluoto rock, by internal heating of the experimental hole (ONK-EH3) using 8 vertically installed heaters. This report presents the results from the Acoustic and ultrasonic monitoring carried out around the third experimental hole of the POSE niche between November 2012 and May 2013. The experiment was monitored using an array of 24 transducers installed along 4 monitoring drillholes and data was automatically acquired and processed using the system installed at the niche by Applied Seismology Consultants in May 2012. Daily ultrasonic surveys were carried out between 14 th November 2012 and 21 st May 2013, monitoring the changes in transmission velocities of P and S-waves with an estimated error of ±2 m x s -1 (ASC, 2013). Changes in transmission velocities closely follow the evolution of the temperature profile in the hole wall. An increase in both P-and S-wave transmission velocities is observed at all depth levels and surveyed raypaths during the heating phase, with the highest changes observed in raypaths skimming the hole surface and depths between 2.33 m and 3.7 m. This observation indicates the closure of in situ and excavation-induced microcracks due to thermal stress. After the heaters were switched off, P-wave velocities show a marked decrease, in all raypaths reaching values below those measured at the start of the monitoring approximately 4 weeks after the heaters were switched off. The highest decrease was observed along raypaths surveying the region skimming the hole wall. This decrease below original background values indicates the induction of rock degradation as microcracking induced through the heating-cooling cycle. Changes in P- and S-wave transmission velocity were used to calculate changes in Young's modulus and Poisson's ratio along the different raypaths and depth levels. An overall

  10. Finnish EPR Olkiluoto 3. The world's first third-generation reactor now under construction

    International Nuclear Information System (INIS)


    The EPR was developed by Framatome and Siemens KWU (the nuclear division of Siemens), whose nuclear activities were combined in January 2001 to form Framatome ANP, now AREVA NP. The French electricity utility EDF (Electricite de France), together with the major German utilities, played an active role in the project. The safety authorities of the two countries joined forces to bring their respective safety standards into line and draw up joint design rules for the new reactor. On December 18, 2003, the consortium formed by AREVA and Siemens - and led by AREVA - signed a contract with TVO for the turnkey construction of the EPR. The overall Olkiluoto 3 project cost has been estimated by TVO at around euros 3 Billion. TVO is responsible for the overall project management and licensing process with the Finnish Safety Authority STUK. In the pre-qualification phase, STUK concluded that the EPR can meet the Finnish licensing requirements. All specific comments will be taken into account for the realization of the project. In January 2005, STUK emphasized in its safety assessment that the evolutionary EPR design compared to predecessor product lines has been further enhanced by AREVA. This paper presents first, The Finnish energy situation (Electricity consumption and supply, Finland's Kyoto CO 2 cutback, Competitiveness of nuclear power), and then the EPR in Olkiluoto (General schedule of responsibilities, Important milestones of the project). Finally, the EPR third-generation and advanced reactor is presented with its position in the international competition (Targeted design objectives, Main characteristics, competitiveness, safety, Additional measures to prevent the occurrence of events likely to damage the core, Increased protection against the consequences of core melt)

  11. The estimation of future surface water bodies at Olkiluoto area based on statistical terrain and land uplift models

    Energy Technology Data Exchange (ETDEWEB)

    Pohjola, J.; Turunen, J.; Lipping, T. [Tampere Univ. of Technology (Finland); Ikonen, A.


    In this working report the modelling effort of future landscape development and surface water body formation at the modelling area in the vicinity of the Olkiluoto Island is presented. Estimation of the features of future surface water bodies is based on probabilistic terrain and land uplift models presented in previous working reports. The estimation is done using a GIS-based toolbox called UNTAMO. The future surface water bodies are estimated in 10 000 years' time span with 1000 years' intervals for the safety assessment of disposal of spent nuclear fuel at the Olkiluoto site. In the report a brief overview on the techniques used for probabilistic terrain modelling, land uplift modelling and hydrological modelling are presented first. The latter part of the report describes the results of the modelling effort. The main features of the future landscape - the four lakes forming in the vicinity of the Olkiluoto Island - are identified and the probabilistic model of the shoreline displacement is presented. The area and volume of the four lakes is modelled in a probabilistic manner. All the simulations have been performed for three scenarios two of which are based on 10 realizations of the probabilistic digital terrain model (DTM) and 10 realizations of the probabilistic land uplift model. These two scenarios differ from each other by the eustatic curve used in the land uplift model. The third scenario employs 50 realizations of the probabilistic DTM while a deterministic land uplift model, derived solely from the current land uplift rate, is used. The results indicate that the two scenarios based on the probabilistic land uplift model behave in a similar manner while the third model overestimates past and future land uplift rates. The main features of the landscape are nevertheless similar also for the third scenario. Prediction results for the volumes of the future lakes indicate that a couple of highly probably lake formation scenarios can be identified

  12. The estimation of future surface water bodies at Olkiluoto area based on statistical terrain and land uplift models

    International Nuclear Information System (INIS)

    Pohjola, J.; Turunen, J.; Lipping, T.; Ikonen, A.


    In this working report the modelling effort of future landscape development and surface water body formation at the modelling area in the vicinity of the Olkiluoto Island is presented. Estimation of the features of future surface water bodies is based on probabilistic terrain and land uplift models presented in previous working reports. The estimation is done using a GIS-based toolbox called UNTAMO. The future surface water bodies are estimated in 10 000 years' time span with 1000 years' intervals for the safety assessment of disposal of spent nuclear fuel at the Olkiluoto site. In the report a brief overview on the techniques used for probabilistic terrain modelling, land uplift modelling and hydrological modelling are presented first. The latter part of the report describes the results of the modelling effort. The main features of the future landscape - the four lakes forming in the vicinity of the Olkiluoto Island - are identified and the probabilistic model of the shoreline displacement is presented. The area and volume of the four lakes is modelled in a probabilistic manner. All the simulations have been performed for three scenarios two of which are based on 10 realizations of the probabilistic digital terrain model (DTM) and 10 realizations of the probabilistic land uplift model. These two scenarios differ from each other by the eustatic curve used in the land uplift model. The third scenario employs 50 realizations of the probabilistic DTM while a deterministic land uplift model, derived solely from the current land uplift rate, is used. The results indicate that the two scenarios based on the probabilistic land uplift model behave in a similar manner while the third model overestimates past and future land uplift rates. The main features of the landscape are nevertheless similar also for the third scenario. Prediction results for the volumes of the future lakes indicate that a couple of highly probably lake formation scenarios can be identified with other

  13. 19 CFR 122.4 - English language required. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false English language required. 122.4 Section 122.4... TREASURY AIR COMMERCE REGULATIONS General Definitions and Provisions § 122.4 English language required. A translation in the English language shall be attached to the original and each copy of any form or document...

  14. 7 CFR 15.122 - Offer of proof. (United States)


    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Offer of proof. 15.122 Section 15.122 Agriculture..., Decisions and Administrative Review Under the Civil Rights Act of 1964 Hearing Procedures § 15.122 Offer of proof. An offer of proof made in connection with an objection taken to any ruling of the hearing officer...

  15. Regulatory aspects of Olkiluoto 3 nuclear power plant (EPR-1600) (Draft, 12 Sept. 2005)

    International Nuclear Information System (INIS)

    Sandberg, J.; Tiippana, P.


    A 1600 MWe European Pressurized Water Reactor (EPR) supplied by the Framatome ANP - Siemens Consortium is under construction at the Olkiluoto site in Finland. Current international safety requirements and especially French and German operating experience have been applied in the design. Finnish requirements and operating experience have also been applied, especially regarding site-specific features. Severe accidentmanagement and protection against a collision of a large passenger airplane are implemented in the plant design. The plant safety features, licensing procedure, Finnish regulatory requirements, changes to the original EPR design, project quality management and regulatory control are discussed. (author)

  16. Stress evolution and fault stability at Olkiluoto during the Weichselian glaciation

    International Nuclear Information System (INIS)

    Lund, B.; Schmidt, P.


    In this study we investigate how a model of the Weichselian glacial cycle affects the state of stress in the Earth, and how those changes in stress influence the stability of faults. The main objectives for this study are the evolution of the glacially induced stresses at repository depth in Olkiluoto, Finland, and the stability field at seismogenic depths below the proposed repository. The analysis presented here is similar to the study by Lund et al. (2009) for the proposed Swedish nuclear waste repository sites of Forsmark and Oskarshamn. Along the lines of Lund et al. (2009), this study is a modeling study, where we use three-dimensional ice and earth models to calculate the glacial isostatic adjustment (GIA), i.e. the response of the Earth to an ice load, examining both displacements and stresses

  17. Significance and estimations of lifetime of natural fracture mineral buffers in the Olkiluoto bedrock

    International Nuclear Information System (INIS)

    Luukkonen, A.; Pitkaenen, P.; Partamies, S.


    This study attempts to make scenarios what geochemical effects the future underground excavations in the Olkiluoto bedrock have on naturally occurring fracture mineral buffers. The excavations of underground research facilities, and final repository galleries will cause steep hydraulic gradients in the bedrock fractures. These gradients likely draw surficial waters within the fracture network and activate weathering processes deeper in rock fractures than in the natural undisturbed conditions. The studies are concentrated on the meteoric and seawater infiltration in the rock fractures, and on the selected minerals considered significant buffers against pH/redox variations in groundwater. Two approaches to calculate the scenarios are utilised. The equilibrium geochemical calculations consider variety of problems including several surficial water compositions, mixing cases between surficial water types, and couple buffer mineral assemblages. These equilibrium calculations indicate that meteoric water by far presents the most potential hazard for the Olkiluoto fracture minerals. In the calculated cases, seawater and the contamination of meteoric water with seawater during the water infiltration usually improved the performance of mineral buffers compared to the pure meteoric water cases. Of the Olkiluoto fracture minerals, calcite and pyrite turn out to be the most important buffer minerals against dissolved O 2 and low pH in groundwater. The kinetic geochemical approach concentrated on two meteoric water cases infiltrating into a narrow fracture channel. Calculations consider the possibilities that the infiltrating meteoric water is dissolved carbon containing soil water or almost 'distilled' rain water. Pyrite and calcite are taken into account as the buffering minerals. Several simulations are done by varying the recharge water compositions and the flow rates of water. It turns out that as long as volumetric flow rates within the 500-metre-channel considered are in

  18. TABLE III. Deaths in 122 U.S. cities (United States)

    U.S. Department of Health & Human Services — TABLE III. Deaths in 122 U.S. cities - 2014. 122 Cities Mortality Reporting System — Each week, the vital statistics offices of 122 cities across the United States...

  19. Rock mechanics stability at Olkiluoto, Haestholmen, Kivetty and Romuvaara

    International Nuclear Information System (INIS)

    Johansson, E.; Rautakorpi, J.


    Posiva Oy is studying the suitability of the Finnish bedrock for the geological disposal of spent nuclear fuel at four sites, Olkiluoto in Eurajoki, Haestholmen in Loviisa, Kivetty in Aeaenekoski and Romuvaara in Kuhmo. To enable the rock properties to be specified in great detail, the site-selection research programme has included rock mechanics investigations such as the measurement of in-situ rock stress and laboratory tests on rock samples. This report presents the results of the rock mechanics analyses performed on the main rock types at the Olkiluoto, Romuvaara, Kivetty and Haestholmen sites. The objective of this study was to assess the near-field stability of the final disposal tunnels and deposition holes at each of the investigation sites. Two empirical methods and a numerical method based on three-dimensional element code (3DEC) were used the analysis tools. A statistical approach was used to select the necessary input data and to specify the cases being analysed. The stability of the KBS-3 and MLH (Medium Long Hole) repository concepts during the pre-closure and post-closure phases was analysed. The repository depths investigated lay between 300 m and 700 m. The empirical methods are based on the study of the ratios between rock strength and the in-situ stress which could result in possible fracturing of the rock mass. Interpretation of the numerical analyses is based on the assumption of an elastic distribution of stress around the disposal tunnel and the deposition hole and the brittle rock strength criterion. The results obtained in this study indicate that in general, the rock mechanics conditions during the pre-closure and post-closure phases at each of the investigated sites remain good and stable between the studied depth levels, especially when the deposition rooms are oriented in a direction parallel to the major in-situ stress. If the disposal tunnels are orientated in a direction perpendicular to the major in-situ stress, the resultant

  20. TABLE III. Deaths in 122 U.S. cities (United States)

    U.S. Department of Health & Human Services — TABLE III. Deaths in 122 U.S. cities – 2016. 122 Cities Mortality Reporting System — Each week, the vital statistics offices of 122 cities across the United States...

  1. Core drilling of deep borehole OL-KR33 at Olkiluoto in Eurajoki 2004

    Energy Technology Data Exchange (ETDEWEB)

    Rautio, T. [Suomen Malmi Oy, Espoo (Finland)


    Posiva Oy submitted an application for the Decision in Principle to the Finnish Government in May 1999. A positive decision was made at the end of 2000 by the Government. The Finnish Parliament ratified the Decision in Principle on the final disposal facility for spent nuclear fuel at Olkiluoto, Eurajoki in May 2001. The decision makes it possible for Posiva to focus the confirming bedrock investigations at Olkiluoto, where in the next few years an underground rock characterisation facility, the ONKALO, will be constructed. As a part of the investigations Suomen Malmi Oy (Smoy) core drilled 311.02 m and 45.53 m deep boreholes with a diameter of 75.7 mm at Olkiluoto in November-December 2004. These boreholes were aimed to get additional information of the quality of bedrock and the quality and the location of the fractured zones R2, RH9 and R72. The identification numbers of the boreholes are OL-KR33 and OL-KR33B, respectively. A set of monitoring measurements and samplings from the drilling and returning water was carried out during the drilling. Both the volume and the electric conductivity of the drilling water and the returning water were recorded as well as the pressure of the drilling water. The objective of these measurements was to obtain more information about bedrock and groundwater properties. Sodium fluorescein was used as a label agent in the drilling water. The volumes of the used drilling water were about 195m{sup 3} and 14m{sup 3} and the measured volumes of the returning water were about 100 m{sup 3} and 9 m{sup 3} in boreholes OL-KR33 and OL-KR33B, respectively. The deviations of the boreholes were measured with the deviation measuring instruments EMS and Maxibor. The results of the Maxibor measurements indicate that borehole OL-KR33 deviates 15.97 m right and 31.04 m up at the borehole depth of 309 m. Uniaxial compressive strength, Young's Modulus and Poisson's ratio were measured from the core samples. The average uniaxial compressive

  2. 7 CFR 1221.122 - Independent evaluation. (United States)


    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Independent evaluation. 1221.122 Section 1221.122 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... INFORMATION ORDER Sorghum Promotion, Research, and Information Order Promotion, Research, and Information...

  3. An isotopic and fluid inclusion study of fracture calcite from borehole OL-KR1 at the Olkiluoto site, Finland

    International Nuclear Information System (INIS)

    Blyth, A.; Frape, S.; Blomqvist, R.; Nissinen, P.; McNutt, R.


    A study of the geochemistry of fracture filling calcite in borehole OL-KR1 at the radioactive waste disposal investigation site Olkiluoto (in Finland) was undertaken in 1998. The purpose of the present study is to characterize the fracture calcite using mineralogy, oxygen, carbon and strontium isotopes, and fluid inclusions in order to determine past and present chemical and isotopic condition at the site

  4. An isotopic and fluid inclusion study of fracture calcite from borehole OL-KR1 at the Olkiluoto site, Finland

    Energy Technology Data Exchange (ETDEWEB)

    Blyth, A.; Frape, S. [Univ. of Waterloo, ON (Canada); Blomqvist, R.; Nissinen, P. [Geological Survey of Finland, Espoo (Finland); McNutt, R. [McMaster Univ. of Hamilton, ON (Canada)


    A study of the geochemistry of fracture filling calcite in borehole OL-KR1 at the radioactive waste disposal investigation site Olkiluoto (in Finland) was undertaken in 1998. The purpose of the present study is to characterize the fracture calcite using mineralogy, oxygen, carbon and strontium isotopes, and fluid inclusions in order to determine past and present chemical and isotopic condition at the site 39 refs.

  5. Permanent vegetation quadrats on Olkiluoto island. Establishment and results from the first inventory

    Energy Technology Data Exchange (ETDEWEB)

    Huhta, A.P.; Korpela, L. [Finnish Forest Research Institute, Helsinki (Finland)


    This report describes in detail the vegetation quadrats established inside the permanent, follow-up sample plots (Forest Extensive High-level monitoring plots, FEH) on Olkiluoto Island. During summer 2005 a total of 94 sample plots (a 30 m{sup 2}), each containing eight quadrats (a 1m{sup 2}), were investigated. The total number of sampled quadrats was 752. Seventy of the 94 plots represent coniferous stands: 57 Norway spruce-dominated and 13 Scots pine-dominated stands. Ten of the plots represent deciduous, birch-dominated (Betula spp.) stands, 7 plots common alder-dominated (Alnus glutinosa) stands, and seven plots are mires. The majority of the coniferous tree stands were growing on sites representing various succession stages of the Myrtillus, Vaccinium-Myrtillus and Deschampsia-Myrtillus forest site types. The pine-dominated stands growing on exposed bedrock clearly differed from the other coniferous stands: the vegetation was characterised by the Cladina, Calluna-Cladina and Empetrum-Vaccinium vitis-idaea/Vaccinium Myrtillus forest site types. The deciduous stands were characterized by tall grasses, especially Calamagrostis epigejos, C. purpurea and Deschampsia flexuosa. The vegetation of the deciduous stands dominated by common alder represented grove-like sites and seashore groves. Typical species for mires included Calamagrostis purpurea, Calla palustris, Equisetum sylvaticum, and especially white mosses (Sphagnum spp.). A total of 184 vascular plant species were found growing within the quadrats. Due to the high number of quadrats in these forests, the spruce stands had the highest total number of species, but the birch and alder-dominated forests had the highest average number of species per quadrat. This basic inventory of the permanent vegetation quadrats on Olkiluoto Island provides a sound starting point for future vegetation surveys. Guidelines for future inventories and supplementary sampling are given in the discussion part of this report. (orig.)

  6. Permanent vegetation quadrats on Olkiluoto island. Establishment and results from the first inventory

    International Nuclear Information System (INIS)

    Huhta, A.P.; Korpela, L.


    This report describes in detail the vegetation quadrats established inside the permanent, follow-up sample plots (Forest Extensive High-level monitoring plots, FEH) on Olkiluoto Island. During summer 2005 a total of 94 sample plots (a 30 m 2 ), each containing eight quadrats (a 1m 2 ), were investigated. The total number of sampled quadrats was 752. Seventy of the 94 plots represent coniferous stands: 57 Norway spruce-dominated and 13 Scots pine-dominated stands. Ten of the plots represent deciduous, birch-dominated (Betula spp.) stands, 7 plots common alder-dominated (Alnus glutinosa) stands, and seven plots are mires. The majority of the coniferous tree stands were growing on sites representing various succession stages of the Myrtillus, Vaccinium-Myrtillus and Deschampsia-Myrtillus forest site types. The pine-dominated stands growing on exposed bedrock clearly differed from the other coniferous stands: the vegetation was characterised by the Cladina, Calluna-Cladina and Empetrum-Vaccinium vitis-idaea/Vaccinium Myrtillus forest site types. The deciduous stands were characterized by tall grasses, especially Calamagrostis epigejos, C. purpurea and Deschampsia flexuosa. The vegetation of the deciduous stands dominated by common alder represented grove-like sites and seashore groves. Typical species for mires included Calamagrostis purpurea, Calla palustris, Equisetum sylvaticum, and especially white mosses (Sphagnum spp.). A total of 184 vascular plant species were found growing within the quadrats. Due to the high number of quadrats in these forests, the spruce stands had the highest total number of species, but the birch and alder-dominated forests had the highest average number of species per quadrat. This basic inventory of the permanent vegetation quadrats on Olkiluoto Island provides a sound starting point for future vegetation surveys. Guidelines for future inventories and supplementary sampling are given in the discussion part of this report. (orig.)

  7. 18 CFR 284.122 - Transportation by intrastate pipelines. (United States)


    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Transportation by intrastate pipelines. 284.122 Section 284.122 Conservation of Power and Water Resources FEDERAL ENERGY... 1978 AND RELATED AUTHORITIES Certain Transportation by Intrastate Pipelines § 284.122 Transportation by...

  8. Statistical Analysis and Modelling of Olkiluoto Structures

    International Nuclear Information System (INIS)

    Hellae, P.; Vaittinen, T.; Saksa, P.; Nummela, J.


    Posiva Oy is carrying out investigations for the disposal of the spent nuclear fuel at the Olkiluoto site in SW Finland. The investigations have focused on the central part of the island. The layout design of the entire repository requires characterization of notably larger areas and must rely at least at the current stage on borehole information from a rather sparse network and on the geophysical soundings providing information outside and between the holes. In this work, the structural data according to the current version of the Olkiluoto bedrock model is analyzed. The bedrock model relies much on the borehole data although results of the seismic surveys and, for example, pumping tests are used in determining the orientation and continuation of the structures. Especially in the analysis, questions related to the frequency of structures and size of the structures are discussed. The structures observed in the boreholes are mainly dipping gently to the southeast. About 9 % of the sample length belongs to structures. The proportion is higher in the upper parts of the rock. The number of fracture and crushed zones seems not to depend greatly on the depth, whereas the hydraulic features concentrate on the depth range above -100 m. Below level -300 m, the hydraulic conductivity occurs in connection of fractured zones. Especially the hydraulic features, but also fracture and crushed zones often occur in groups. The frequency of the structure (area of structures per total volume) is estimated to be of the order of 1/100m. The size of the local structures was estimated by calculating the intersection of the zone to the nearest borehole where the zone has not been detected. Stochastic models using the Fracman software by Golder Associates were generated based on the bedrock model data complemented with the magnetic ground survey data. The seismic surveys (from boreholes KR5, KR13, KR14, and KR19) were used as alternative input data. The generated models were tested by

  9. New low-spin states of 122Xe observed via high-statistics β-decay of 122Cs (United States)

    Jigmeddorj, B.; Garrett, P. E.; Andreoiu, C.; Ball, G. C.; Bruhn, T.; Cross, D. S.; Garnsworthy, A. B.; Hadinia, B.; Moukaddam, M.; Park, J.; Pore, J. L.; Radich, A. J.; Rajabali, M. M.; Rand, E. T.; Rizwan, U.; Svensson, C. E.; Voss, P.; Wang, Z. M.; Wood, J. L.; Yates, S. W.


    Excited states of 122Xe were studied via the β+/EC decay of 122Cs with the 8π γ-ray spectrometer at the TRIUMF-ISAC facility. Compton-suppressed HPGe detectors were used for measurements of γ-ray intensities, γγ coincidences, and γ-γ angular correlations. Two sets of data were collected to optimize the decays of the ground (21.2 s) and isomeric (3.7 min) states of 122Cs. The data collected have enabled the observation of about 505 new transitions and about 250 new levels, including 51 new low-spin states. Spin assignments have been made for 58 low-spin states based on the deduced β-decay feeding and γ-γ angular correlation analyses.

  10. Regional development of river basins in the Olkiluoto-Pyhaejaervi Area, SW Finland, 2000 BP - 8000 AP

    International Nuclear Information System (INIS)

    Ojala, A.E.K.; Virkki, H.; Palmu, J.-P.; Hokkanen, K.; Kaija, J.


    Biosphere assessment forms one of the main components in Posiva's Safety Case portfolio and includes analyses of terrain and ecosystem development. Shoreline displacement and changes in surface hydrology form one part of these analyses. In this report, the regional development of the Olkiluoto-Pyhaejaervi area in the time period 2000 BP - 8000 AP was examined by taking into account changes in the surface flow patterns of the Lapinjoki and Eurajoki river basins. A hydrological model, EULA, was developed and applied to investigate the past and future hydrological regimes and changes in the Olkiluoto-Pyhaejaervi study area. As detailed assessment of erosion and sedimentation effects were not within the scope of this study, only their general effects were evaluated. The digital elevation models (DEM) for different time stages (2000, 1500, 1000 and 500 BP; 100, 300, 500, 1000, 1500, 2000, 2500, 3000, 3500, 4000, 4500, 5000, 6000, 7000 and 8000 AP) were compiled taking into account the land uplift and tilting of the Earth's crust. With the aid of various sophisticated GIS tools, the boundaries of the main river basins, the flow patterns of rivers and development of lakes during each stage were modelled. The yearly discharge rates of rivers Eurajoki and Lapinjoki were also evaluated with the assumption that present climatic features prevail during the whole time period 2000 BP - 8000 AP. Finally, the probability of significant changes in the surface water flow routes were estimated during different stages. (orig.)

  11. 46 CFR 122.518 - Inflatable survival craft placards. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Inflatable survival craft placards. 122.518 Section 122... Preparations for Emergencies § 122.518 Inflatable survival craft placards. (a) Every vessel equipped with an inflatable survival craft must have approved placards or other cards containing instructions for launching...

  12. Progesterone-associated proteins PP12 and PP14 in the human endometrium. (United States)

    Rutanen, E M; Koistinen, R; Seppälä, M; Julkunen, M; Suikkari, A M; Huhtala, M L


    Two proteins, designated as PP12 and PP14 were originally isolated from soluble extracts of the human placenta and its adjacent membranes. We have shown that they are synthesized by decidualized/secretory endometrium and not by placenta. Both proteins occur at high concentrations in human amniotic fluid, which is therefore an excellent source for purification. PP12 is a 34-kDa glycoprotein, which has an N-terminal amino acid sequence of Ala-Pro-Trp-Gln-Cys-Ala-Pro-Cys-Ser-Ala. This is identical with that of somatomedin-binding protein purified from the amniotic fluid. PP12 too binds somatomedin-C, or IGF-I (insulin-like growth factor-I). Human secretory endometrium synthesizes and secretes PP12, and progesterone stimulates its secretion. PP14 is a 28-kDa glycoprotein. Its N-terminal sequence shows homology to that of beta-lactoglobulins from various species. We have found PP14 in the human endometrium, serum and milk. Immunologically, PP14 is related to progestagen-associated endometrial protein (PEP), alpha-2 pregnancy-associated endometrial protein (alpha-2, PEG), endometrial protein 15 (EP15), alpha-uterine protein (AUP) and chorionic alpha-2 microglobulin (CAG-2). In ovulatory menstrual cycles, the concentration of PP14 increases in endometrial tissue as the secretory changes advance. In serum, the PP14 concentration begins to rise later than the progesterone levels, and high serum PP14 levels are maintained for the first days of the next cycle. By contrast, no elevation of serum PP14 level is seen in anovulatory cycles. Our results show that progesterone-associated proteins are synthesized by the human endometrium and appear in the peripheral circulation, where they can be quantitatively measured using immunochemical techniques.

  13. Deformations during saturation of the crushed aggregate, Olkiluoto tonalite

    International Nuclear Information System (INIS)

    Laaksonen, R.; Rathmayer, H.; Takala, J.; Toernqvist, J.


    Crushed aggregate tonalite produced of crystalline tonalite or a correspondent rock with particle size up to 8 mm (or 16 mm) will be used as backfill material in the VLJ repository caverns at Olkiluoto (in Finland). The backfill material has to retard radionuclides, to restrict the groundwater perlocation and to support mechanically the concrete structure of the repository silos. Mechanical and hydraulic behaviour of crushed tonalite when effected by stresses applied during compaction of the backfill and due to groundwater perlocation was studied at three batches having different gradations. Information about the phenomenon of settlement due to saturation and as a function of the compaction methods was obtained from a literature survey. The maximum amount of possible deformation due to compaction was analyzed with a gyratory device, known to have a good repeatability. In a group of simulation tests using a large oedometer cell the amount of compression due to the saturation process was measured. Also studies on the suitability of different compaction methods could be done with these tests. (43 refs., 49 figs., 3 tabs.)

  14. 39 CFR 122.2 - Stand-alone special services. (United States)


    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Stand-alone special services. 122.2 Section 122.2 Postal Service UNITED STATES POSTAL SERVICE POST OFFICE SERVICES [DOMESTIC MAIL] SERVICE STANDARDS FOR MARKET-DOMINANT SPECIAL SERVICES PRODUCTS § 122.2 Stand-alone special services. (a) The service standard...

  15. 19 CFR 122.5 - Reproduction of Customs forms. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Reproduction of Customs forms. 122.5 Section 122.5 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS General Definitions and Provisions § 122.5 Reproduction of Customs forms...

  16. 46 CFR 122.602 - Hull markings. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Hull markings. 122.602 Section 122.602 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS CARRYING MORE THAN 150....602 Hull markings. (a) Each vessel must be marked as required by part 67, subpart I, of this chapter...

  17. Game statistics for the island of Olkiluoto in 2010-2011

    International Nuclear Information System (INIS)

    Nieminen, M.; Niemi, M.; Jussila, I.


    The game statistics for the island of Olkiluoto were updated in the summer 2011 and compared with earlier statistics. Population size estimates are based on interviews of the local hunters. No moose or deer inventories were made in the winter 2010-2011. The moose population is stable when compared with the previous year. The white-tailed deer population is stable or slightly increasing when compared with the previous year. The changes in the roe deer population are not accurately known, but population size varies somewhat from year to year. The number of hunted raccoon dogs approximately doubled in the latest hunting season. Altogether two waterfowl were hunted in 2010 (17 in the previous year). The populations of mountain hare and red squirrel are abundant, and the number of hunted mountain hares approximately doubled when compared with the previous hunting season. The brown hare population is still small. In the winter, there were observations of one lynx spending time in the area. (orig.)

  18. Game statistics for the island of Olkiluoto in 2010-2011

    Energy Technology Data Exchange (ETDEWEB)

    Nieminen, M. [Faunatica Oy, Espoo (Finland); Niemi, M. [Helsinki Univ. (Finland), Dept. of Forest Sciences; Jussila, I. [Turku Univ. (Finland), Satakunta Environmental Research Inst.


    The game statistics for the island of Olkiluoto were updated in the summer 2011 and compared with earlier statistics. Population size estimates are based on interviews of the local hunters. No moose or deer inventories were made in the winter 2010-2011. The moose population is stable when compared with the previous year. The white-tailed deer population is stable or slightly increasing when compared with the previous year. The changes in the roe deer population are not accurately known, but population size varies somewhat from year to year. The number of hunted raccoon dogs approximately doubled in the latest hunting season. Altogether two waterfowl were hunted in 2010 (17 in the previous year). The populations of mountain hare and red squirrel are abundant, and the number of hunted mountain hares approximately doubled when compared with the previous hunting season. The brown hare population is still small. In the winter, there were observations of one lynx spending time in the area. (orig.)

  19. Modelling end-glacial earthquakes at Olkiluoto. Expansion of the 2010 study

    Energy Technology Data Exchange (ETDEWEB)

    Faelth, B.; Hoekmark, H. [Clay Technology AB, Lund (Sweden)


    The present report is an extension of Posiva working report 2011-13: 'Modelling end-glacial earthquakes at Olkiluoto'. The modelling methodology and most parameter values are identical to those used in that report. The main objective is the same: to obtain conservative estimates of fracture shear displacements induced by end-glacial earthquakes occurring on verified deformation zones at the Olkiluoto site. The remotely activated rock fractures (with their fracture centres positioned at different distances around the potential earthquake fault being considered) are called 'target fractures'. As in the previous report, all target fractures were assumed to be perfectly planar and circular with a radius of 75 m. Compared to the previous study, the result catalogue is more complete. One additional deformation zone (i.e. potential earthquake fault) has been included (BFZ039), whereas one deformation zone that appeared to produce only insignificant target fracture disturbances (BFZ214) is omitted. For each of the three zones considered here (BFZ021, BFZ039, and BFZ100), four models, each with a different orientation of the target fractures surrounding the fault, are analysed. Three of these four sets were included in the previous report, however not as systematically as here where each of the four fracture orientations is tried in all fracture positions. As in the previous study, seismic moments and moment magnitudes are as high as reasonably possible, given the sizes and orientations of the zones, i.e., the earthquakes release the largest possible amount of strain energy. The strain energy release is restricted only by a low residual fault shear strength applied to suppress post-rupture fault oscillations. Moment magnitudes are: 5.8 (BFZ021), 3.9 (BFZ039) and 4.3 (BFZ100). For the BFZ100 model, the sensitivity of the results to variations in fracture shear strength is checked. The BFZ021 and BFZ100 models are analyzed for two additional in situ stress

  20. 19 CFR 122.26 - Entry and clearance. (United States)


    ... AIR COMMERCE REGULATIONS Private Aircraft § 122.26 Entry and clearance. Private aircraft, as defined... information as set forth in § 122.22(c), and grants electronic clearance via electronic mail or telephone...

  1. 46 CFR 122.360 - Use of auto pilot. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Use of auto pilot. 122.360 Section 122.360 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS CARRYING MORE THAN 150... Requirements § 122.360 Use of auto pilot. Whenever an automatic pilot is used the master shall ensure that: (a...

  2. Safety case for the disposal of spent nuclear fuel at Olkiluoto. Terrain and ecosystems development modelling in the biosphere assessment BSA-2012

    International Nuclear Information System (INIS)


    This report is one of the four supporting reports for the three main biosphere reports in the safety case for the disposal of spent nuclear fuel at Olkiluoto, 'TURVA-2012'. The focus of this report is to detail the scenario analysis of terrain and ecosystems development at the Olkiluoto repository site within a time frame of 10 000 years, whereas the input data to this modelling is detailed in the Data Basis report. The results are used further especially in the surface and near-surface hydrological modelling and in the biosphere radionuclide transport and dose modelling, both part of the biosphere assessment 'BSA-2012' feeding into the safety case. Based on the results of the 18 cases simulated in the scenario analysis, it can be outlined that the most significant differences in respect of the dose implications of the repository arise from the inputs and settings affecting the rate of coastline retreat (i.e. land uplift and sea level) and determining whether there are croplands or not in the area. (orig.)

  3. Posiva safety case hydrogeochemical evolution of the Olkiluoto site

    Energy Technology Data Exchange (ETDEWEB)

    Trinchero, P.; Roman-Ross, G.; Maia, F.; Molinero, J. [Amphos 21 Consulting S.L., Barcelona (Spain)


    The goal of the present work is to assess the hydrochemical evolution and related changes in the buffering capacity of the Olkiluoto site using reactive transport models. The analysis covers a number of operational-related and climatic-related modelling periods that take place during a glacial cycle; namely, the present conditions with the open repository (Operational Period), the post-closure conditions (Temperate Period) and a stage of the glacial cycle representative of the ice sheet retreat phase (Melting Period). With the aim of reproducing the interplay between the hydrodynamic and geochemical processes, the reactive transport calculations summarised in this document integrate the results of a hydrogeological model with a number of geochemical reactions whose parameterisation relies on previous site investigation studies. The conceptual model on which the study is based, assumes that the hydrochemical evolution of the groundwater at repository depth is the result of infiltration processes from the surface of the domain to the repository. The infiltration occurs along flowpaths through deformation zones and fractures in the bedrock. The infiltrating water, in turn, undergo geochemical reactions with the rock and minerals, namely calcite and iron sulphide precipitation/dissolution, kinetic dissolution of aluminosilicates, cation exchange and aqueous redox reactions. Mass exchange between the transmissive fractures and the low permeability matrix is simulated using a dual porosity approach for the Temperate and Melting Periods. On the contrary, the Operational Period, which is characterised by high hydraulic gradients with advection being the dominant transport mechanism, is simulated using a single porosity model. In all the reactive transport simulations denoted as 'Base Case', pyrite is assumed to be the main iron sulphide mineral in the fracture filling. A set of sensitivity simulations, denoted as 'Variant Case', has been defined where

  4. Results of monitoring at Olkiluoto in 2013, rock mechanics

    Energy Technology Data Exchange (ETDEWEB)

    Johansson, E. (ed.) [Saanio and Riekkola Oy, Helsinki (Finland)


    The rock mechanics monitoring at Olkiluoto concentrates on the assessment of potential tectonic movements and stability of the bedrock. The rock mechanics monitoring programme 2013 consisted of seismic measurements, GPS measurements, surface levelling measurements and temperature measurements at Olkiluoto and vicinity and displacement measurements, temperature measurements and visual tunnel observations made in the ONKALO. The Posiva's microseismic network consists of 17 seismic stations and 21 triaxial sensors. Five stations are in the ONKALO. In spite of few breaks the network operated continuously and well during 2013. The number of located events (436) was slightly more than in 2012, but much less than in 2011. Nearly half of the observed explosions (237) in 2013 occurred inside the seismic semi-regional area and especially inside the seismic ONKALO block (137). One small induced earthquake (M{sub L} = -1.8) was detected at the depth of 429 m and was probably associated with smaller branches of the brittle fracture zone (OL-BFZ045). According to the seismic monitoring the rock mass has been stable in 2013. The local GPS network consists of 18 stations. Six new stations were set up for permanent tracking during 2013 and in total 12 permanent stations are now operating continuously. Manual measurements were carried out twice in 2013. Most of the inner network baselines showed very small motions as in the previous years: 75% of change rates were smaller than 0.10 mm/y. Roughly one third of the change rates are statistically significant. The surface levelling network currently consists of 87 fixed measuring points. During 2013 all the measuring loops were measured. The results indicated local subsidence area in the ONKALO loop and the rising area in the VLJ loop. Mean deformation rate has been +0.05 mm/y. Only elevation of one benchmark in the GPS station loop has changed more than one millimetre. The continuous displacement measurements in the technical rooms

  5. Results of monitoring at Olkiluoto in 2013, rock mechanics

    International Nuclear Information System (INIS)

    Johansson, E.


    The rock mechanics monitoring at Olkiluoto concentrates on the assessment of potential tectonic movements and stability of the bedrock. The rock mechanics monitoring programme 2013 consisted of seismic measurements, GPS measurements, surface levelling measurements and temperature measurements at Olkiluoto and vicinity and displacement measurements, temperature measurements and visual tunnel observations made in the ONKALO. The Posiva's microseismic network consists of 17 seismic stations and 21 triaxial sensors. Five stations are in the ONKALO. In spite of few breaks the network operated continuously and well during 2013. The number of located events (436) was slightly more than in 2012, but much less than in 2011. Nearly half of the observed explosions (237) in 2013 occurred inside the seismic semi-regional area and especially inside the seismic ONKALO block (137). One small induced earthquake (M L = -1.8) was detected at the depth of 429 m and was probably associated with smaller branches of the brittle fracture zone (OL-BFZ045). According to the seismic monitoring the rock mass has been stable in 2013. The local GPS network