12 CFR 533.3 - CRA communications.
2010-01-01
... officer of the bank holding company to discuss the adequacy of the performance under the CRA of the target... company at the time the NGEP met with the target institution. (See § 533.11(a) of this part.) Accordingly... affiliate. (v) Example 5. A NGEP engaged in the sale or purchase of loans in the secondary market sends a...
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Definitions. 513.2 Section 513.2 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY PRACTICE BEFORE THE OFFICE § 513.2 Definitions. As used in this part: (a) Office means the Office; (b) The term Secretary means the Secretary and...
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Reinstatement. 513.5 Section 513.5 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY PRACTICE BEFORE THE OFFICE § 513.5 Reinstatement. (a) Any person who is suspended from practicing before the Office under paragraph (a) or (c) of...
12 CFR 513.4 - Suspension and debarment.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Suspension and debarment. 513.4 Section 513.4 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY PRACTICE BEFORE THE OFFICE § 513.4 Suspension and debarment. (a) The Office may censure any person practicing before it or may deny...
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Scope of part. 513.1 Section 513.1 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY PRACTICE BEFORE THE OFFICE § 513.1 Scope of part. This part prescribes rules with regard to general practice before the Office on one's own...
12 CFR 513.3 - Who may practice.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Who may practice. 513.3 Section 513.3 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY PRACTICE BEFORE THE OFFICE § 513.3 Who may practice. (a) By non-attorneys. (1) An individual may appear on his own behalf (pro se); a member...
12 CFR 513.7 - Proceeding under this part.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Proceeding under this part. 513.7 Section 513.7 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY PRACTICE BEFORE THE OFFICE § 513.7 Proceeding under this part. (a) All hearings required or permitted to be held under paragraphs...
43 CFR 2.11 - Why is it important to send my request to the right office?
2010-10-01
... the right office? 2.11 Section 2.11 Public Lands: Interior Office of the Secretary of the Interior RECORDS AND TESTIMONY; FREEDOM OF INFORMATION ACT Requests for Records under the FOIA § 2.11 Why is it important to send my request to the right office? The bureau and office FOIA Contacts listed in appendix A...
12 CFR 513.6 - Duty to file information concerning adverse judicial or administrative action.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Duty to file information concerning adverse judicial or administrative action. 513.6 Section 513.6 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY PRACTICE BEFORE THE OFFICE § 513.6 Duty to file information concerning adverse...
48 CFR 36.513 - Accident prevention.
2010-10-01
... CATEGORIES OF CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Contract Clauses 36.513 Accident prevention. (a) The contracting officer shall insert the clause at 52.236-13, Accident Prevention, in... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Accident prevention. 36...
Evaluation and application of alumina-based Rb-82 generators charged with high levels of Sr-82/85
International Nuclear Information System (INIS)
Yano, Y.; Budinger, T.F.; Chiang, G.; O'Brien, H.A.; Grant, P.M.
1979-01-01
Generator-produced Rb-82, a 75-sec positron emitter with potential for myocardial blood-flow imaging, was studied with various ion-exchange columns to evaluate the characteristics of alumina as an adsorber for the 25-day Sr-82 parent. Test columns of alumina, Bio Rex 70, and Chelex 100 were loaded with multimillicurie amounts of no-carrier-added Sr-82/Sr-85 (Sr-85 is a production contaminant). The breakthrough of Sr-82/Sr-85, and the yield of Rb-82, were determined for long-term elutions from each column with up to 4 liter of 2% NaCl solution at pH 8 to 9. The breakthrough of Sr-82/85 was 10 -6 to 10 -5 from alumina and 10 -6 to 10 -4 from Chelex 100 and Bio Rex 70. The effects of eluent flow rate and concentration, and of alumina volume, on the breakthrough and yield were also studied. An improved and automated Rb-82 generator was used for myocardial and brain blood-flow studies in experimental animals and in man; it was equipped with solenoid flow-control valves and five in. of lead shielding for the alumina columns, which were charged with 25 to 50 mCi Sr-82 (100 to 150 mCi Sr-85). The Rb-82 generator with alumina column provided up to 20 to 40 mCi of Rb-82 as often as every 5 to 10 min with -5 breakthrough of Sr-82/85 over the 2- to 3-mo, useful life of the generator
49 CFR Appendix A to Part 533 - Example of Calculating Compliance Under § 533.5 Paragraph (g)
2010-10-01
... 49 Transportation 6 2010-10-01 2010-10-01 false Example of Calculating Compliance Under § 533.5 Paragraph (g) A Appendix A to Part 533 Transportation Other Regulations Relating to Transportation... ECONOMY STANDARDS Pt. 533, App. A Appendix A to Part 533—Example of Calculating Compliance Under § 533.5...
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Authority. 53.3 Section 53.3 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections... STANDARDS) Regulations Administration § 53.3 Authority. The Director is charged with the administration of...
2010-01-01
... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false [Reserved] 9901.513 Section 9901.513 Administrative Personnel DEPARTMENT OF DEFENSE HUMAN RESOURCES MANAGEMENT AND LABOR RELATIONS SYSTEMS (DEPARTMENT... (NSPS) Staffing and Employment External Recruitment and Internal Placement § 9901.513 [Reserved] ...
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Death. 638.513 Section 638.513 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR JOB CORPS PROGRAM UNDER TITLE IV-B OF THE JOB TRAINING PARTNERSHIP ACT Center Operations § 638.513 Death. In each case of student death, the...
23 CFR 710.513 - Environmental mitigation.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Environmental mitigation. 710.513 Section 710.513 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RIGHT-OF-WAY AND ENVIRONMENT RIGHT-OF-WAY AND REAL ESTATE Property Acquisition Alternatives § 710.513 Environmental mitigation. (a) The...
20 CFR 725.513 - Accountability; transfer.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Accountability; transfer. 725.513 Section 725.513 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR FEDERAL COAL MINE... MINE SAFETY AND HEALTH ACT, AS AMENDED Payment of Benefits General Provisions § 725.513 Accountability...
47 CFR 101.513 - Transmitter power.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Transmitter power. 101.513 Section 101.513... SERVICES 24 GHz Service and Digital Electronic Message Service § 101.513 Transmitter power. The transmitter power will be governed by § 101.113. Further, each application must contain an analysis demonstrating...
27 CFR 5.33 - Additional requirements.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Additional requirements. 5.33 Section 5.33 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS LABELING AND ADVERTISING OF DISTILLED SPIRITS Labeling Requirements for...
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Limitations. 513.31 Section 513.31 Judicial Administration BUREAU OF PRISONS, DEPARTMENT OF JUSTICE GENERAL MANAGEMENT AND ADMINISTRATION... published in 5 CFR part 297 and by Department of Justice regulations published in 28 CFR part 16. ...
28 CFR 51.3 - Delegation of authority.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Delegation of authority. 51.3 Section 51.3 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) PROCEDURES FOR THE ADMINISTRATION OF SECTION 5 OF THE VOTING RIGHTS ACT OF 1965, AS AMENDED General Provisions § 51.3 Delegation of authority...
28 CFR 513.10 - Purpose and scope.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Purpose and scope. 513.10 Section 513.10 Judicial Administration BUREAU OF PRISONS, DEPARTMENT OF JUSTICE GENERAL MANAGEMENT AND ADMINISTRATION ACCESS TO RECORDS Production or Disclosure of FBI/NCIC Information § 513.10 Purpose and scope. This...
10 CFR 51.3 - Resolution of conflict.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Resolution of conflict. 51.3 Section 51.3 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) ENVIRONMENTAL PROTECTION REGULATIONS FOR DOMESTIC LICENSING AND RELATED REGULATORY FUNCTIONS § 51.3 Resolution of conflict. In any conflict between a general rule in subpart A of...
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Definitions. 513.605 Section 513.605 Foreign... does not include workers not on the payroll of the grantee (e.g., volunteers, even if used to meet a... instead of money, or other assistance in the form of loans, loan guarantees, interest subsidies, insurance...
26 CFR 513.6 - Pensions and life annuities.
2010-04-01
... 26 Internal Revenue 19 2010-04-01 2010-04-01 false Pensions and life annuities. 513.6 Section 513... UNDER TAX CONVENTIONS IRELAND Withholding of Tax § 513.6 Pensions and life annuities. (a) Pensions... rendered thereto in the discharge of governmental functions, and any life annuity, derived from sources...
14 CFR 330.23 - To what address must air carriers send their applications?
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false To what address must air carriers send their applications? 330.23 Section 330.23 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF...) to the following address: U.S. Department of Transportation, Aviation Relief Desk (X-50), 1200 New...
40 CFR 35.533 - Programs eligible for inclusion.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Programs eligible for inclusion. 35.533... § 35.533 Programs eligible for inclusion. (a) Eligible programs. Except as provided in paragraph (b) of this section, the environmental programs eligible for inclusion in a Performance Partnership Grant are...
28 CFR 513.12 - Inmate request for record clarification.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Inmate request for record clarification. 513.12 Section 513.12 Judicial Administration BUREAU OF PRISONS, DEPARTMENT OF JUSTICE GENERAL MANAGEMENT AND ADMINISTRATION ACCESS TO RECORDS Production or Disclosure of FBI/NCIC Information § 513.12...
25 CFR 533.2 - Time for submitting management contracts and amendments.
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false Time for submitting management contracts and amendments. 533.2 Section 533.2 Indians NATIONAL INDIAN GAMING COMMISSION, DEPARTMENT OF THE INTERIOR MANAGEMENT CONTRACT PROVISIONS APPROVAL OF MANAGEMENT CONTRACTS § 533.2 Time for submitting management contracts and...
22 CFR 513.305 - Causes for debarment.
2010-04-01
... public agreements or transactions; (2) A history of failure to perform or of unsatisfactory performance... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Causes for debarment. 513.305 Section 513.305 Foreign Relations BROADCASTING BOARD OF GOVERNORS GOVERNMENT DEBARMENT AND SUSPENSION (NONPROCUREMENT) AND...
33 CFR 148.115 - How many copies of the application must I send and where must I send them?
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false How many copies of the application must I send and where must I send them? 148.115 Section 148.115 Navigation and Navigable Waters... Application for a License § 148.115 How many copies of the application must I send and where must I send them...
9 CFR 53.3 - Appraisal of animals or materials.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Appraisal of animals or materials. 53.3 Section 53.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF... animals or materials. (a) Animals affected by or exposed to disease, and materials required to be...
47 CFR 97.513 - VE session manager requirements.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false VE session manager requirements. 97.513 Section... SERVICES AMATEUR RADIO SERVICE Qualifying Examination Systems § 97.513 VE session manager requirements. (a) A VE session manager may be selected by the VE team for each examination session. The VE session...
26 CFR 513.4 - Patent and copyright royalties and film rentals.
2010-04-01
... 26 Internal Revenue 19 2010-04-01 2010-04-01 false Patent and copyright royalties and film rentals. 513.4 Section 513.4 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) REGULATIONS UNDER TAX CONVENTIONS IRELAND Withholding of Tax § 513.4 Patent and copyright royalties and film...
28 CFR 513.20 - Release of information to law enforcement agencies.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Release of information to law enforcement agencies. 513.20 Section 513.20 Judicial Administration BUREAU OF PRISONS, DEPARTMENT OF JUSTICE GENERAL MANAGEMENT AND ADMINISTRATION ACCESS TO RECORDS Release of Information to Law Enforcement Agencies § 513.20 Release of information to law...
CERN’s Prévessin site post office
2016-01-01
The post office at CERN’s Prévessin site (Building 866) is open Monday to Thursday from 9.30 a.m. to 12.30 p.m. for the following services: Sending parcels Purchasing stamps Sending money: postal money order/express international money order Telephone contacts: Internal: 77071 From Switzerland: +41 22 767 7071 From France: 04 50 40 75 54
31 CFR 585.513 - Transactions related to telecommunications authorized.
2010-07-01
... telecommunications authorized. 585.513 Section 585.513 Money and Finance: Treasury Regulations Relating to Money and... Transactions related to telecommunications authorized. (a) All transactions of U.S. common carriers with respect to the receipt and transmission of telecommunications involving the FRY (S&M) are authorized...
49 CFR 192.513 - Test requirements for plastic pipelines.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Test requirements for plastic pipelines. 192.513 Section 192.513 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND... Test requirements for plastic pipelines. (a) Each segment of a plastic pipeline must be tested in...
Office of Personnel Management (OPM) Earnings
Social Security Administration — Each year the Office of Personnel Management (OPM) sends SSA a file to be verified and matched against the Master Earnings File (MEF) and Employer Information File...
31 CFR 560.513 - Importation of Iranian-origin oil.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Importation of Iranian-origin oil. 560.513 Section 560.513 Money and Finance: Treasury Regulations Relating to Money and Finance... the Government of the Islamic Republic of Iran of January 19, 1981, or where the proceeds are...
32 CFR 644.533 - Contamination discovered after return of land to owner, or sale.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Contamination discovered after return of land to owner, or sale. 644.533 Section 644.533 National Defense Department of Defense (Continued) DEPARTMENT OF... Other Contamination from Proposed Excess Land and Improvements § 644.533 Contamination discovered after...
2010-04-01
... GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (GRANTS) Drug-Free Workplace Requirements (Grants) § 513.610... subpart. In the event of any conflict between provisions of this subpart and other provisions of this part... workplace requirements concerning grants. ...
Sending more process data without additional cables
International Nuclear Information System (INIS)
Licht, H.; Roiha, R.; Rodych, M.
1997-01-01
The as-built data transmission capability in CANDU plants is fully employed. Long delays and high cost make it often not feasible to retrofit plant equipment with additional sensors and bring the data to the office. One of the reasons is the unavoidable addition of data transmission cables. This presentation describes the results of work performed in 1996/97 to network sensors using existing plant infrastructure. To provide an alternative solution, a general purpose data transmission system is being developed. It sends data over existing plant infrastructure such as power wiring and the telephone system. Its components are based on PC technology packaged in a 'black box', using special hardware and software to appear to the user as a very simple, low cost, device. Its drawback is its rather limited transmission speed. This design is in marked contrast to the complexity of present commercial data transmission systems. A point-to-point system has been demonstrated. A networked system is under development. (author)
49 CFR 214.513 - Retrofitting of existing on-track roadway maintenance machines; general.
2010-10-01
... maintenance machines; general. 214.513 Section 214.513 Transportation Other Regulations Relating to... SAFETY On-Track Roadway Maintenance Machines and Hi-Rail Vehicles § 214.513 Retrofitting of existing on-track roadway maintenance machines; general. (a) Each existing on-track roadway maintenance machine...
Lifescience Database Archive (English)
Full Text Available AF (Link to library) AFJ513 (Link to dictyBase) - G20675 DDB0218542 Contig-U10004-1...brary) Clone ID AFJ513 (Link to dictyBase) Atlas ID - NBRP ID G20675 dictyBase ID DDB0218542 Link to Contig ...Contig-U10004-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFJ5-...LLVNLVV VNDSGDIEPDTIIPLVDG--- ---SCFECSLXAFPPQVSYAICTIANTPRVPEHCIQWALLFGLQDATLEKPFDPKQFDND NPDHMNWLFECAKKRAE...r*r*rll*ti*ncycrfrfnrskkmd*wfis*fsc ck**w*y*trynhsig*ww--- ---SCFECSLXAFPPQVSYAICT
2010-04-01
... GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (GRANTS) General § 513.105 Definitions. The following definitions apply to this part: Adequate evidence. Information sufficient to support the reasonable belief... designated by the agency head. Indictment. Indictment for a criminal offense. An information or other filing...
24 CFR 570.513 - Lump sum drawdown for financing of property rehabilitation activities.
2010-04-01
... DEVELOPMENT BLOCK GRANTS Grant Administration § 570.513 Lump sum drawdown for financing of property... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Lump sum drawdown for financing of property rehabilitation activities. 570.513 Section 570.513 Housing and Urban Development Regulations...
31 CFR 545.513 - Provision of certain legal services authorized.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Provision of certain legal services authorized. 545.513 Section 545.513 Money and Finance: Treasury Regulations Relating to Money and Finance... issued on a case-by-case basis authorizing receipt from unblocked sources of payment of professional fees...
31 CFR 575.533 - Certain new transactions.
2010-07-01
..., Authorizations, and Statements of Licensing Policy § 575.533 Certain new transactions. (a) New transactions..., including any aviation, financial, or trade requirements of agencies other than the Department of the... subsequent permanent Iraqi government: Agricultural Cooperative Bank Al-Rafidain Shipping Company Industrial...
Removal or transport of office furniture and PCs
TS Department
2008-01-01
The TS/FM Group wishes to remind users that requests for the removal or transport of office furniture must be made using the EDH ‘Transport request’ form. Please select the "Removals" category from the drop-down menu to indicate the nature of the request. Requests for the transport of PCs from your office to Bldg. 513 or back must also be made using the EDH ‘Transport request’ form. In this case select the "PC transport" category from the drop-down menu. TS/FM Group Tel. 160239
26 CFR 1.533-2 - Statement required.
2010-04-01
... Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Corporations Used to Avoid Income Tax on Shareholders § 1.533-2 Statement... shareholders, the amounts that would be payable to each of the shareholders if the income of the corporation...
File list: Pol.Emb.20.AllAg.5-13h_embryos [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Pol.Emb.20.AllAg.5-13h_embryos dm3 RNA polymerase Embryo 5-13h embryos SRX671944,SR...X671945 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Pol.Emb.20.AllAg.5-13h_embryos.bed ...
28 CFR 513.43 - Inmate access to certain Bureau Program Statements.
2010-07-01
... Statements. 513.43 Section 513.43 Judicial Administration BUREAU OF PRISONS, DEPARTMENT OF JUSTICE GENERAL... simple local access procedures described in this section to review certain Bureau Program Statements... 28 CFR), local access is available through the institution law library. (b) For a current Bureau...
File list: His.Emb.10.AllAg.5-13h_embryos [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available His.Emb.10.AllAg.5-13h_embryos dm3 Histone Embryo 5-13h embryos SRX474566,SRX474584...,SRX474583,SRX474579 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/His.Emb.10.AllAg.5-13h_embryos.bed ...
25 CFR 20.513 - Should Interstate Compacts be used for the placement of children?
2010-04-01
... children? 20.513 Section 20.513 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR HUMAN SERVICES FINANCIAL ASSISTANCE AND SOCIAL SERVICES PROGRAMS Child Assistance Foster Care § 20.513 Should Interstate Compacts be used for the placement of children? Interstate compact agreements should be used when...
File list: ALL.Emb.05.AllAg.5-13h_embryos [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available ALL.Emb.05.AllAg.5-13h_embryos dm3 All antigens Embryo 5-13h embryos SRX671948,SRX6...RX671960,SRX671949 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/ALL.Emb.05.AllAg.5-13h_embryos.bed ...
File list: Oth.Emb.10.AllAg.5-13h_embryos [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.Emb.10.AllAg.5-13h_embryos dm3 TFs and others Embryo 5-13h embryos SRX683494,SR...SRX671952,SRX671949 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Oth.Emb.10.AllAg.5-13h_embryos.bed ...
25 CFR 700.513 - Business dealings on behalf of the government.
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false Business dealings on behalf of the government. 700.513... RELOCATION PROCEDURES Employee Responsibility and Conduct § 700.513 Business dealings on behalf of the... the Commission. Employees shall observe courtesy, consideration and promptness in dealing with clients...
Oxygen relieves the CO2 and acetate dependency of Lactobacillus johnsonii NCC 533
Hertzberger, R.Y.; Pridmore, R.D.; Gysler, C.; Kleerebezem, M.; Teixeira de Mattos, M.J.
2013-01-01
Oxygen relieves the CO2 and acetate dependency of Lactobacillus johnsonii NCC 533. The probiotic Lactobacillus johnsonii NCC 533 is relatively sensitive to oxidative stress; the presence of oxygen causes a lower biomass yield due to early growth stagnation. We show however that oxygen can also be
IT Department
2006-01-01
As part of IT's preparations to meet the challenge of LHC computing, a new chilled water production unit is being constructed for the Computer Centre. The air conditioning work will start in mid-January and last until June 2006. During this period access to the car park of Building 513 will be restricted. Please consult the plan for details of the area affected by the work. With apologies for the inconvenience, IT Department
IT Department
2006-01-01
As part of IT's preparations to meet the challenge of LHC computing, a new chilled water production unit is being constructed for the Computer Centre. The air conditioning work will start in mid-January and last until June 2006. During this period, access to the car park of Building 513 will be restricted. Please consult the plan for details of the area affected by the work. With apologies for the inconvenience. IT Department
Study of Irradiation Effects on the Fracture Properties of A533-Series Ferritic Steels
International Nuclear Information System (INIS)
Lee, Yong Bok; Lee, Gyeong Geun; Kwon, Jun Hyun
2011-01-01
Since the Kori nuclear power plant unit 3 (Kori-3) was founded in 1986, the surveillance tests have been conducted five times. One of the primary objectives of the surveillance test is to determine the effects of irradiation on reactor pressure vessel (RPV) steel embrittlement. The RPV is made out of ferritic steels such as SA533 type B class 1, which were used for early nuclear power plants industry including Kori-2, 3, 4 and Yonggwang-1, 2 units in Korea. The Westinghouse supplied Kori-3 with the RPV steels ASTM A533 grade B class 1, which is equivalent to SA533 type B class 1. The irradiation effects on tensile properties in ASTM A533 grade B class 1 steel had been studied by Steichen and Williams. They experimentally determined the effect of strain rate and temperature on the tensile properties of unirradiated and irradiated A533 grade B steel 1. The effects of neutron irradiation on ferritic steels could be determined from tensile properties, as well as the fracture strength and toughness measurements. Hunter and Williams have reported that the strength and ductility for unirradiated material at a low strain rate increase with decreasing test temperature. Also, neutron irradiation increases strength and decreases ductility. Crosley and Ripling revealed that the yield strength of unirradiated material rapidly increases with the strain rate. Therefore, yield strength for unirradiated and irradiated materials should be determined by test parameters along with strain rate and temperature. In this study we compare ASTM A533 grad B class 1 steel obtained from several papers with SA533 type B class 1 steel taken from the surveillance data of Kori-3 unit, whose mechanical property of unirradiated and irradiated materials was correlated with the rate-temperature parameter
48 CFR 836.513 - Accident prevention.
2010-10-01
... CATEGORIES OF CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Contract Clauses 836.513 Accident... solicitations and contracts for construction that contain the clause at FAR 52.236-13, Accident Prevention. ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Accident prevention. 836...
26 CFR 513.7 - Release of excess tax withheld at source.
2010-04-01
... source from life annuities and pensions, other than pensions paid by the Government of the United States... 26 Internal Revenue 19 2010-04-01 2010-04-01 false Release of excess tax withheld at source. 513.7...) REGULATIONS UNDER TAX CONVENTIONS IRELAND Withholding of Tax § 513.7 Release of excess tax withheld at source...
International Nuclear Information System (INIS)
Druce, S.G.; Eyre, B.L.
1978-08-01
This is the final part of a series of three reports examining the upper shelf fracture toughness of A533B Class 1 pressure vessel steel. Part I (AERE R 8968) critically reviews the current elasto plastic fracture mechanics methodologies employed to characterise toughness following extensive yielding and Part II (AERE R 8969) examines several sources of fracture mechanics data pertinent to A533B Class 1 in the longitudinal (RW) orientation. Part III is a review of the effects of (i) position and orientation within the plate (ii) welding processes and post weld heat treatment and (iii) neutron irradiation as measured by Charpy impact testing. It is concluded that the upper shelf factor energy is dependent on orientation and position and can be reduced by welding, extended post weld heat treatments and neutron irradiation. Neutron irradiation effects are known to be strongly dependent on composition and metallurgical conditions, but an explanation for the variability following extended post weld treatments has yet to be resolved. (author)
MOVE AND UPGRADE OF COMPUTING HELPDESK IN BUILDING 513
IT User Services Group
2002-01-01
In an effort to make the IT Computing Helpdesk more efficient at answering questions directly we are making changes as of Monday May 6th for a one month trial period. Extra staff will be assigned to answer problems in a new environment where the staff will have more space and less background noise. During this test period this new office will allow ONLY telephone calls and e-mails. Opening hours remain the same 8.30 to 17.30 whereas the satellite Helpdesk in Building 52 (next to the main library) will be open for enquiries and visits. We have modified the hours to 9.00 to 13.00 to enable users to visit over lunchtime. Self-service documentation remains in 513. Persons bringing computers for repair or fetching repairs will find instructions for assistance at the old helpdesk window as well as a telephone in case of difficulty. We will naturally be monitoring statistics and assessing quality very closely. Following a two week test period we will publish our findings in cern.computing newsgroup such that users a...
48 CFR 636.513 - Accident prevention.
2010-10-01
... CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Contract Clauses 636.513 Accident prevention. (a) In... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Accident prevention. 636... contracting activities shall insert DOSAR 652.236-70, Accident Prevention, in lieu of FAR clause 52.236-13...
33 CFR 5.33 - Training, examination, and assignment.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Training, examination, and... GENERAL COAST GUARD AUXILIARY § 5.33 Training, examination, and assignment. The Commandant will prescribe the type of training, qualifications and examinations required before a member of the Auxiliary shall...
12 CFR 533.6 - Disclosure of covered agreements.
2010-01-01
... REPORTING OF CRA-RELATED AGREEMENTS § 533.6 Disclosure of covered agreements. (a) Applicability date. This... mailing the agreement. (7) Use of CRA public file by insured depository institution or affiliate. An... institution's CRA public file if the institution makes the agreement available in accordance with the...
2003-01-01
As part of IT's preparation to meet the challenges of LHC computing, a new substation is being constructed for the Computer Centre. The civil engineering work for this substation will start in mid-August and last until March 2004. During this period access to the Les Merisiers car park, between B513 (the Computer Centre) and B504 (Restaurant 2) will be restricted. Please see the diagram for details and for the location of alternative parking space. With apologies for the incovenience, IT Division
12 CFR 533.11 - Other definitions and rules of construction used in this part.
2010-01-01
... THE TREASURY DISCLOSURE AND REPORTING OF CRA-RELATED AGREEMENTS § 533.11 Other definitions and rules... party to the agreement makes a CRA communication, as described in § 533.3 of this part. (b) Control. Control is defined in section 2(a) of the Bank Holding Company Act (12 U.S.C. 1841(a)). (c) CRA affiliate...
GS Department
2009-01-01
The Mail Office wishes to remind users that the CERN mail service is exclusively reserved for official CERN mail. All external official mail must be sent to the Mail Office in an unstamped envelope on which your name and Department must be clearly indicated below the official CERN address (see example) to help us to find you in the event that it cannot be delivered. If you wish to send private mail from the CERN site you must use the post offices at Meyrin (63-R-011) or Prévessin (866-R-C02). Please use "PRIORITY" envelopes only in the case of urgent mail. Any mail containing merchandise (i.e. anything other than documents) must be sent using an EDH shipping request form. INTERNAL MAIL Please remember to include the recipient’s MAILBOX number on the internal mail envelopes, either in the relevant box (new envelopes) or next to the name (old envelopes). This information, which can be found in the CERN PHONEBOOK, simplifies our t...
Creep of A508/533 Pressure Vessel Steel
Energy Technology Data Exchange (ETDEWEB)
Richard Wright
2014-08-01
ABSTRACT Evaluation of potential Reactor Pressure Vessel (RPV) steels has been carried out as part of the pre-conceptual Very High Temperature Reactor (VHTR) design studies. These design studies have generally focused on American Society of Mechanical Engineers (ASME) Code status of the steels, temperature limits, and allowable stresses. Initially, three candidate materials were identified by this process: conventional light water reactor (LWR) RPV steels A508 and A533, 2¼Cr-1Mo in the annealed condition, and Grade 91 steel. The low strength of 2¼Cr-1Mo at elevated temperature has eliminated this steel from serious consideration as the VHTR RPV candidate material. Discussions with the very few vendors that can potentially produce large forgings for nuclear pressure vessels indicate a strong preference for conventional LWR steels. This preference is based in part on extensive experience with forging these steels for nuclear components. It is also based on the inability to cast large ingots of the Grade 91 steel due to segregation during ingot solidification, thus restricting the possible mass of forging components and increasing the amount of welding required for completion of the RPV. Grade 91 steel is also prone to weld cracking and must be post-weld heat treated to ensure adequate high-temperature strength. There are also questions about the ability to produce, and very importantly, verify the through thickness properties of thick sections of Grade 91 material. The availability of large components, ease of fabrication, and nuclear service experience with the A508 and A533 steels strongly favor their use in the RPV for the VHTR. Lowering the gas outlet temperature for the VHTR to 750°C from 950 to 1000°C, proposed in early concept studies, further strengthens the justification for this material selection. This steel is allowed in the ASME Boiler and Pressure Vessel Code for nuclear service up to 371°C (700°F); certain excursions above that temperature are
Reactor pressure vessel steels ASTM A533B and A508 Cl.2
International Nuclear Information System (INIS)
Pelli, R.; Kemppainen, M.; Toerroenen, K.
1979-11-01
This report presents the tensile test results of steels ASTM A533B and A508 Cl.2 obtained in connection with a programme initiated to gather and create information needed for the assessment of the structural integrity of the reactor pressure vessels. The tensile properties were studied between -196 and 300 degC varying austenitizing and tempering temperatures and having two different carbon contents for the heats of A533B. (author)
Metal organic framework MIL-101(Cr) for dehydration reactions
Indian Academy of Sciences (India)
under vapour phase conditions in the temperature range of 513–533 K and time on stream (TOS) at 513 K. Cr-MIL-101 ... gies and potential applications in gas storage, sep- aration ... these materials have not been explored much. Recently .... The products were collected in ice cold trap and ... There is no change in the crys-.
Specific pathologist responses for Standard for Exchange of Nonclinical Data (SEND).
Watanabe, Atsushi; Kusuoka, Osamu; Sato, Norihiro; Nakazono, Osamu; Wasko, Michael; Potenta, Daniel; Nakae, Dai; Hatakeyama, Hirofumi; Iwata, Hijiri; Naota, Misaki; Anzai, Takayuki
2017-07-01
The Standard for Exchange of Nonclinical Data (SEND), introduced by the US Food and Drug Administration (FDA), is a scheme for the computerization, electronic application, and screening of preclinical data. Since its establishment, related organizations have been working together to implement SEND. However, it is difficult for individual pharmaceutical companies that often outsource to achieve complete compliance with SEND; hence, the cooperation of contract research organizations (CROs) and SEND Registered Solution Providers (RSPs) is indispensable. In SEND, most data, including those on pathology findings, are converted into controlled terminology (CT), but it is not a simple process to convert findings or levels of severity in the field of pathology, which is a descriptive science. The authors have successfully completed an FDA trial submission for a toxicology test conducted at a CRO and in doing so acquired important knowledge. This article presents a clear picture of such important knowledge from a pathologist's viewpoint.
31 CFR 500.533 - Exportations, reexportations, and incidental transactions.
2010-07-01
... CONTROL REGULATIONS Licenses, Authorizations and Statements of Licensing Policy § 500.533 Exportations..., software, or technology (including technical data) from the United States or reexportation of U.S.-origin goods, software, or technology from a foreign country to any person in a designated foreign country or...
Effect of neutron irradiation on the impact properties of A533B steel
International Nuclear Information System (INIS)
Schubert, L.E.; Kumar, A.S.; Rosinski, S.T.; Hamilton, M.L.
1994-01-01
A new methodology is proposed to correlate the upper shelf energy (USE) of full size and subsize Charpy specimens of a nuclear reactor pressure vessel plate material, ASTM type A 533 Grade B (A533B) having a low USE (USE 19 n/cm 2 (E > 1 MeV) by 78 degree, 83 degree, and 70 degree C for full, half, and third size specimens, respectively. These shifts in DBTT appeared to be independent of specimen size and notch geometry
42 CFR 412.513 - Patient classification system.
2010-10-01
... LTC-DRG classification system provides a LTC-DRG, and an appropriate weighting factor, for those cases... intermediary decides that a different LTC-DRG should be assigned, the case will be reviewed by the appropriate... 42 Public Health 2 2010-10-01 2010-10-01 false Patient classification system. 412.513 Section 412...
The Role of Altruism in Sending and Spending Remittances
Directory of Open Access Journals (Sweden)
Akira Shimada
2011-06-01
Full Text Available We investigate the effects of altruism on migrants' decisions to send money home and on their households' decisions to invest or to consume those remittances. Previous studies have devoted extensive attention to migrants' altruism toward recipients and little to recipients'altruism toward migrants. We find that the migrant sends larger remittances home when he feels more altruistic toward other household members, while he may send nothing if he feels less altruistic. We also find that other household members in the home country likely consume rather than invest remittances if they are highly altruistic toward the migrant. Our results may partially explain why countries receiving large remittances do not always make large investments, and suggest that altruism among household members does not necessarily enhance a country's development and growth through remittances.
2010-01-01
... independent public accountants and accounting firms performing audit services. 513.8 Section 513.8 Banks and... Removal, suspension, or debarment of independent public accountants and accounting firms performing audit... of independent public accountants and their accounting firms from performing independent audit and...
A maker-community-friendly implementation of a smart and green office environment: Lessons learned
CSIR Research Space (South Africa)
Smith, Andrew C
2015-05-01
Full Text Available previously untested (again, by ourselves) concepts and technologies, our learning from the first design iteration proved to be of significant value. Both design iterations incorporate a combination of an Arduino Uno [11] and a Raspberry Pi [12... into the office. Sensing the state of the office door, the office window, and the presence of a person within the office is simple: By wiring three sensors that each sends one of two signals levels to an Arduino Uno circuit, we can independently detect whether...
Phenotype-gene: 533 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 533 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1530i low sensitivity toward under influence...nsitivity toward under influence of 1-chloro-2,4-dinitrobenzene http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u921i AT2G34660 ...Plant Cell Physiol. 49(4):557-69. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u18325934i low se
14 CFR 25.533 - Hull and main float bottom pressures.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hull and main float bottom pressures. 25... AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY AIRPLANES Structure Water Loads § 25.533 Hull and main float bottom pressures. (a) General. The hull and main float structure, including frames and bulkheads...
2010-06-16
.../ Federal Air Marshal are required to complete regarding their mental health history. DATES: Send your..., Communications Branch, Business Management Office, Office of Information Technology, TSA-11, Transportation... evaluation determining that they do not have an established medical history or clinical diagnosis of...
25 CFR 533.3 - Submission of management contract for approval.
2010-04-01
...) For new contracts and new operations, a three (3)-year business plan which sets forth the parties... operations, a three (3)-year business plan which sets forth the parties' goals, objectives, budgets... 25 Indians 2 2010-04-01 2010-04-01 false Submission of management contract for approval. 533.3...
Artificial Intelligence in Prediction of Secondary Protein Structure Using CB513 Database
Avdagic, Zikrija; Purisevic, Elvir; Omanovic, Samir; Coralic, Zlatan
2009-01-01
In this paper we describe CB513 a non-redundant dataset, suitable for development of algorithms for prediction of secondary protein structure. A program was made in Borland Delphi for transforming data from our dataset to make it suitable for learning of neural network for prediction of secondary protein structure implemented in MATLAB Neural-Network Toolbox. Learning (training and testing) of neural network is researched with different sizes of windows, different number of neurons in the hidden layer and different number of training epochs, while using dataset CB513. PMID:21347158
12 CFR 533.1 - Purpose and scope of this part.
2010-01-01
... REPORTING OF CRA-RELATED AGREEMENTS § 533.1 Purpose and scope of this part. (a) General. This part... Community Reinvestment Act. This part does not affect in any way the Community Reinvestment Act of 1977 (CRA... interpretations or administration of the CRA or Community Reinvestment rule. (d) Examples. (1) The examples in...
12 CFR 533.5 - Related agreements considered a single agreement.
2010-01-01
... DISCLOSURE AND REPORTING OF CRA-RELATED AGREEMENTS § 533.5 Related agreements considered a single agreement... entered into within the same 12-month period; and (3) Are each in fulfillment of the CRA. (b... in fulfillment of the CRA, if the contracts were negotiated in a coordinated fashion and a NGEP is a...
2010-04-01
... ability to engage in Indian gaming for failure to pay a debt? 513.7 Section 513.7 Indians NATIONAL INDIAN GAMING COMMISSION, DEPARTMENT OF THE INTERIOR GENERAL PROVISIONS DEBT COLLECTION General Provisions § 513.7 What is the Commission's policy on revoking a debtor's ability to engage in Indian gaming for...
29 CFR 4000.28 - What if I send a computer disk?
2010-07-01
... 29 Labor 9 2010-07-01 2010-07-01 false What if I send a computer disk? 4000.28 Section 4000.28... I send a computer disk? (a) In general. We determine your filing or issuance date for a computer... paragraph (b) of this section. (1) Filings. For computer-disk filings, we may treat your submission as...
28 CFR 513.11 - Procedures for requesting a FBI identification record or a NCIC/III record.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Procedures for requesting a FBI identification record or a NCIC/III record. 513.11 Section 513.11 Judicial Administration BUREAU OF PRISONS, DEPARTMENT OF JUSTICE GENERAL MANAGEMENT AND ADMINISTRATION ACCESS TO RECORDS Production or Disclosure of FBI...
5 CFR 532.513 - Flexible and compressed work schedules.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Flexible and compressed work schedules... REGULATIONS PREVAILING RATE SYSTEMS Premium Pay and Differentials § 532.513 Flexible and compressed work schedules. Federal Wage System employees who are authorized to work flexible and compressed work schedules...
14 CFR 23.533 - Hull and main float bottom pressures.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hull and main float bottom pressures. 23... Water Loads § 23.533 Hull and main float bottom pressures. (a) General. The hull and main float....00213; K2=hull station weighing factor, in accordance with figure 2 of appendix I of this part; VS1...
Ong, Eugenia Z; Budigi, Yadunanda; Tan, Hwee Cheng; Robinson, Luke N; Rowley, Kirk J; Winnett, Alexander; Hobbie, Sven; Shriver, Zachary; Babcock, Gregory J; Ooi, Eng Eong
2017-08-01
Despite useful in vivo activity, no therapeutic against dengue virus (DENV) has demonstrated efficacy in clinical trials. Herein, we explored dosing and virological endpoints to guide the design of human trials of VIS513, a pan-serotype anti-DENV IgG1 antibody, in non-human primates (NHPs). Dosing VIS513 pre- or post-peak viremia in NHPs neutralized infectious DENV although RNAemia remained detectable post-treatment; differential interaction of human IgGs with macaque Fc-gamma receptors may delay clearance of neutralized DENV. Our findings suggest useful antiviral utility of VIS513 and highlight an important consideration when evaluating virological endpoints of trials for anti-DENV biologics. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.
Financial Officer Finance Section Office of the Chief Operating Officer Facilities Engineering Services Accelerator Division Accelerator Physics Center Office of the Chief Safety Officer Environment, Safety, Health and Quality Section Office of the Chief Project Officer Office of Project Support Services Office of
6 CFR 5.33 - Use and collection of social security numbers.
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Use and collection of social security numbers. 5... OF RECORDS AND INFORMATION Privacy Act § 5.33 Use and collection of social security numbers. Each... to 1975; and (b) That individuals requested to provide their social security numbers must be informed...
Die posisie van die Helper in die sending
Directory of Open Access Journals (Sweden)
I. J. van der Walt
1972-05-01
Full Text Available Gedurende die aanvangsjare van die sending het die helper ’n onmisbare funksie vervul. Hulle het die onherbergsame binnelande geken, waardevolle kontakpunte vir die sendelinge geopen en hulle mense geestelik help voorlig en voorberei.
The use of on-site Project Officers by a nuclear regulatory body
International Nuclear Information System (INIS)
Beare, J.W.
1977-01-01
In Canada consideration of applications for licensing nuclear installations is entrusted to the Reactor Safety Advisory Committee within the Atomic Energy Control Board (AECB). The licensing procedure is conducted in three stages (site approval, construction licence, operating licence). In order to control construction and operation of nuclear installations Project Officers are assigned to each particular installation. The policy of AECB is to send these officers on site several months before the reactor reaches criticality; and during reactor operation. This system clearly provides great practical advantages. (NEA) [fr
International Nuclear Information System (INIS)
Williams, J.A.
1979-09-01
The ductile fracture toughness, J/sub Ic/, of ASTM A 533, Grade B, Class 1 and ASTM A 533, heat treated to simulate irradiation, was determined for 10- to 100-mm thick compact specimens. The toughness at maximum specimen load was also measured to determine the conservatism of J/sub Ic/. The toughness of ASTM A 533, Grade B, Class 1 steel was 349 kJ/m 2 and at the equivalent upper shelf temperature, the heat treated material exhibited 87 kJ/m 2 . The maximum load fracture toughness was found to be linearly proportional to specimen size, and only specimens which failed to meet ASTM size criteria exhibited maximum load toughness less than J/sub Ic/
32 CFR 513.2 - Administrative procedures for processing complaints.
2010-07-01
... the requirements discussed in § 513.4, interview the soldier. (A) Ensure that the soldier is properly advised of his or her rights under the Privacy Act of 1974. DA Form 4817-R (Consent/Nonconsent To Disclose... claimant (DA Form 4817-R). AR 340-17 and AR 340-21, paragraph 3-3 govern this. (I) Ask the soldier about...
47 CFR 51.513 - Proxies for forward-looking economic cost.
2010-10-01
... 47 Telecommunication 3 2010-10-01 2010-10-01 false Proxies for forward-looking economic cost. 51... SERVICES (CONTINUED) INTERCONNECTION Pricing of Elements § 51.513 Proxies for forward-looking economic cost... a cost study that complies with the forward-looking economic cost based pricing methodology...
Independent Validation of the SEND-PD and Correlation with the MDS-UPDRS Part IA
Directory of Open Access Journals (Sweden)
Mayela Rodríguez-Violante
2014-01-01
Full Text Available Introduction. Neuropsychiatric symptoms in Parkinson’s disease can be assessed by the MDS-UPDRS part IA. The Scale for Evaluation of Neuropsychiatric Disorders in Parkinson’s disease (SEND-PD has been recently developed to assess the severity of some neuropsychiatric symptoms. The objective of this study is to compare the performance of the SEND-PD with the corresponding items of the MDS-UPDRS part IA. Methods. Patients with Parkinson’s disease were evaluated using the MDS-UPDRS and the SEND-PD by independent raters. Partial SEND-PD and neuropsychiatric MDS-UPDRS part IA were constructed with equivalent items for comparison. Results. A total of 260 consecutive patients were included. Overall, 61.2% of the patients did not report any psychotic symptom and 83.5% did not report any ICD symptom. On the other hand, 78.5% of the patients did report at least one symptom related to apathy, depression, or anxiety. The partial SEND-PD score was 2.9±3.1 (range from 0 to 16. The neuropsychiatric MDS-UPDRS part IA score was 2.9±3 (range from 0 to 14. The correlation coefficient between corresponding items ranged from 0.67 to 0.98 and between both summary indexes was rs=0.93 (all, P<0.001. Conclusion. A high association between equivalent items of the SEND-PD and the MDS-UPDRS was found.
An evaluation of the Panasonic model UD513AC-1 Thermoluminescence Dosimetry system
International Nuclear Information System (INIS)
Durrer, R.E. Jr.
1991-12-01
An evaluation of the Panasonic UD513AC-1 Thermoluminescence Dosimetry system was performed to determine the system's capabilities as a general purpose thermoluminescence dosimeter measuring device. The tests that were performed included a critique of the user's manual, delimitation of the operating parameters, the quality of construction, and an evaluation of the features that were unique to this system. The UD513AC-1 was found to be an adequate measuring device for most dosimetric applications. It was not well suited for experimental work with thermoluminescence materials due to a low sensitivity displayed by the photomultiplier tube to commonly used materials. The system was well constructed and did not suffer hardware failure during this research. Major attributes of the UD513AC-1 were automatic data storage, highly reproducible heating ramps, an excellent infrared light filter and a unique feature to a single phosphor unit, a dose determination function. Negative aspects of the system included a limited data manipulation capability within the controlling program, a poorly written user's manual, inadequate sensitivity on the part of the photomultiplier tube, and insufficient capability to adjust the hot N 2 gas flow to desired levels
Energy Technology Data Exchange (ETDEWEB)
Rieger, B. [Universitaetsklinikum Carl Gustav Carus, Klinik und Poliklinik fuer Neurochirurgie, Dresden (Germany)
2015-10-15
Minimal access spinal technologies (MAST) lead to a diversification of surgical procedures, which requires careful selection of the procedure and outcome monitoring. For a rational selection of the procedure simulation, endoscopy, navigation, decompression and stabilization (SENDS) criteria can be derived from the development of the MAST procedures. Preoperative simulation has diagnostic and therapeutic values. The SENDS criteria can be verified indirectly via outcome control. Biomechanically meaningful diagnostic x-rays of the spinal segment to be surgically treated are currently carried out with the patient in inclination and reclination. Software-related preoperative simulation based on these x-ray images facilitates the selection and implementation of the MAST procedure. For preoperative simulation motion shots are needed in inclination, neutral position and reclination and the dimensions can be obtained using an x-ray ball or a computed tomography (CT) scan. The SENDS criteria are useful because established procedures based on these criteria reach a comparable outcome. Preoperative simulation appears to be a useful selection criterion. Preoperatively it is necessary to collate patient and segment information in order to provide each patient with individualized treatment. So far there is no evidence for a better outcome after preoperative simulation but a reduction of surgery time and intraoperative radiation exposure could already be demonstrated. Minimally invasive methods should be preferred if there is a comparable outcome. The establishment of new procedures has to be accompanied by the maintenance of a spine register. Minimally invasive surgical procedures should be individualized for each patient and segment. Mobility X-ray images should be prepared for use with the preoperative simulation as the information content significantly increases with respect to the MAST procedure. (orig.) [German] Die Minimal Access Spine Technology (MAST) fuehrt zur
47 CFR 15.513 - Technical requirements for medical imaging systems.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Technical requirements for medical imaging... DEVICES Ultra-Wideband Operation § 15.513 Technical requirements for medical imaging systems. (a) The UWB... MHz and 10,600 MHz. (b) Operation under the provisions of this section is limited to medical imaging...
2010-04-29
...] Draft Guidance for Industry and Food and Drug Administration Staff; User Fees for 513(g); Requests for... the Internet. To receive ``Draft Guidance for Industry and Food and Drug Administration Staff; User... and Industry Procedures for Section 513(g) Requests for Information under the Federal Food, Drug, and...
31 CFR 560.533 - Brokering sales of agricultural commodities, medicine, and medical devices.
2010-07-01
... technical data, software, or information) that are subject to license application requirements of another... IRANIAN TRANSACTIONS REGULATIONS Licenses, Authorizations and Statements of Licensing Policy § 560.533 Brokering sales of agricultural commodities, medicine, and medical devices. (a) General license for...
HEALTH DEPARTMENT REPORTS AND NOTES: TO STATE AND MUNICIPAL HEALTH OFFICERS.
1913-11-01
This new division of the Journal is specially designed to be of use to active Health Officers of the countries represented in the American Public Health Association. It will be unable to serve its true function unless the Health Officers are willing to coöperate by sending to the Journal copies of their reports, bulletins, new ordinances and personal information which will be of general interest. Furthermore it would be distinctly desirable if communications on subjects of general interest are submitted for publication in this division of the Journal. The management will further welcome any suggestions from Health Officers for the improvement of this division. All communications should be addressed to Selskar M. Gunn, Managing Editor, American Journal of Public Health, 755 Boylston St., Boston, Mass.
Wilson, Mark A.; Amour, Courtney V. St.; Collins, Jennifer L.; Ringe, Dagmar; Petsko, Gregory A.
2004-01-01
The yeast gene YDR533C encodes a protein belonging to the DJ-1/ThiJ/PfpI superfamily. This family includes the human protein DJ-1, which is mutated in autosomal recessive early-onset Parkinson's disease. The function of DJ-1 and its yeast homologue YDR533Cp is unknown. We report here the crystal structure of YDR533Cp at 1.8-Å resolution. The structure indicates that the closest relative to YDR533Cp is the Escherichia coli heat shock protein Hsp31 (YedU), which has both chaperone and protease activity. As expected, the overall fold of the core domain of YDR533Cp is also similar to that of DJ-1 and the bacterial protease PfpI. YDR533Cp contains a possible catalytic triad analogous to that of Hsp31 and an additional domain that is present in Hsp31 but is not seen in DJ-1 and other members of the family. The cysteine in this triad (Cys-138) is oxidized in this crystal structure, similar to modifications seen in the corresponding cysteine in the crystal structure of DJ-1. YDR533Cp appears to be a dimer both in solution and the crystal, but this dimer is formed by a different interface than that found in Hsp31 or other members of the superfamily. PMID:14745011
IFPE/IFA-533, Fuel Thermal Behaviour at High Burnup, Halden Reactor
International Nuclear Information System (INIS)
Gyori, Cs.; Turnbull, J.A.
1997-01-01
Description: After twelve years irradiation in the Halden Boiling Water Reactor two fuel rods (Rod 807 and Rod 808) were re-instrumented with fuel centre thermocouples and reloaded into the reactor in order to investigate the fuel thermal behaviour at high burnup. The fuel rods were pre-irradiated with four other rods in the upper cluster of IFA-409 (IFA=Instrumented Fuel Assembly) from May 1973 to June 1985. After base irradiation the four neighbouring rods were re-instrumented with pressure transducers and ramp tested in IFA-535.5 and IFA-535.6 providing useful data about fission gas release (FGR) presented in the Fuel Performance Database as well (Ref. 1). The two rods re-instrumented with fuel centre thermocouples have been irradiated as IFA-533.2 from April 1992. As the irradiation history of IFA-533.2 in the first months was very similar to the history of the ramp tests, the fuel temperature and FGR data measured in the different IFAs can complement each other, although the fuel-cladding gap sizes were slightly different and due to re-instrumentation the internal gas conditions were also dissimilar
New Office Software course format!
HR Department
Always keen to anticipate your training needs, the Technical Training service is pleased to propose two new Office Software course formats: “Focus on... ”: On a monthly basis we will propose a theme such as “Sharepoint Collaboration Workspace” or “Word 2007” or “charts”, etc. You will be invited to send us in advance your questions regarding the proposed topic and register for the course through our Training Catalogue. During the session, our trainer will answer all the questions received and participants will increase their knowledge thanks to the solutions discussed for everyone. The course will last two hours, from 9-00 to 11-00 a.m. - with open questions on the proposed topic at the end. “Office software Individual coaching”: If one or more specific topics are causing you sleepless nights, you can get the help of our trainer who will ...
New Office Software course format
HR Department
2010-01-01
Always interested to anticipate your training needs, the Technical Training service is pleased to propose two new Office Software course formats : “Focus on... ” : On a monthly basis we will propose a theme such as “Sharepoint Collaboration Workspace” or “Word 2007” or “charts” etc. You will have to send us in advance your questions regarding the proposed topic and register for the course through our Training Catalogue. During the session, our trainer will answer all the questions received and participants will increase their knowledge thanks to the solutions discussed for everyone. The course will last two hours, from 09h00 to 11h00 - with open questions on the proposed topic at the end. “Office software Individual coaching”: If one or several particular topics cause you sleepless nights, you can get the help of our trainer who will come to your workplace for a multiple of 1-hour slots . All fields ...
New Office Software course format!
HR Department
2009-01-01
Always keen to anticipate your training needs, the Technical Training service is pleased to propose two new Office Software course formats: “Focus on... ”: On a monthly basis we will propose a theme such as “Sharepoint Collaboration Workspace” or “Word 2007” or “charts”, etc. You will be invited to send us in advance your questions regarding the proposed topic and register for the course through our Training Catalogue. During the session, our trainer will answer all the questions received and participants will increase their knowledge thanks to the solutions discussed for everyone. The course will last two hours, from 9-00 to 11-00 a.m. - with open questions on the proposed topic at the end. “Office software Individual coaching”: If one or more specific topics are causing you sleepless nights, you can get the help of our trainer who will ...
77 FR 75169 - Silver Nanoparticles (AgNPs); Information and Comment Request
2012-12-19
... control measures (e.g., engineering controls, work practices, PPE) that are being used in workplaces where... (513) 533-8363. Background Nanotechnology is generally defined as the intentional manipulation of...). Nanotechnology involves a wide range of chemistries and almost unlimited types of structures that have highly...
28 CFR 513.35 - Accounting/nonaccounting of disclosures to third parties.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Accounting/nonaccounting of disclosures... and Procedures § 513.35 Accounting/nonaccounting of disclosures to third parties. Accounting/nonaccounting of disclosures to third parties shall be made in accordance with Department of Justice regulations...
Kurihara, Ryoko; Imazumi, Katsunori; Takamatsu, Hajime; Ishizu, Kenichiro; Yoshino, Taiji; Masuda, Noriyuki
2016-05-01
We investigated the effect of the selective prostaglandin E2 EP2 receptor agonist CP-533,536 on voiding efficiency in rats with midodrine-induced functional urethral obstruction. The effect of CP-533,536 (0.03-0.3 mg/kg, intravenous [i.v.]) on urethral perfusion pressure (UPP) was investigated in anesthetized rats pre-treated with midodrine (1 mg/kg, i.v.), which forms an active metabolite that acts as an α1 -adrenoceptor agonist. The effect of CP-533,536 (0.03-0.3 mg/kg, i.v.) on cystometric parameters was also investigated in anesthetized rats. In addition, the effect of CP-533,536 (0.03-0.3 mg/kg, i.v.) on residual urine volume (RV) and voiding efficiency (VE) was investigated in conscious rats treated with midodrine (1 mg/kg, i.v.). CP-533,536 dose-dependently decreased UPP elevated by midodrine in anesthetized rats. In contrast, CP-533,536 did not affect maximum voiding pressure, intercontraction interval, or intravesical threshold pressure. In conscious rats, midodrine (1 mg/kg, i.v.) markedly increased RV and reduced VE. CP-533,536 dose-dependently ameliorated increases in RV and decreases in VE induced by midodrine. These results suggest that a selective EP2 receptor agonist could ameliorate the elevation of RV and improve the reduction of VE in rats with functional urethral obstruction caused by stimulation of α1 -adrenoceptors. The mechanism of action might be not potentiation of bladder contraction but rather preferential relief of urethral constriction. © 2014 Wiley Publishing Asia Pty Ltd.
Fracture toughness of A533B. Part 2. Review of data pertinent to upper shelf temperatures
International Nuclear Information System (INIS)
Druce, S.G.; Eyre, B.L.; Belcher, W.P.A.
1978-08-01
This report is the second in a series of three examining the state of the art of elastoplastic fracture mechanics as applied to A533B pressure vessel steel in the upper shelf temperature regime. Part II presents a review of fracture toughness data for A533B Class 1 plate tested in the longitudinal (RW) orientation. Data from USA, UK and Scandinavian sources published prior to September 1976 has been included. It is concluded that previous studies using a maximum load criterion have over-estimated the initiation toughness in the upper shelf regime. Results derived from J integral tests now show the mean toughness at 275 0 C to vary between 141 ksi sq. root in and 154 ksi sq. root in depending on the exact analytical procedure used. Limited statistical analysis of the results obtained using several heats of material suggest that standard deviation of the scatter of results is approximately 11% of the mean value. Recommendations for future work to improve our understanding of the fracture properties of A533B and similar medium strength high toughness materials, and their application to large structures, are presented. (author)
49 CFR 178.513 - Standards for boxes of natural wood.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Standards for boxes of natural wood. 178.513... natural wood. (a) The following are the identification codes for boxes of natural wood: (1) 4C1 for an ordinary box; and (2) 4C2 for a box with sift-proof walls. (b) Construction requirements for boxes of...
46 CFR 67.513 - Application for evidence of deletion from documentation.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Application for evidence of deletion from documentation... AND MEASUREMENT OF VESSELS DOCUMENTATION OF VESSELS Fees § 67.513 Application for evidence of deletion from documentation. An application fee is charged for evidence of deletion from documentation in...
2012-04-06
...] Guidance for Industry and Food and Drug Administration Staff; User Fees for 513(g) Requests for Information... Administration (FDA) is announcing the availability of the guidance entitled ``Guidance for Industry and Food and... ``Guidance for Industry and Food and Drug Administration Staff; User Fees for 513(g) Requests for Information...
Send and Receive fax documents using electronic mail
2005-01-01
Any CERN Staff Member can now send and receive faxes directly through email using the new fax service. To do so, you need to register and obtain your “personal” fax number using the page http://cern.ch/fax. Once you have your fax number, you can fax someone by sending an email message to the address of the form name@number.mail2fax.cern.ch, for example: Joe.Bloggs@000441719999999.mail2fax.cern.ch In the example, “000441719999999” is the fax number to call, as seen from inside CERN, in this case, in London. “Joe.Bloggs” is the name of your correspondent and it will appear on the cover page along with your name, email address, your “personal” fax number, and the subject of the email. Documentation and additional examples of fax addresses are on http://cern.ch/fax The eventual text of your email will be transmitted in the fax, followed by the optional attachments, as extra pages. Attachments can be in Acrobat (.pdf), Text (.txt), Word (.doc) , Excel (.xls) or Powerpoint (.ppt) formats. Once ...
French Customs office - Prévessin site: New opening times
Relations with the Host States Service
2005-01-01
Please note the following new opening times for CERN's on-site French Customs office (Building 904): From Monday to Thursday: 8:15 - 12:15 / 13:30 - 17:30 Fridays: 8:15 - 12:15 / 13:30 - 16:00 The new opening times will apply as of 1 March 2005. For further information, please call 75618 or send an e-mail to Douane.Francaise@cern.ch Relations with the Host States Service http://www.cern.ch/relations/ Tel. 72848
the relation between freedom, love, spirit and flesh in galatians 5:13
African Journals Online (AJOL)
Spirit” and “flesh” are ... As far as the structure of 5:13-6:10 is concerned, 5:13 contributes to the resumption ... opens the ensuing admonitory section, including several appeals to a life by the Spirit. ..... Love cannot grow in such an environment and.
A New Twisting Somersault: 513XD
Tong, William; Dullin, Holger R.
2017-12-01
We present the mathematical framework of an athlete modelled as a system of coupled rigid bodies to simulate platform and springboard diving. Euler's equations of motion are generalised to non-rigid bodies and are then used to innovate a new dive sequence that in principle can be performed by real-world athletes. We begin by assuming that shape changes are instantaneous so that the equations of motion simplify enough to be solved analytically, and then use this insight to present a new dive (513XD) consisting of 1.5 somersaults and five twists using realistic shape changes. Finally, we demonstrate the phenomenon of converting pure somersaulting motion into pure twisting motion by using a sequence of impulsive shape changes, which may have applications in other fields such as space aeronautics.
Send and Receive fax documents using electronic mail
2005-01-01
Any CERN Staff Member can now send and receive faxes directly through email using the new fax service. To do so, you need to register and obtain your “personal” fax number using the page http://cern.ch/fax. Once you have your fax number, you can fax someone by sending an email message to the address of the form name@number.mail2fax.cern.ch, for example: Joe.Bloggs@000441719999999.mail2fax.cern.ch In the example, “000441719999999” is the fax number to call, as seen from inside CERN, in this case, in London. “Joe.Bloggs” is the name of your correspondent and it will appear on the cover page along with your name, email address, your “personal” fax number, and the subject of the email. Documentation and additional examples of fax addresses are on http://cern.ch/fax The eventual text of your email will be transmitted in the fax, followed by the optional attachments, as extra pages. Attachments can be in Acrobat (.pdf), Text (.txt), Word (.doc) , Excel (.xls) or Powerpoint (.ppt) formats. Once the ...
Social problem-solving in high-functioning schizophrenia: specific deficits in sending skills.
Vaskinn, Anja; Sundet, Kjetil; Hultman, Christina M; Friis, Svein; Andreassen, Ole A
2009-02-28
This study examined social problem-solving performance in high-functioning schizophrenia (n=26) and its relation to neurocognition. Ten healthy controls were used as a comparison group. Social problem-solving was assessed with the Assessment of Interpersonal Problem Solving Skills (AIPSS) method. The schizophrenia group was outperformed by healthy controls on all AIPSS measures, reaching statistical significance for sending skills. Exploration of the internal relationship between different aspects of social problem-solving showed that identification of an interpersonal problem (a receiving skill) was not correlated with formulating solutions to the problem (processing skills) or successfully role-playing solutions (interpersonal sending skills). Non-verbal performance in the role-play (an interpersonal sending skill) was not significantly correlated with identification of an interpersonal problem or the generation of solutions. This suggests a dissociation of social problem-solving processes. Social problem-solving was significantly associated with psychomotor speed, verbal learning, semantic fluency and cognitive flexibility. Clinical implications are that remediation of social problem-solving skills should focus on role-playing (nonverbal) interpersonal behaviors, rather than on verbally analyzing an interpersonal problem and clarifying alternative solutions.
28 CFR 513.62 - Freedom of Information Act requests by former inmates.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Freedom of Information Act requests by... GENERAL MANAGEMENT AND ADMINISTRATION ACCESS TO RECORDS Release of Information Freedom of Information Act Requests for Information § 513.62 Freedom of Information Act requests by former inmates. Former federal...
Directory of Open Access Journals (Sweden)
Karnes Jason H
2013-01-01
Full Text Available Abstract Background Recently, the high-mobility group A1 gene (HMGA1 variant IVS5-13insC has been associated with type 2 diabetes, but reported associations are inconsistent and data are lacking in Hispanic and African American populations. We sought to investigate the HMGA1-diabetes association and to characterize IVS5-13insC allele frequencies and linkage disequilibrium (LD in 3,070 Caucasian, Hispanic, and African American patients from the INternational VErapamil SR-Trandolapril STudy (INVEST. Methods INVEST was a randomized, multicenter trial comparing two antihypertensive treatment strategies in an ethnically diverse cohort of hypertensive, coronary artery disease patients. Controls, who were diabetes-free throughout the study, and type 2 diabetes cases, either prevalent or incident, were genotyped for IVS5-13insC using Taqman®, confirmed with Pyrosequencing and Sanger sequencing. For LD analysis, genotyping for eight additional HMGA1 single nucleotide polymorphisms (SNPs was performed using the Illumina® HumanCVD BeadChip. We used logistic regression to test association of the HMGA1 IVS5-13insC and diabetes, adjusted for age, gender, body mass index, and percentage European, African, and Native American ancestry. Results We observed IVS5-13insC minor allele frequencies consistent with previous literature in Caucasians and African Americans (0.03 in cases and 0.04 in controls for both race/ethnic groups, and higher frequencies in Hispanics (0.07 in cases and 0.07 in controls. The IVS5-13insC was not associated with type 2 diabetes overall (odds ratio 0.98 [0.76-1.26], p=0.88 or in any race/ethnic group. Pairwise LD (r2 of IVS5-13insC and rs9394200, a SNP previously used as a tag SNP for IVS5-13insC, was low (r2=0.47 in Caucasians, r2=0.25 in Hispanics, and r2=0.06 in African Americans. Furthermore, in silico analysis suggested a lack of functional consequences for the IVS5-13insC variant. Conclusions Our results suggest that IVS5-13ins
Xie, Yu; Jiang, Yang; Greenman, Emily
2008-06-01
During China's Cultural Revolution, a large proportion of urban youth were forced to go to the countryside as a result of the state's "send-down" policy. Past research has been ambivalent about the long-term social consequences for the Chinese youth who experienced send-down. Some scholars have suggested that the send-down experience may have yielded beneficial effects. To test this claim, we analyze data from the Survey of Family Life in Urban China, which we conducted in three large cities in 1999. Questions available in this data set allow us to ascertain the send-down experience of both the respondent and a sibling and educational attainment at the times of send-down and return. Our analyses of the new data show that the send-down experience does not seem to have benefited the affected Chinese youth. Differences in social outcomes between those who experienced send-down and those who did not are either non-existent or spurious due to other social processes.
2010-07-01
....533 Exportation of certain services and software incident to Internet-based communications. (a) To the....S. persons, wherever located, to persons in Sudan of software necessary to enable the services... indirect exportation of services or software with knowledge or reason to know that such services or...
Xi, Huixing
2017-05-01
Neighbor discovery protocol (NDP) is the underlying protocol in the IPv6 protocol, which is mainly used to solve the problem of interconnection between nodes on the same link. But with wide use of IPV6, NDP becomes the main objects of a variety of attacks due to a lack of security mechanism. The paper introduces the working principle of the NDP and methods of how the SEND protocol to enhance NDP security defense. It also analyzes and summarizes the security threats caused by the defects of the protocol itself. On the basis of the SEND protocol, the NDP data packet structure is modified to enhance the security of the SEND. An improved NDP cheating defense technology is put forward to make up the defects of the SEND protocol which can't verify the correctness of the public key and cannot bind the MAC address.
Weissmann, Deborah
2010-01-01
Although much as been written about information technologies and politics, less is known about how information is handled in congressional personal offices. What happens when a constituent sends an email to their Congressman? How does a Senator get information about the pros and cons of a proposed bill? A study was conducted to understand the…
2010-07-01
... Department of Defense (Continued) DEPARTMENT OF THE ARMY AID OF CIVIL AUTHORITIES AND PUBLIC RELATIONS... news media organizations to the unit, installation, or command public affairs officer for response. (6) The unit, installation, or command public affairs officer will— (i) Answer correspondence and queries...
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Filing documents with the Docket Management System (DMS) and sending documents to the administrative law judge and Assistant Chief Counsel for... Management System (DMS) and sending documents to the administrative law judge and Assistant Chief Counsel for...
A study of long term ageing effects in A533B Class 1 and A508 Class 3 steels
International Nuclear Information System (INIS)
Druce, S.G.
1981-08-01
The effects of long term thermal ageing treatments on notched impact fracture properties has been studied in two commercially produced PWR pressure vessel steels, A533B Class 1 and A508 Class 3. Heat treatments of up to 10,000h duration at temperatures between 300 and 600 0 C have been investigated. Additionally the effects of specimen size, specimen orientation, specimen position from within the plate and the effect of a prior post weld heat treatment on subsequent fracture behaviour following thermal ageing have been evaluated for the A533B Class 1 material. The susceptibility of both materials to temper embrittlement effects is relatively low, the maximum increase in transition temperature following thermal ageing treatments in the temperature range 300 to 500 0 C being about 40 to 45 0 C. Thermal ageing at 600 0 C for times in excess of 100h produces microstructural changes resulting in larger increases in transition temperature. For the A533B material, specimen position and orientation are found to have a large influence on impact behaviour but do not affect the susceptibility to temper embrittlement. Post weld heat treatment has little or no influence on impact fracture behaviour before further isothermal ageing treatments nor on susceptibility to temper embrittlement. (author)
Genome sequencing and analysis of the versatile cell factory Aspergillus niger CBS 513.88
Pel, Herman J.; de Winde, Johannes H.; Archer, David B.; Dyer, Paul S.; Hofmann, Gerald; Schaap, Peter J.; Turner, Geoffrey; Albang, Richard; Albermann, Kaj; Andersen, Mikael R.; Bendtsen, Jannick D.; Benen, Jacques A. E.; van den Berg, Marco; Breestraat, Stefaan; Caddick, Mark X.; Contreras, Roland; Cornell, Michael; Coutinho, Pedro M.; Danchin, Etienne G. J.; Debets, Alfons J. M.; Dekker, Peter; van Dijck, Piet W. M.; van Dijk, Alard; Dijkhuizen, Lubbert; Driessen, Arnold J. M.; d'Enfert, Christophe; Geysens, Steven; Groot, Gert S. P.; de Groot, Piet W. J.; Guillemette, Thomas; Henrissat, Bernard; Herweijer, Marga; van den Hombergh, Johannes P. T. W.; van den Hondel, Cees A. M. J. J.; van der Heijden, Rene T. J. M.; van der Kaaij, Rachel M.; Klis, Frans M.; Kools, Harrie J.; Kubicek, Christian P.; van Kuyk, Patricia A.; Lauber, Juergen; Lu, Xin; van der Maarel, Marc J. E. C.; Meulenberg, Rogier; Menke, Hildegard; Mortimer, Martin A.; Nielsen, Jens; Oliver, Stephen G.; Olsthoorn, Maurien; Pal, Karoly; van Peij, Noel N. M. E.; Ram, Arthur F. J.; Rinas, Ursula; Roubos, Johannes A.; Sagt, Cees M. J.; Schmoll, Monika; Sun, Jibin; Ussery, David; Varga, Janos; Vervecken, Wouter; de Vondervoort, Peter J. J. van; Wedler, Holger; Wosten, Han A. B.; Zeng, An-Ping; van Ooyen, Albert J. J.; Visser, Jaap; Stam, Hein; Enfert, Christophe d’; Lauber, Jürgen; Goosen, Coenie; de Vries, Ronald P.
The filamentous fungus Aspergillus niger is widely exploited by the fermentation industry for the production of enzymes and organic acids, particularly citric acid. We sequenced the 33.9-megabase genome of A. niger CBS 513.88, the ancestor of currently used enzyme production strains. A high level of
32 CFR 806b.29 - Sending personal information over electronic mail.
2010-07-01
... information over electronic mail. (a) Exercise caution before transmitting personal information over e-mail to... 32 National Defense 6 2010-07-01 2010-07-01 false Sending personal information over electronic mail. 806b.29 Section 806b.29 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR...
Sarika, H L; Papathoma, A; Garofalaki, M; Vasileiou, V; Vlassopoulou, B; Anastasiou, E; Alevizaki, M
2012-12-01
Genetic screening for ret mutation has become routine practice in the evaluation of medullary thyroid carcinoma (MTC). Approximately 25% of these tumours are familial, and they occur as components of the multiple endocrine neoplasia type 2 syndromes (MEN 2A and 2B) or familial MTC. In familial cases, the majority of mutations are found in exons 10, 11, 13, 14 or 15 of the ret gene. A rare mutation involving exon 8 (G533C) has recently been reported in familial cases of MTC in Brazil and Greece; some of these cases were originally thought to be sporadic. The aim of this study was to re-evaluate a series of sporadic cases of MTC, with negative family history, and screen them for germline mutations in exon 8. Genomic DNA was extracted from peripheral lymphocytes in 129 unrelated individuals who had previously been characterized as 'sporadic' based on the negative family history and negative screening for ret gene mutations. Samples were analysed in Applied Biosystems 7500 real-time PCR and confirmed by sequencing. The G533C exon 8 mutation was identified in 10 of 129 patients with sporadic MTC. Asymptomatic gene carriers were subsequently identified in other family members. In our study, we found that 7·75% patients with apparently sporadic MTC do carry G533C mutation involving exon 8 of ret. We feel that there is now a need to include exon 8 mutation screening in all patients diagnosed as sporadic MTC, in Greece. © 2012 Blackwell Publishing Ltd.
Energy Technology Data Exchange (ETDEWEB)
Yoon, Ji Hyun; Lee, Bong Sang [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2017-08-15
The precise prediction of radiation embrittlement of aged reactor pressure vessels (RPVs) is a prerequisite for the long-term operation of nuclear power plants beyond their original design life. The expiration of the operation licenses for Korean reactors the RPVs of which are made from SA533B-1 plates and welds is imminent. Korean regulatory rules have adopted the US Nuclear Regulatory Commission's transition temperature shift (TTS) models to the prediction of the embrittlement of Korean reactor pressure vessels. The applicability of the TTS model to predict the embrittlement of Korean RPVs made of SA533B-1 plates and welds was investigated in this study. It was concluded that the TTS model of 10 CFR 50.61a matched the trends of the radiation embrittlement in the SA533B-1 plates and welds better than did that of Regulatory Guide (RG) 1.99 Rev. 2. This is attributed to the fact that the prediction performance of 10 CFR 50.61a was enhanced by considering the difference in radiation embrittlement sensitivity among the different types of RPV materials.
Hardening and microstructural evolution of A533b steels irradiated with Fe ions and electrons
Energy Technology Data Exchange (ETDEWEB)
Watanabe, H., E-mail: watanabe@riam.kyushu-u.ac.jp [Research Institute for Applied Mechanics, Kyushu University, 6-1, Kasuga-kouenn, Kasugashi, Fukuoka, 816-8580 (Japan); Arase, S. [Interdisciplinary Graduate School of Kyushu University, 6-1, Kasuga-kouenn, Kasugashi, Fukuoka, 816-8580 (Japan); Yamamoto, T.; Wells, P. [Dept. Chemical Engineering, UCSB Engineering II, RM3357, Santa Barbara, CA, 93106-5080 (United States); Onishi, T. [Interdisciplinary Graduate School of Kyushu University, 6-1, Kasuga-kouenn, Kasugashi, Fukuoka, 816-8580 (Japan); Odette, G.R. [Dept. Chemical Engineering, UCSB Engineering II, RM3357, Santa Barbara, CA, 93106-5080 (United States)
2016-04-01
Radiation hardening and embrittlement of A533B steels is heavily dependent on the Cu content. In this study, to investigate the effect of copper on the microstructural evolution of these materials, A533B steels with different Cu levels were irradiated with 2.4 MeV Fe ions and 1.0 MeV electrons. Ion irradiation was performed from room temperature (RT) to 350 °C with doses up to 1 dpa. At RT and 290 °C, low dose (<0.1 dpa) hardening trend corresponded with ΔH ∝ (dpa){sup n}, with n initially approximately 0.5 and consistent with a barrier hardening mechanism, but saturating at ≈0.1 dpa. At higher dose levels, the radiation-induced hardening exhibited a strong Cu content dependence at 290 °C, but not at 350 °C. Electron irradiation using high-voltage electron microscopy revealed the growth of interstitial-type dislocation loops and enrichment of Ni, Mn, and Si in the vicinities of pre-existing dislocations at doses for which the radiation-induced hardness due to ion irradiation was prominent.
36 CFR 1011.4 - What notice will the Presidio Trust send to a debtor when collecting a debt?
2010-07-01
... PRESIDIO TRUST DEBT COLLECTION Procedures To Collect Presidio Trust Debts § 1011.4 What notice will the Presidio Trust send to a debtor when collecting a debt? (a) Notice requirements. The Presidio Trust will aggressively collect debts. The Presidio Trust will send at least one written notice to a debtor informing the...
Genome sequencing and analysis of the versatile cell factory Aspergillus niger CBS 513.88
DEFF Research Database (Denmark)
Pel, Herman J.; de Winde, Johannes H.; Archer, David B.
2007-01-01
The filamentous fungus Aspergillus niger is widely exploited by the fermentation industry for the production of enzymes and organic acids, particularly citric acid. We sequenced the 33.9-megabase genome of A. niger CBS 513.88, the ancestor of currently used enzyme production strains. A high level...... clusters for fumonisin and ochratoxin A synthesis....
Is Mars Sample Return Required Prior to Sending Humans to Mars?
Carr, Michael; Abell, Paul; Allwood, Abigail; Baker, John; Barnes, Jeff; Bass, Deborah; Beaty, David; Boston, Penny; Brinkerhoff, Will; Budney, Charles;
2012-01-01
Prior to potentially sending humans to the surface of Mars, it is fundamentally important to return samples from Mars. Analysis in Earth's extensive scientific laboratories would significantly reduce the risk of human Mars exploration and would also support the science and engineering decisions relating to the Mars human flight architecture. The importance of measurements of any returned Mars samples range from critical to desirable, and in all cases these samples will would enhance our understanding of the Martian environment before potentially sending humans to that alien locale. For example, Mars sample return (MSR) could yield information that would enable human exploration related to 1) enabling forward and back planetary protection, 2) characterizing properties of Martian materials relevant for in situ resource utilization (ISRU), 3) assessing any toxicity of Martian materials with respect to human health and performance, and 4) identifying information related to engineering surface hazards such as the corrosive effect of the Martian environment. In addition, MSR would be engineering 'proof of concept' for a potential round trip human mission to the planet, and a potential model for international Mars exploration.
2010-07-01
... transportation service provider (TSP) send to receive payment for a transportation billing? 102-118.195 Section... must a transportation service provider (TSP) send to receive payment for a transportation billing? For... Government Billing Documents Terms and Conditions Governing Acceptance and Use of A Government Bill of Lading...
Relaxation response of A533B steel from 25 to 600/degree/C
International Nuclear Information System (INIS)
Swindeman, R.W.; Bolling, E.
1989-01-01
Relaxation tests were performed on A533B steel over the range 25 to 600/degree/C in order to examine the general features of time- dependent deformation. It was found that the relaxation strength increased with the flow stress at low temperatures and was relatively independent of history at high temperatures. In the temperature range 400 to 600/degree/C the inelastic strain rates calculated from the relaxation rates followed stress dependencies that were consistent with expectations based on a model proposed by Hart and coworkers for matrix deformation. 21 refs., 10 figs
Crack arrest toughness measurements with A533B steel
International Nuclear Information System (INIS)
Salonen, Seppo.
1979-11-01
This work covers crack arrest toughness measurements on A533B steel done at the Technical Research Centre of Finland. These measurements are one part of a multinational effort, involving 30 laboratories. The aim of the cooperative test program is to examine two test procedures for measuring the crack arrest toughness, to give information about their reproducibility, and to identify the factors affecting the interpretation. The principles given for the testing were easy to apply in general and the results were satisfactory. Some factors in the test runs and in the specimen's behaviour are indicated which can cause error in the results or make implementation of the test more difficult. By comparing the results from our laboratory with average values from the test program a good agreement can be seen. Crack arrest toughness values derived from the compared procedures with a static analysis agree closely, but values calculated using a dynamic analysis differ considerably. (author)
Robinson, Luke N.; Ong, Li Ching; Rowley, Kirk J.; Winnett, Alexander; Tan, Hwee Cheng; Hobbie, Sven; Shriver, Zachary; Babcock, Gregory J.; Alonso, Sylvie; Ooi, Eng Eong
2018-01-01
Dengue virus (DENV) infection imposes enormous health and economic burden worldwide with no approved treatment. Several small molecules, including lovastatin, celgosivir, balapiravir and chloroquine have been tested for potential anti-dengue activity in clinical trials; none of these have demonstrated a protective effect. Recently, based on identification and characterization of cross-serotype neutralizing antibodies, there is increasing attention on the potential for dengue immunotherapy. Here, we tested the ability of VIS513, an engineered cross-neutralizing humanized antibody targeting the DENV E protein domain III, to overcome antibody-enhanced infection and high but brief viremia, which are commonly encountered in dengue patients, in various in vitro and in vivo models. We observed that VIS513 efficiently neutralizes DENV at clinically relevant viral loads or in the presence of enhancing levels of DENV immune sera. Single therapeutic administration of VIS513 in mouse models of primary infection or lethal secondary antibody-enhanced infection, reduces DENV titers and protects from lethal infection. Finally, VIS513 administration does not readily lead to resistance, either in cell culture systems or in animal models of dengue infection. The findings suggest that rapid viral reduction during acute DENV infection with a monoclonal antibody is feasible. PMID:29425203
Hospitals will send an integrated nurse home with each discharge.
Morrow, Thomas
2015-01-01
Hospitals must adapt to the rapidly changing environment of risk by changing the health behavior of their population. There is only one way to do this efficiently and at scale; send a nurse home with every patient at the time of discharge. That nurse can ensure adherence to medication and slowly, over time, transform personal behavior to evidence based levels ... basically taking their medication as prescribed, changing eating habits, increasing exercise, getting people to throw away their cigarettes, teaching them how to cope, improving their sleep and reducing their stress. But, this approach will require a nurse to basically "live" with the patient for prolonged periods of time, as bad health behaviors are quick to start but slow to change or end. The rapid developments in artificial intelligence and natural language understanding paired with cloud based computing and integrated with a variety of data sources has led to a new marketplace comprised of cognitive technologies that can emulate even the most creative, knowledgeable and effective nurse. Termed the Virtual Health Assistant, your patients can literally talk to these agents using normal conversational language. The possibility to send a nurse home with each patient to maintain adherence and prevent readmissions has arrived. The technology is available. Who will step forward to reap the rewards first?
Anwar, Munir A.; Kralj, Slavko; van der Maarel, Marc J. E. C.; Dijkhuizen, Lubbert
Fructansucrase enzymes polymerize the fructose moiety of sucrose into levan or inulin fructans, with beta(2-6) and beta(2-1) linkages, respectively. The probiotic bacterium Lactobacillus johnsonii strain NCC 533 possesses a single fructansucrase gene (open reading frame AAS08734) annotated as a
Energy Technology Data Exchange (ETDEWEB)
Andersen, Mikael R.; Salazar, Margarita; Schaap, Peter; van de Vondervoort, Peter; Culley, David E.; Thykaer, Jette; Frisvad, Jens C.; Nielsen, Kristian F.; Albang, Richard; Albermann, Kaj; Berka, Randy; Braus, Gerhard; Braus-Stromeyer, Susanna A.; Corrochano, Luis; Dai, Ziyu; van Dijck, Piet; Hofmann, Gerald; Lasure, Linda L.; Magnuson, Jon K.; Menke, Hildegard; Meijer, Martin; Meijer, Susan; Nielsen, Jakob B.; Nielsen, Michael L.; van Ooyen, Albert; Pel, Herman J.; Poulsen, Lars; Samson, Rob; Stam, Hein; Tsang, Adrian; van den Brink, Johannes M.; ATkins, Alex; Aerts, Andrea; Shapiro, Harris; Pangilinan, Jasmyn; Salamov, Asaf; Lou, Yigong; Lindquist, Erika; Lucas, Susan; Grimwood, Jane; Grigoriev, Igor V.; Kubicek, Christian P.; Martinez, Diego; van Peij, Noel; Roubos, Johannes A.; Nielsen, Jens B.; Baker, Scott E.
2011-06-01
The filamentous fungus Aspergillus niger exhibits great diversity in its phenotype. It is found globally, both as marine and terrestrial strains, produces both organic acids and hydrolytic enzymes in high amounts, and some isolates exhibit pathogenicity. Although the genome of an industrial enzyme-producing A. niger strain (CBS 513.88) has already been sequenced, the versatility and diversity of this species compels additional exploration. We therefore undertook whole genome sequencing of the acidogenic A. niger wild type strain (ATCC 1015), and produced a genome sequence of very high quality. Only 15 gaps are present in the sequence and half the telomeric regions have been elucidated. Moreover, sequence information from ATCC 1015 was utilized to improve the genome sequence of CBS 513.88. Chromosome-level comparisons uncovered several genome rearrangements, deletions, a clear case of strain-specific horizontal gene transfer, and identification of 0.8 megabase of novel sequence. Single nucleotide polymorphisms per kilobase (SNPs/kb) between the two strains were found to be exceptionally high (average: 7.8, maximum: 160 SNPs/kb). High variation within the species was confirmed with exo-metabolite profiling and phylogenetics. Detailed lists of alleles were generated, and genotypic differences were observed to accumulate in metabolic pathways essential to acid production and protein synthesis. A transcriptome analysis revealed up-regulation of the electron transport chain, specifically the alternative oxidative pathway in ATCC 1015, while CBS 513.88 showed significant up regulation of genes associated with biosynthesis of amino acids that are abundant in glucoamylase A, tRNA-synthases and protein transporters.
International Nuclear Information System (INIS)
Rieger, B.
2015-01-01
Minimal access spinal technologies (MAST) lead to a diversification of surgical procedures, which requires careful selection of the procedure and outcome monitoring. For a rational selection of the procedure simulation, endoscopy, navigation, decompression and stabilization (SENDS) criteria can be derived from the development of the MAST procedures. Preoperative simulation has diagnostic and therapeutic values. The SENDS criteria can be verified indirectly via outcome control. Biomechanically meaningful diagnostic x-rays of the spinal segment to be surgically treated are currently carried out with the patient in inclination and reclination. Software-related preoperative simulation based on these x-ray images facilitates the selection and implementation of the MAST procedure. For preoperative simulation motion shots are needed in inclination, neutral position and reclination and the dimensions can be obtained using an x-ray ball or a computed tomography (CT) scan. The SENDS criteria are useful because established procedures based on these criteria reach a comparable outcome. Preoperative simulation appears to be a useful selection criterion. Preoperatively it is necessary to collate patient and segment information in order to provide each patient with individualized treatment. So far there is no evidence for a better outcome after preoperative simulation but a reduction of surgery time and intraoperative radiation exposure could already be demonstrated. Minimally invasive methods should be preferred if there is a comparable outcome. The establishment of new procedures has to be accompanied by the maintenance of a spine register. Minimally invasive surgical procedures should be individualized for each patient and segment. Mobility X-ray images should be prepared for use with the preoperative simulation as the information content significantly increases with respect to the MAST procedure. (orig.) [de
25 CFR 513.30 - When may the Commission use salary offset to collect debts?
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false When may the Commission use salary offset to collect... GENERAL PROVISIONS DEBT COLLECTION Salary Offset § 513.30 When may the Commission use salary offset to... salary offset under the authority of: 5 U.S.C. 5514; 31 U.S.C. 3716; 5 CFR part 550, subpart K; 31 CFR...
13 CFR 134.614 - What deadlines apply to my application for an award and where do I send it?
2010-01-01
... application for an award and where do I send it? 134.614 Section 134.614 Business Credit and Assistance SMALL... and where do I send it? After you have prevailed in an administrative proceeding or in a discrete... award for fees and expenses may still be filed, but it will not be considered by the ALJ until a final...
Cloud Instrument Powered by Solar Cell Sends Data to Pachube
Directory of Open Access Journals (Sweden)
Doru Ursutiu
2010-11-01
Full Text Available Despite the economic downturn, there have been quite a few new developments in the world of remote measurements lately. Tag4M (www.tag4m.com introduced the concept of cloud instrument where sensors connected to WiFi tags send data to off-the-shelf Access Points which are part of the WiFi infrastructure that exists in enterprises, retail outlets, factories, and warehouses. Access Points route the data to the Internet where specialized web applications receive the information for processing and display. One of these specialized web applications is Pachube, (http://www.pachube.com which bills itself as a “real-time data brokerage platform”. Pachube enables people to tag and share real time sensor data from objects, devices and spaces around the world. This article presents the pachube cloud instrument where sensors connected to Tag4M WiFi tags send digitized data to www.pachube.com for public display. The article contains very detailed analysis of the solar cell power source that is used to continuously power the Tag4M tag during this application. Cloud Instruments powered by solar cells enable people around the world to share real time sensor data using web pages on the Internet. This is a very interesting and exciting technology development that we want to bring to your attention.
Andersen, Mikael R.; Salazar, Margarita P.; Schaap, Peter J.; van de Vondervoort, Peter J.I.; Culley, David; Thykaer, Jette; Frisvad, Jens C.; Nielsen, Kristian F.; Albang, Richard; Albermann, Kaj; Berka, Randy M.; Braus, Gerhard H.; Braus-Stromeyer, Susanna A.; Corrochano, Luis M.; Dai, Ziyu; van Dijck, Piet W.M.; Hofmann, Gerald; Lasure, Linda L.; Magnuson, Jon K.; Menke, Hildegard; Meijer, Martin; Meijer, Susan L.; Nielsen, Jakob B.; Nielsen, Michael L.; van Ooyen, Albert J.J.; Pel, Herman J.; Poulsen, Lars; Samson, Rob A.; Stam, Hein; Tsang, Adrian; van den Brink, Johannes M.; Atkins, Alex; Aerts, Andrea; Shapiro, Harris; Pangilinan, Jasmyn; Salamov, Asaf; Lou, Yigong; Lindquist, Erika; Lucas, Susan; Grimwood, Jane; Grigoriev, Igor V.; Kubicek, Christian P.; Martinez, Diego; van Peij, Noël N.M.E.; Roubos, Johannes A.; Nielsen, Jens; Baker, Scott E.
2011-01-01
The filamentous fungus Aspergillus niger exhibits great diversity in its phenotype. It is found globally, both as marine and terrestrial strains, produces both organic acids and hydrolytic enzymes in high amounts, and some isolates exhibit pathogenicity. Although the genome of an industrial enzyme-producing A. niger strain (CBS 513.88) has already been sequenced, the versatility and diversity of this species compel additional exploration. We therefore undertook whole-genome sequencing of the acidogenic A. niger wild-type strain (ATCC 1015) and produced a genome sequence of very high quality. Only 15 gaps are present in the sequence, and half the telomeric regions have been elucidated. Moreover, sequence information from ATCC 1015 was used to improve the genome sequence of CBS 513.88. Chromosome-level comparisons uncovered several genome rearrangements, deletions, a clear case of strain-specific horizontal gene transfer, and identification of 0.8 Mb of novel sequence. Single nucleotide polymorphisms per kilobase (SNPs/kb) between the two strains were found to be exceptionally high (average: 7.8, maximum: 160 SNPs/kb). High variation within the species was confirmed with exo-metabolite profiling and phylogenetics. Detailed lists of alleles were generated, and genotypic differences were observed to accumulate in metabolic pathways essential to acid production and protein synthesis. A transcriptome analysis supported up-regulation of genes associated with biosynthesis of amino acids that are abundant in glucoamylase A, tRNA-synthases, and protein transporters in the protein producing CBS 513.88 strain. Our results and data sets from this integrative systems biology analysis resulted in a snapshot of fungal evolution and will support further optimization of cell factories based on filamentous fungi. PMID:21543515
2010-04-01
..., Ineligibility and Voluntary Exclusion-Lower Tier Covered Transactions B Appendix B to Part 513 Foreign Relations... Debarment, Suspension, Ineligibility and Voluntary Exclusion—Lower Tier Covered Transactions Instructions... is providing the certification set out below. 2. The certification in this clause is a material...
Muti, Paola; Donzelli, Sara; Sacconi, Andrea; Hossain, Ahmed; Ganci, Federica; Frixa, Tania; Sieri, Sabina; Krogh, Vittorio; Berrino, Franco; Biagioni, Francesca; Strano, Sabrina; Beyene, Joseph; Yarden, Yosef; Blandino, Giovanni
2018-02-09
MicroRNAs (miRNAs) might be considered both predictors and players of cancer development. The aim of the present report was to investigate whether many years before the diagnosis of breast cancer miRNA expression is already disregulated. In order to test this hypothesis, we compared miRNAs extracted from leukocytes in healthy women who later developed breast cancer and in women who remain healthy during the whole 15-year follow-up time. Accordantly, we used a case-control study design nested in the hOrmone and Diet in the ETiology of breast cancer (ORDET) prospective cohort study addressing the possibility that miRNAs can serve as both early biomarkers and components of the hormonal etiological pathways leading to breast cancer development in premenopausal women. We compared leukocyte miRNA profiles of 191 incident premenopausal breast cancer cases and profiles of 191 women who remained healthy over a follow-up period of 20 years. The analysis identified 20 differentially expressed miRNAs in women candidate to develop breast cancer versus control women. The upregulated miRNAs, miR-513-a-5p, miR-513b-5p and miR-513c-5p were among the most significantly deregulated miRNAs. In multivariate analysis, miR-513a-5p upregulation was directly and statistically significant associated with breast cancer risk (OR = 1.69; 95% CI 1.08-2.64; P = 0.0293). In addition, the upregulation of miR-513-a-5p displayed the strongest direct association with serum progesterone and testosterone levels. The experimental data corroborated the inhibitory function of miR-513a-5p on progesterone receptor expression confirming that progesterone receptor is a target of miR-513a-5p. The identification of upregulated miR-513a-5p with its oncogenic potential further validates the use of miRNAs as long-term biomarker of breast cancer risk. © The Author(s) 2017. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Energy Technology Data Exchange (ETDEWEB)
Grigoriev, Igor V.; Baker, Scott E.; Andersen, Mikael R.; Salazar, Margarita P.; Schaap, Peter J.; Vondervoot, Peter J.I. van de; Culley, David; Thykaer, Jette; Frisvad, Jens C.; Nielsen, Kristen F.; Albang, Richard; Albermann, Kaj; Berka, Randy M.; Braus, Gerhard H.; Braus-Stromeyer, Susanna A.; Corrochano, Luis M.; Dai, Ziyu; Dijck, Piet W.M. van; Hofmann, Gerald; Lasure, Linda L.; Magnusson, Jon K.; Meijer, Susan L.; Nielsen, Jakob B.; Nielsen, Michael L.; Ooyen, Albert J.J. van; Panther, Kathyrn S.; Pel, Herman J.; Poulsen, Lars; Samson, Rob A.; Stam, Hen; Tsang, Adrian; Brink, Johannes M. van den; Atkins, Alex; Aerts, Andrea; Shapiro, Harris; Pangilinan, Jasmyn; Salamov, Asaf; Lou, Yigong; Lindquist, Erika; Lucas, Susan; Grimwood, Jane; Kubicek, Christian P.; Martinez, Diego; Peij, Noel N.M.E. van; Roubos, Johannes A.; Nielsen, Jens
2011-04-28
The filamentous fungus Aspergillus niger exhibits great diversity in its phenotype. It is found globally, both as marine and terrestrial strains, produces both organic acids and hydrolytic enzymes in high amounts, and some isolates exhibit pathogenicity. Although the genome of an industrial enzyme-producing A. niger strain (CBS 513.88) has already been sequenced, the versatility and diversity of this species compels additional exploration. We therefore undertook whole genome sequencing of the acidogenic A. niger wild type strain (ATCC 1015), and produced a genome sequence of very high quality. Only 15 gaps are present in the sequence and half the telomeric regions have been elucidated. Moreover, sequence information from ATCC 1015 was utilized to improve the genome sequence of CBS 513.88. Chromosome-level comparisons uncovered several genome rearrangements, deletions, a clear case of strain-specific horizontal gene transfer, and identification of 0.8 megabase of novel sequence. Single nucleotide polymorphisms per kilobase (SNPs/kb) between the two strains were found to be exceptionally high (average: 7.8, maximum: 160 SNPs/kb). High variation within the species was confirmed with exo-metabolite profiling and phylogenetics. Detailed lists of alleles were generated, and genotypic differences were observed to accumulate in metabolic pathways essential to acid production and protein synthesis. A transcriptome analysis revealed up-regulation of the electron transport chain, specifically the alternative oxidative pathway in ATCC 1015, while CBS 513.88 showed significant up-regulation of genes relevant to glucoamylase A production, such as tRNA-synthases and protein transporters. Our results and datasets from this integrative systems biology analysis resulted in a snapshot of fungal evolution and will support further optimization of cell factories based on filamentous fungi.[Supplemental materials (10 figures, three text documents and 16 tables) have been made available
SBS 0846+513: a New Gamma-ray Emitting Narrow-line Seyfert 1 Galaxy
D'Ammando, F.; Orienti, M.; Finke, J.; Raiteri, C. M.; Angelakis, E.; Fuhrmann, L.; Giroletti, M.; Hovatta, T.; Max-Moerbeck, W.; Perkins, J. S.;
2012-01-01
We report Fermi-LAT observations of the radio-loud AGN SBS 0846+513 (z=0.5835), optically classified as a Narrow-Line Seyfert 1 galaxy, together with new and archival radio-to-X-ray data. The source was not active at ?-ray energies during the first two years of Fermi operation. A significant increase in activity was observed during 2010 October-2011 August. In particular a strong gamma-ray flare was observed in 2011 June reaching an isotropic ?-ray luminosity (0.1-300 GeV) of 1.0×10(sup 48) erg s(sup -1), comparable to that of the brightest flat spectrum radio quasars, and showing spectral evolution in gamma rays. An apparent superluminal velocity of (8.2+/-1.5)c in the jet was inferred from 2011-2012 VLBA images, suggesting the presence of a highly relativistic jet. Both the power released by this object during the flaring activity and the apparent superluminal velocity are strong indications of the presence of a relativistic jet as powerful as those of blazars. In addition, variability and spectral properties in radio and gamma-ray bands indicate blazar-like behaviour, suggesting that, except for some distinct optical characteristics, SBS 0846+513 could be considered as a young blazar at the low end of the blazar's black hole mass distribution.
Distribute Off-Time Office Internet bandwidth Using Topology Mesh For Sorrounding Neighbour
Zendrato, Niskarto; Sihombing, Oloan; Laia, Yonata; Sabarita Barus, Ertina
2018-04-01
The Internet as one of the very rapidly growing information technology can provide data and information with wide world, complete, and up to date. Users can download and upload data such as the application file, multimedia and text through the Internet network. But for the Internet availability is still less equal access because of the lack of availability of adequate infrastructure, therefore the author make the utilization of bandwidth that can be establish Internet balancing although still on a small scale. By this research the authors use bandwidth from PT. Deltauli Home Teknikarya that where bandwidth necessity on when time off-time unused office, where the office always pay full for Internet connection even though at the time of the off-time. It’s many of the available bandwidth, so that the author is trying to take advantage of the bandwidth at the time of the off-time the office to be used by the community using radio connection link and use the radius server as user management and server to send sms and user and password to the users who want to enjoy free internet connection.
'It sends a message': Liberian opinion leaders' responses to the trial of Charles Taylor
Glasius, M.
2015-01-01
This article investigates the potential impact of an international criminal trial on a post-conflict society. It assesses the claims of legal expressivism, which conceptualizes criminal justice as a message sending mechanism that can enunciate societal condemnation of atrocities, establish an
28 CFR 513.63 - Freedom of Information Act requests on behalf of an inmate or former inmate.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Freedom of Information Act requests on..., DEPARTMENT OF JUSTICE GENERAL MANAGEMENT AND ADMINISTRATION ACCESS TO RECORDS Release of Information Freedom of Information Act Requests for Information § 513.63 Freedom of Information Act requests on behalf of...
Manogaran, Motharasan; Ahmad, Siti Aqlima; Yasid, Nur Adeela; Yakasai, Hafeez Muhammad; Shukor, Mohd Yunus
2018-02-01
In this novel study, we report on the use of two molybdenum-reducing bacteria with the ability to utilise the herbicide glyphosate as the phosphorus source. The bacteria reduced sodium molybdate to molybdenum blue (Mo-blue), a colloidal and insoluble product, which is less toxic. The characterisation of the molybdenum-reducing bacteria was carried out using resting cells immersed in low-phosphate molybdenum media. Two glyphosate-degrading bacteria, namely Burkholderia vietnamiensis AQ5-12 and Burkholderia sp. AQ5-13, were able to use glyphosate as a phosphorous source to support molybdenum reduction to Mo-blue. The bacteria optimally reduced molybdenum between the pHs of 6.25 and 8. The optimum concentrations of molybdate for strain Burkholderia vietnamiensis strain AQ5-12 was observed to be between 40 and 60 mM, while for Burkholderia sp. AQ5-13, the optimum molybdate concentration occurred between 40 and 50 mM. Furthermore, 5 mM of phosphate was seen as the optimum concentration supporting molybdenum reduction for both bacteria. The optimum temperature aiding Mo-blue formation ranged from 30 to 40 °C for Burkholderia vietnamiensis strain AQ5-12, whereas for Burkholderia sp. AQ5-13, the range was from 35 to 40 °C. Glucose was the best electron donor for supporting molybdate reduction, followed by sucrose, fructose and galactose for both strains. Ammonium sulphate was the best nitrogen source in supporting molybdenum reduction. Interestingly, increasing the glyphosate concentrations beyond 100 and 300 ppm for Burkholderia vietnamiensis strain AQ5-12 and Burkholderia sp. AQ5-13, respectively, significantly inhibited molybdenum reduction. The ability of these bacteria to reduce molybdenum while degrading glyphosate is a useful process for the bioremediation of both toxicants.
2010-01-01
... default assumptions. The same assumptions shall be made in computing Design Energy Consumption as were... area Ft 2 person Assembly 50 Office 275 Retail 300 Warehouse 15000 School 75 Hotel/Motel 250 Restaurant...
42 CFR 137.171 - Where do Self-Governance Tribes send their audit reports?
2010-10-01
... Provisions Audits and Cost Principles § 137.171 Where do Self-Governance Tribes send their audit reports? (a) For fiscal years ending on or before June 30, 1996, the audit report must be sent to: National... years, beginning after June 30, 1996, the audit report must be sent to: Single Audit Clearinghouse, 1201...
Powernext futuresTM front office user's guide
International Nuclear Information System (INIS)
2004-07-01
The introduction of a power exchange in France is a direct response to the opening up of the European electricity markets. Powernext SA is a Multilateral Trading Facility in charge of managing the French power exchange through an optional and anonymous organised exchange offering: - Day-ahead contracts for the management of volume risk on Powernext Day-Ahead TM since 21 November 2001, - Medium term contracts for the management of price risk on Powernext Futures TM since 18 June 2004. This document is the front office user's guide, it presents: the market model (characteristics, regulation, contractual framework), the members (traders, clearers, quotation providers, fees structure), the products (specifications, use, liquidity and market efficiency), the trading system (architecture, hardware and software requirements, installation process and connecting to server), the trading (session, screen, sending an order, order execution). Contracts codifications and a glossary are given in the appendix. (J.S.)
40 CFR 1045.345 - What production-line testing records must I send to EPA?
2010-07-01
... must I send to EPA? 1045.345 Section 1045.345 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... nonroutine adjustment, modification, repair, preparation, maintenance, or test for the test engine if you did... sample-size calculation required in § 1045.310 for each engine family. (9) Report on each failed engine...
40 CFR 1048.345 - What production-line testing records must I send to EPA?
2010-07-01
... must I send to EPA? 1048.345 Section 1048.345 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... nonroutine adjustment, modification, repair, preparation, maintenance, or test for the test engine if you did... the sample-size calculation required in § 1048.310 for each engine family. (9) Report on each failed...
Sending Children to School "Back Home": Multiple Moralities of Punjabi Sikh Parents in Britain
Qureshi, Kaveri
2014-01-01
This article explores how Punjabi Sikh parents in Britain try to produce "good children" through moral reasoning about their schooling. Parents compare schooling in Britain with India and sometimes wonder about sending their children to school "back home", in the hope of immersing them in Indian culture, traditions and…
Garcia, Justin R; Gesselman, Amanda N; Siliman, Shadia A; Perry, Brea L; Coe, Kathryn; Fisher, Helen E
2016-07-29
Background: The transmission of sexual images and messages via mobile phone or other electronic media (sexting) has been associated with a variety of mostly negative social and behavioural consequences. Research on sexting has focussed on youth, with limited data across demographics and with little known about the sharing of private sexual images and messages with third parties. Methods: The present study examines sexting attitudes and behaviours, including sending, receiving, and sharing of sexual messages and images, across gender, age, and sexual orientation. A total of 5805 single adults were included in the study (2830 women; 2975 men), ranging in age from 21 to 75+ years. Results: Overall, 21% of participants reported sending and 28% reported receiving sexually explicit text messages; both sending and receiving 'sexts' was most common among younger respondents. Although 73.2% of participants reported discomfort with unauthorised sharing of sexts beyond the intended recipient, of those who had received sext images, 22.9% reported sharing them with others (on average with 3.17 friends). Participants also reported concern about the potential consequences of sexting on their social lives, careers, and psychosocial wellbeing. Conclusion: Views on the impact of sexting on reputation suggest a contemporary struggle to reconcile digital eroticism with real-world consequences. These findings suggest a need for future research into negotiations of sexting motivations, risks, and rewards.
Skrzypiec, Grace; Askell-Williams, Helen; Slee, Phillip; Rudzinski, Adrian
2016-01-01
Students' wellbeing is an essential component of their ability to function well, not only at school but also in all life domains. Many studies have investigated student wellbeing. However, empirical studies about the wellbeing of students with special educational needs and disabilities (SEND) are scarce. Furthermore, many studies have adopted a…
2010-04-01
... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Definition of unrelated trade or business... (CONTINUED) Taxation of Business Income of Certain Exempt Organizations § 1.513-2 Definition of unrelated trade or business applicable to taxable years beginning before December 13, 1967. (a) In general. (1) As...
Quantum key distribution without sending a quantum signal
International Nuclear Information System (INIS)
Ralph, T C; Walk, N
2015-01-01
Quantum Key Distribution is a quantum communication technique in which random numbers are encoded on quantum systems, usually photons, and sent from one party, Alice, to another, Bob. Using the data sent via the quantum signals, supplemented by classical communication, it is possible for Alice and Bob to share an unconditionally secure secret key. This is not possible if only classical signals are sent. While this last statement is a long standing result from quantum information theory it turns out only to be true in a non-relativistic setting. If relativistic quantum field theory is considered we show it is possible to distribute an unconditionally secure secret key without sending a quantum signal, instead harnessing the intrinsic entanglement between different regions of space–time. The protocol is practical in free space given horizon technology and might be testable in principle in the near term using microwave technology. (paper)
Strain ageing of nuclear pressure vessel steels A533B and A508 cl.2
International Nuclear Information System (INIS)
Pelli, R.; Toerroenen, K.
1978-04-01
The susceptibility of the reactor pressure vessel steels A533B and A508 cl.2 to strain ageing has been studied using conventional tensile and impact testing of prestrained and aged specimens. The results show a modest susceptibility, seen as an increase in yield strength and Charpy V transition temperatures. The effect of varying alloying additions within the range of normal production was not observed, but the initial mechanical properties clearly affect the strain ageing. The lower the initial yield strength, the higher increase in strength and the lower increase in transition temperature is observed. (author)
International Nuclear Information System (INIS)
Otterberg, R.
1979-10-01
In order to predict the stress reduction during stress relief heat treatment in welded joints of the pressure vessel steel A533B, uniaxial stress relaxation as well as creep tests have been performed. The specimens were isothermally stress relaxed between 600 and 640 degree C from initial stresses corresponding to specimen elongations of 0.25, 0.5 and 0.2 percent. The stress relaxation results are excellently described by a Norton relationship. The magnitude of the initial stress has been found to affect the stress relaxation in the beginning of the tests, but at times longer than one hour the effect is very small. Creep strain data from creep tests in the actual temperature interval was converted to describe stress relaxation behaviour as well. The results will be used in a forthcoming study to predict the multiaxial stress reduction in thick weldments of A533B. (author)
Thermal Aging Effect on Corrosion Resistance in Fusion Boundary of A533 Gr. B and Alloy 152
Energy Technology Data Exchange (ETDEWEB)
Choi, Kyoung Joon; Yoo, Seung Chang; Kim, Taeho; Ham, Junhyuk; Kim, Ji Hyun [UNIST, Ulsan (Korea, Republic of)
2016-10-15
Dissimilar metal weldment (DMW) is frequently used for joining low-alloy steel pressure vessel nozzles and steam generator nozzles to nickel-based wrought alloy or austenitic stainless steel components in high energy systems. This feature also significantly hinders C diffusion from the ferrite base metal to the weld metal. Until now, stress corrosion cracking has not occurred in DMWs where a High-Cr weld metal (such as Alloy 152 or Alloy 690), which is Ni-base weld metal including relative high Cr, is used as the weld metal in the weld between the nickel-based alloy and low-alloy steel. To understand the microstructure and corrosion evolution on fusion boundary between low-alloy steel and Ni-base weld metal, microstructural analysis and polarization test were performed with A533 Gr. B/Alloy 152/Alloy 690. Remarkable changes were observed in corrosion resistance and hardness at fusion boundary between low-alloy steel and Ni-base weld metal. The precipitate, which has different potential with peripheral region, can cause galvanic corrosion or pitting corrosion and is the one of hardening methods by disturbing movement of the dislocation. At initial step of heat treatment, the number of precipitates was increased. In fusion boundary between A533 Gr. B and Alloy 152, the corrosion resistance was decreased, and the hardness was increased. Next, at further step, the number of precipitates.
Directory of Open Access Journals (Sweden)
Hamed Jelodar
2014-03-01
Full Text Available Routing Protocols are underlying principles in networks like internet, transport and mobile. Routing Protocols include a series of rules and algorithms that consider routing metric and select the best way for sending healthy data packets from origin to destination. Dynamic routing protocol compatible to topology has a changeable state. RIP and OSPF are dynamic routing protocol that we consider criteria like convergence and sending protocols traffic assessment RIP first version and OSPF second version. By the test we have done on OPNET stimulation we understood that the OSPF protocol was more efficient than RIP protocol.
Sending Safety Video over WiMAX in Vehicle Communications
Directory of Open Access Journals (Sweden)
Jun Steed Huang
2013-10-01
Full Text Available This paper reports on the design of an OPNET simulation platform to test the performance of sending real-time safety video over VANET (Vehicular Adhoc NETwork using the WiMAX technology. To provide a more realistic environment for streaming real-time video, a video model was created based on the study of video traffic traces captured from a realistic vehicular camera, and different design considerations were taken into account. A practical controller over real-time streaming protocol is implemented to control data traffic congestion for future road safety development. Our driving video model was then integrated with the WiMAX OPNET model along with a mobility model based on real road maps. Using this simulation platform, different mobility cases have been studied and the performance evaluated in terms of end-to-end delay, jitter and visual experience.
Lu, Yao; Hu, Peifeng; Treiman, Donald J
2012-08-01
China has experienced large-scale internal migration and growing mental health disorders. Limited research has examined the relationship between the two processes. We examined the association between labor out-migration and depressive symptoms of family members left behind in migrant-sending areas. We conducted a multistage probability sample survey of Chinese adults in 2008 ("Internal Migration and Health in China"), including 787 people in rural migrant-sending areas. To study whether adults in out-migrant households were more likely to experience depressive symptoms (CES-D) than were adults in non-migrant households, we used multivariate regressions and adjusted for a wide range of confounding factors and for the complex sampling design. Adults in households with labor out-migrants were more likely to report depressive symptoms than those in households without out-migrants, presumably a result of the absence of family members. However, monetary remittances from labor migrants buffered the mental health costs of out-migration. Labor out-migration has important consequences for the mental health in migrant-sending communities. There is an urgent need to address the psychological costs of migration and to promote regular remittances.
The prophages of Lactobacillus johnsonii NCC 533: comparative genomics and transcription analysis
International Nuclear Information System (INIS)
Ventura, Marco; Canchaya, Carlos; Pridmore, R. David; Bruessow, Harald
2004-01-01
Two non-inducible, but apparently complete prophages were identified in the genome of the sequenced Lactobacillus johnsonii strain NCC 533. The 38- and 40-kb-long prophages Lj928 and Lj965 represent distinct lineages of Sfi11-like pac-site Siphoviridae unrelated at the DNA sequence level. The deduced structural proteins from Lj928 demonstrated aa sequence identity with Lactococcus lactis phage TP901-1, while Lj965 shared sequence links with Streptococcus thermophilus phage O1205. With the exception of tRNA genes, inserted between DNA replication and DNA packaging genes, the transcription of the prophage was restricted to the genome segments near both attachment sites. Transcribed genes unrelated to phage functions were inserted between the phage repressor and integrase genes; one group of genes shared sequence relatedness with a mobile DNA element in Staphylococcus aureus. A short, but highly transcribed region was located between the phage lysin and right attachment site; it lacked a protein-encoding function in one prophage
Mobile phone use patterns and preferences in safety net office-based buprenorphine patients.
Tofighi, Babak; Grossman, Ellie; Buirkle, Emily; McNeely, Jennifer; Gourevitch, Marc; Lee, Joshua D
2015-01-01
Integrating mobile phone technologies in addiction treatment is of increasing importance and may optimize patient engagement with their care and enhance the delivery of existing treatment strategies. Few studies have evaluated mobile phone and text message (TM) use patterns in persons enrolled in addiction treatment, and none have assessed the use in safety net, office-based buprenorphine practices. A 28-item, quantitative and qualitative semistructured survey was administered to opiate-dependent adults in an urban, publicly funded, office-based buprenorphine program. Survey domains included demographic characteristics, mobile phone and TM use patterns, and preferences pertaining to their recovery. Surveyors approached 73 of the 155 eligible subjects (47%); 71 respondents completed the survey. Nearly all participants reported mobile phone ownership (93%) and TM use (93%), and most reported "very much" or "somewhat" comfort sending TM (79%). Text message contact with 12-step group sponsors, friends, family members, and counselors was also described (32%). Nearly all preferred having their providers' mobile phone number (94%), and alerting the clinic via TM in the event of a potential relapse to receive both supportive TM and a phone call from their buprenorphine provider was also well received (62%). Mobile phone and TM use patterns and preferences among this sample of office-based buprenorphine participants highlight the potential of adopting patient-centered mobile phone-based interventions in this treatment setting.
Irmak, A; Bumin, G; Irmak, R
2012-01-01
In direct proportion to current technological developments, both the computer usage in the workplaces is increased and requirement of leaving the desk for an office worker in order to photocopy a document, send or receive an e-mail is decreased. Therefore, office workers stay in the same postures accompanied by long periods of keyboard usage. In recent years, with intent to reduce the incidence of work related musculoskeletal disorders several exercise reminder software programs have been developed. The purpose of this study is to evaluate the effectiveness of the exercise reminder software program on office workers' perceived pain level, work performance and quality of life. 39 healthy office workers accepted to attend the study. Participants were randomly split in to two groups, control group (n = 19) and intervention group (n = 20). Visual Analogue Scale to evaluate the perceived pain was administered all of the participants in the beginning and at the end of the study. The intervention group used the program for 10 weeks. Findings showed that the control group VAS scores remained the same, but the intervention group VAS scores decreased in a statistically significant way (p software programs may help to reduce perceived pain among office workers. Further long term studies with more subjects are needed to describe the effects of these programs and the mechanism under these effects.
Early Intervention with Cdk9 Inhibitors to Prevent Post-Traumatic Osteoarthritis
2015-10-01
China, and University of Califor- nia Davis, Sacramento, California; 3Ratna Kumari, PhD: University of California Davis, Sacramento, California, and...2012;20(6):562e71. 19. Malfait AM, Ritchie J, Gil AS, Austin JS, Hartke J, Qin W, et al. ADAMTS-5 deficient mice do not develop mechanical allody- nia ...498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534
12 CFR 533.4 - Fulfillment of the CRA
2010-01-01
... Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY DISCLOSURE AND REPORTING OF..., home-improvement, small business, small farm, community development, and consumer lending, as described... the case of an insured depository institution that is evaluated on the basis of a strategic plan, any...
International Nuclear Information System (INIS)
Logsdon, W.A.; Begley, J.A.; Gottshall, C.L.
1978-03-01
The ASME Boiler and Pressure Vessel Code, Section III, Article G-2000, requires that dynamic fracture toughness data be developed for materials with specified minimum yield strengths greater than 50 ksi to provide verification and utilization of the ASME specified minimum reference toughness K/sub IR/ curve. In order to qualify ASME SA508 Class 2a and ASME SA533 Grade A Class 2 pressure vessel steels (minimum yield strengths equal 65 kip/in. 2 and 70 kip/in. 2 , respectively) per this requirement, dynamic fracture toughness tests were performed on these materials. All dynamic fracture toughness values of SA508 Class 2a base and HAZ material, SA533 Grade A Class 2 base and HAZ material, and applicable weld metals exceeded the ASME specified minimum reference toughness K/sub IR/ curve
Analysis of the irradiation data for A302B and A533B correlation monitor materials
International Nuclear Information System (INIS)
Wang, J.A.
1996-04-01
The results of Charpy V-notch impact tests for A302B and A533B-1 Correlation Monitor Materials (CMM) listed in the surveillance power reactor data base (PR-EDB) and material test reactor data base (TR-EDB) are analyzed. The shift of the transition temperature at 30 ft-lb (T 30 ) is considered as the primary measure of radiation embrittlement in this report. The hyperbolic tangent fitting model and uncertainty of the fitting parameters for Charpy impact tests are presented in this report. For the surveillance CMM data, the transition temperature shifts at 30 ft-lb (ΔT 30 ) generally follow the predictions provided by Revision 2 of Regulatory Guide 1.99 (R.G. 1.99). Difference in capsule temperatures is a likely explanation for large deviations from R.G. 1.99 predictions. Deviations from the R.G. 1.99 predictions are correlated to similar deviations for the accompanying materials in the same capsules, but large random fluctuations prevent precise quantitative determination. Significant scatter is noted in the surveillance data, some of which may be attributed to variations from one specimen set to another, or inherent in Charpy V-notch testing. The major contributions to the uncertainty of the R.G. 1.99 prediction model, and the overall data scatter are from mechanical test results, chemical analysis, irradiation environments, fluence evaluation, and inhomogeneous material properties. Thus in order to improve the prediction model, control of the above-mentioned error sources needs to be improved. In general the embrittlement behavior of both the A302B and A533B-1 plate materials is similar. There is evidence for a fluence-rate effect in the CMM data irradiated in test reactors; thus its implication on power reactor surveillance programs deserves special attention
DEFF Research Database (Denmark)
Andersen, Mikael Rørdam; Salazar, Margarita Pena; Schaap, Peter J.
2011-01-01
The filamentous fungus Aspergillus niger exhibits great diversity in its phenotype. It is found globally, both as marine and terrestrial strains, produces both organic acids and hydrolytic enzymes in high amounts, and some isolates exhibit pathogenicity. Although the genome of an industrial enzyme......-producing A. niger strain (CBS 513.88) has already been sequenced, the versatility and diversity of this species compel additional exploration. We therefore undertook whole-genome sequencing of the acidogenic A. niger wild-type strain (ATCC 1015) and produced a genome sequence of very high quality. Only 15...
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Potato Leaf Roll Virus Resistance Gene... REQUIREMENTS FOR PLANT-INCORPORATED PROTECTANTS Tolerances and Tolerance Exemptions § 174.513 Potato Leaf Roll... protectant Potato Leaf Roll Virus Resistance Gene (also known as orf1/orf2 gene) in or on all food...
Send your data into the cloud and make it… vaporize
Computer Security Team
2011-01-01
“Cloud computing” --- the term is as nebulous as real clouds. Basically, it means storing data somewhere on the Internet. This certainly has advantages, since this data will be available anytime from anywhere. For example, the Google mailbox is available from everywhere; “Dropbox” provides a central storage for any type of files; “ZAPR” and “TeamViewer”, once installed, allow you to share your local files by just sending around links, or give third parties full remote access to your PC, respectively. In addition, there is a growing number of cloud synchronisation services (e.g. “iCloud”/”MobileMe”, “Firefox Sync”, “Dropbox”) which provide (semi-)automatic back-ups of all local files of a laptop, PC or mobile phone. But hold on. What actually is transferred into the cloud? Personal files like bank statements? Passwords, especially CE...
International Nuclear Information System (INIS)
James, L.A.
1987-01-01
The fatigue-crack propagation (FCP) behavior of ASTM A533-B-1 steel was characterized in vacuo at 288 0 C. Tests were conducted at two stress ratios: R = 0.05 and R = 0.7. Results of these tests were compared with results from previous studies for the same type of steel tested in an air environment, and FCP rates in vacuo were generally lower than those in air. Stress ratio effects in vacuo were not as great as those in air, and both stress ratio effects and environmental effects are discussed from the standpoint of crack closure concepts
The motivation of European governments for sending Christian missionaries to Iran during Safavid era
Directory of Open Access Journals (Sweden)
انسیه Hoseyni Sharif
2014-08-01
Full Text Available Religious changes and reforms which occurred in most European countries in the fifteenth century, Ottoman danger which was an important issue in the Christian world and Europe, and some other factors made European countries seek to disseminate Christianity and promote Catholicism by collaboration and advice from Pope. Therefore, any European country selected missionaries among Catholic sects and sent them to other areas including Iran. What was governments` main motivation to send missionaries to other areas? Were religious factors influenced by political and economic issues? The present article attempts to have an analytical view and to utilize the reports related to the presence and activities of missionaries in Iran, Travelogues, and all historic documents and books to answer the two questions. According to political, economic and religious situation of Europe, it seems that the missionaries were sent by the support from European governments. However, because of the especial importance of the religious issues in Europe, the factor of religion was the most important matter in sending missionaries. On the other hand, due to a feud with Ottomans, commercial competitions in Europe, and development of capitalism, political and commercial issues had attracted the attention of European governments and the Pope. Priests and missionaries were very influential in development and success of political and commercial relations among European governments. But, the claim that the missionaries were sent just for political and commercial purposes is not acceptable.
The Seebeck coefficient of monocrystalline α-SiC and polycrystalline β-SiC measured at 300-533 K
Abu-Ageel, N.; Aslam, M.; Ager, R.; Rimai, L.
2000-01-01
The temperature dependence of the Seebeck coefficient of polycrystalline icons/Journals/Common/beta" ALT="beta" ALIGN="TOP"/> -SiC films deposited on quartz substrates by laser ablation and of commercially available icons/Journals/Common/alpha" ALT="alpha" ALIGN="TOP"/> -SiC wafers is reported in a temperature range of 300-533 K for the first time. The Seebeck emf of icons/Journals/Common/alpha" ALT="alpha" ALIGN="TOP"/> -SiC substrates and icons/Journals/Common/beta" ALT="beta" ALIGN="TOP"/> -SiC samples ranges between -9 µV °C-1 and -108 µV °C-1 which is higher than that of commercial Pt thermocouples.
Energy Technology Data Exchange (ETDEWEB)
Druce, S.G.; Gage, G.; Jordan, G.
1985-04-01
Manganese-molybdenum-nickel steels are used commonly in the fabrication of critical components in the PWR primary circuit operating at temperatures up to 345 C for periods up to several hundred thousand hours. Demonstration of structural integrity throughout service life requires quantification of the effects of thermal ageing on mechanical properties. Thermal ageing in the temperature range 300 to 550 C for durations up to 2000 h was studied in quenched and tempered A533B plate and simulated heat-affected-zone (HAZ) microstructures in A533B and A508 materials. A combination of tensile, hardness and Charpy impact tests were used to assess changes in rheological and toughness related properties. Quantitative fractography and Auger spectroscopy were used to characterize associated changes in fracture mode and grain boundary composition.
Mayavan, T.; Karthikeyan, L.; Senthilkumar, V. S.
2016-11-01
The present work aims to investigate the effects of the temperature gradient developed within the tool profiles on the formability of IS 513 CR3-grade steel sheets using the cup drawing test. The deformation characteristics of steel sheets were analyzed by comparing the thicknesses in various regions of the formed cup and also the limiting drawing ratios (LDR). Finite element simulations were carried out to predict the behavior of the steel sheets in isothermal and non-isothermal forming using Abaqus/Standard 6.12-1. An analytical model created by Kim was used to validate the experimental and finite element analysis (FEA) results on identical process parameters. Both the FEA and analytical modeling results showed that formability improvement is possible in warm forming; the findings are in good agreement with the experimental results in determining the locations and values of excessive thinning. The results also indicated that formability improvement cannot be achieved by keeping the tooling temperature at the same level. The LDR increased by around 9.5% in isothermal forming and by 19% in non-isothermal forming (with the punch maintained at a lower temperature compared with the die and blank holder). In addition, the fractured surfaces of unsuccessfully formed samples were analyzed using scanning electron microscopy. Metallographic investigations confirmed that the fracture mechanism during the forming of IS 513 CR3-grade steel sheets depends on the brittleness, strain hardening value, forming temperature, and magnitude of stresses developed.
Effect of microstructure on the susceptibility of a 533 steel to temper embrittlement
International Nuclear Information System (INIS)
Raoul, S.; Marini, B.; Pineau, A.
1998-01-01
In ferritic steels, brittle fracture usually occurs at low temperature by cleavage. However the segregation of impurities (P, As, Sn etc..) along prior γ grain boundaries can change the brittle fracture mode from transgranular to intergranular. In quenched and tempered steels, this segregation is associated with what is called the temper-embrittlement phenomenon. The main objective of the present study is to investigate the influence of the as-quenched microstructure (lower bainite or martensite) on the susceptibility of a low alloy steel (A533 cl.1) to temper-embrittlement. Dilatometric tests were performed to determine the continous-cooling-transformation (CCT) diagram of the material and to measure the critical cooling rate (V c ) for a martensitic quench. Then subsized Charpy V-notched specimens were given various cooling rates from the austenitization temperature to obtain a wide range of as-quenched microstructures, including martensite and bainite. These specimens were subsequently given a heat treatment to develop temper embrittlement and tested to measure the V-notch fracture toughness at -50 C. The fracture surfaces were examined by SEM. It is shown that martensitic microstructures are more susceptible to intergranular embrittlement than bainitic microstructures. These observed microstructural influences are briefly discussed. (orig.)
Radiological accident in Panama - IAEA to send assistance team
International Nuclear Information System (INIS)
2001-01-01
Full text: The International Atomic Energy Agency (IAEA) is sending a team of six international experts to assist the authorities of Panama to deal with the aftermath of a radiological accident that occurred at Panama's National Oncology Institute. The Government of Panama informed the IAEA on 22 May about the accident, reported that 28 patients have been affected, and requested IAEA's assistance under the Convention on Assistance in the Case of a Nuclear Accident or Radiological Emergency, to which Panama is a party. The assistance to be provided by the expert mission will include: ensuring that the radiation source(s) involved in the accident is (are) in a safe and secure condition; evaluating the doses incurred by the affected patients, inter alia, by analysing the treatment records and physical measurements; undertaking a medical evaluation of the affected patients' prognosis and treatment, taking into account, inter alia, the autopsy findings for those who died; and identifying issues on which the IAEA could offer to provide and/or co-ordinate assistance to minimize the consequences of the accident. The team, which includes senior experts in radiology, radiotherapy, radiopathology, radiation dosimetry and radiation protection from France, USA and Japan, and the IAEA itself, will leave for Panama tomorrow, 26 May
Barlow, Alexandra; Humphrey, Neil
2012-01-01
Parents' involvement in their children's education is known to be an important predictor of a range of adaptive outcomes. For learners with special educational needs and disabilities (SEND), lack of parental engagement and confidence has been highlighted as a problematic issue. Given this, the objectives of the current study were to: (i) determine…
41 CFR 102-118.260 - Must my agency send all quotations, tenders, or contracts with a TSP to GSA?
2010-07-01
... quotations, tenders, or contracts with a TSP to GSA? 102-118.260 Section 102-118.260 Public Contracts and... REGULATION TRANSPORTATION 118-TRANSPORTATION PAYMENT AND AUDIT Use of Government Billing Documents Quotations, Tenders Or Contracts § 102-118.260 Must my agency send all quotations, tenders, or contracts with a TSP to...
Energy Technology Data Exchange (ETDEWEB)
1980-06-01
This document is the Final Report of the Solar Energy System Installed at the First Solar Heated Office Building, One Solar Place, Dallas, Texas. The Solar System was designed to provide 87 percent of the space heating needs, 100 percent of the potable hot water needs and is sized for future absorption cooling. The collection subsystem consists of 28 Solargenics, series 76, flat plate collectors with a total area of 1596 square feet. The solar loop circulates an ethylene glycol-water solution through the collectors into a hot water system heat exchanger. The hot water storage subsystem consists of a heat exchanger, two 2300 gallon concrete hot water storage tanks with built in heat exchangers and a back-up electric boiler. The domestic hot water subsystem sends hot water to the 10,200 square feet floor area office building hot water fixtures. The building cold water system provides make-up to the solar loop, the heating loop, and the hot water concrete storage tanks. The design, construction, cost analysis, operation and maintenance of the solar system are described. The system became operational July 11, 1979.
Silva, Adriana Madeira Alvares da [UNIFESP; Maciel, Rui Monteiro de Barros [UNIFESP; Dias-da-Silva, Magnus Régios [UNIFESP; Toledo, Silvia Regina Caminada de [UNIFESP; De Carvalho, Marcos B.; Cerutti, Janete Maria [UNIFESP
2003-01-01
Familial medullary thyroid carcinoma is related to germ-line mutations in the RET oncogene, mainly in cysteine codon 10 or 11, whereas noncysteine mutations in codons 13 - 15 are rare. We now report a new missense point mutation in exon 8 of the RET gene (1597G-->T) corresponding to a Gly(533)Cys substitution in the cystein-rich domain of RET protein in 76 patients from a 6-generation Brazilian family with 229 subjects, with ascendants from Spain. It is likely that the mutation causes familia...
Directory of Open Access Journals (Sweden)
Luis Miguel Pérez
2011-08-01
Full Text Available Introducción: la diabetes mellitus tipo 2 es una enfermedad heterogénea y multifactorial, que está determinada por factores genéticos y no genéticos. El sustrato 1 del receptor de la insulina (IRS-1 cumple una función fundamental en la transmisión de la señal insulínica, por tanto sus variantes génicas constituyen blancos importantes en el estudio de la susceptibilidad genética a esta enfermedad en las diferentes poblaciones. Objetivo: explorar el papel de las variantes polimórficas Gly972Arg y Ala513Pro del gen IRS-1 en la susceptibilidad genética de la diabetes mellitus tipo 2 en un grupo de la población cubana. Métodos: se determinó la frecuencia de los polimorfismos Gly972Arg y Ala513Pro del IRS-1 en 499 ciudadanos cubanos, con un índice de masa corporal entre 22-30, con edades comprendidas entre los 40 y 70 años: de ellos 272 (54,5 % diabéticos y 227 (45,5 % no diabéticos. Resultados: la frecuencia del alelo Pro513 fue baja (1,2 % y similar para ambos grupos (1,1 % vs. 1,3 % para el grupo de diabéticos y el grupo control, respectivamente. La frecuencia del polimorfismo Gly972Arg fue de 16,2%, superior a la reportada para la mayoría de las poblaciones estudiadas. No se encontraron diferencias significativas en la frecuencia del alelo Arg972 entre el grupo de diabéticos y el grupo control (15,4 % vs. 17,3 %, ni cambios en los niveles de glucemia e insulinemia asociados a la presencia del alelo polimórfico Arg972. Conclusiones: en este grupo de sujetos de la población cubana, las variantes polimórficas Ala513Pro y Gly972Arg del gen IRS-1 no participan en la etiología de la diabetes mellitus tipo 2.Introduction: the type 2 diabetes mellitus is a heterogeneous and multifactor disease determined by genetic and no-genetic factors. The substrate 1 of insulin receptor (IRS-1 has a fundamental function in transmission of insulin signal, thus its genic variants are significant targets in study of genetic susceptibility to
Effect of microstructure on the susceptibility of a 533 steel to temper embrittlement
Energy Technology Data Exchange (ETDEWEB)
Raoul, S.; Marini, B. [CEA Centre d`Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France). Service de Recherches Metallurgiques Appliquees; Pineau, A. [CNRS, Evry (France). Centre de Materiaux
1998-11-01
In ferritic steels, brittle fracture usually occurs at low temperature by cleavage. However the segregation of impurities (P, As, Sn etc..) along prior {gamma} grain boundaries can change the brittle fracture mode from transgranular to intergranular. In quenched and tempered steels, this segregation is associated with what is called the temper-embrittlement phenomenon. The main objective of the present study is to investigate the influence of the as-quenched microstructure (lower bainite or martensite) on the susceptibility of a low alloy steel (A533 cl.1) to temper-embrittlement. Dilatometric tests were performed to determine the continous-cooling-transformation (CCT) diagram of the material and to measure the critical cooling rate (V{sub c}) for a martensitic quench. Then subsized Charpy V-notched specimens were given various cooling rates from the austenitization temperature to obtain a wide range of as-quenched microstructures, including martensite and bainite. These specimens were subsequently given a heat treatment to develop temper embrittlement and tested to measure the V-notch fracture toughness at -50 C. The fracture surfaces were examined by SEM. It is shown that martensitic microstructures are more susceptible to intergranular embrittlement than bainitic microstructures. These observed microstructural influences are briefly discussed. (orig.) 11 refs.
2010-01-15
... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Office of Biotechnology... Coordinator, Office of Biotechnology Activities, Office of Science Policy, Office of the Director, National..., Office of Biotechnology Activities, National Institutes of Health. [FR Doc. 2010-730 Filed 1-14-10; 8:45...
J-R Fracture Resistance of SA533 Gr.B-Cl.1 Steel for Reactor Pressure Vessel
Energy Technology Data Exchange (ETDEWEB)
Yoon, Ji-Hyun; Hong, Seokmin; Lee, Bong-Sang [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2016-10-15
A rolled plate might show different mechanical behaviors from a forging, even though they contain same chemical compositions. Furthermore, it is known that the fracture behavior of a rolled plate is very sensitive to material orientation comparing to a forging. In this study, the J-R fracture resistances of SA533 Gr.B-Cl.1 plate were measured at reactor operating temperature and the material orientation sensitivity was discussed. The decrease of fracture resistance of this kind of low alloy steel at an elevated temperature is known as the effect of dynamic strain aging (DSA). It was attributed to that the carbides and grains elongated to primary rolling direction, so that the aspect ratio of carbides and grains in the specimen with T-L orientation is larger. Generally, the hard second phase could take a roll of trigger point of unstable fracture. It is needed that the fracture surfaces of the tested specimens to be examined profoundly.
2010-10-01
... Office of Aviation Safety, Office of Railroad Safety, Office of Highway Safety, Office of Marine Safety... Offices of Aviation, Railroad, Highway, Marine, and Pipeline and Hazardous Materials Safety, the authority... 49 Transportation 7 2010-10-01 2010-10-01 false Delegation to the Directors of Office of Aviation...
DEFF Research Database (Denmark)
Jacobsen, S; Petersen, J; Ullman, S
1998-01-01
influence on survival related to mortality caused by infections. Diffuse central nervous system disease and myocarditis were related to increased SLE-related mortality, whereas photosensitivity predicted a decreased mortality. Non-fatal infections and thrombotic events predicted a decreased overall survival......In this Danish multicentre study, predictive clinical factors of mortality and survival were calculated for 513 patients with systemic lupus erythematosus (SLE), 122 of whom died within a mean observation period of 8.2 years equalling a mortality rate of 2.9% per year. Survival rates were 97%, 91...
2011-05-18
... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Office of Biotechnology Activities, Office of Science Policy, Office of the Director; Notice of Meeting Pursuant to section 10(a) of... Hill, NSABB Program Assistant, NIH Office of Biotechnology Activities, 6705 Rockledge Drive, Suite 750...
2011-01-21
... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Office of Biotechnology Activities, Office of Science Policy, Office of the Director; Notice of Meeting Pursuant to section 10(a) of... Assistant NIH Office of Biotechnology Activities, 6705 Rockledge Drive, Suite 750, Bethesda, Maryland 20892...
2011-12-12
... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Office of Biotechnology Activities, Office of Science Policy, Office of the Director; Notice of Meeting Pursuant to section 10(d) of..., NSABB Program Assistant, NIH Office of Biotechnology Activities, 6705 Rockledge Drive, Suite 750...
2012-11-06
... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Office of Biotechnology Activities, Office of Science Policy, Office of the Director; Notice of Meeting Pursuant to section 10(a) of..., Maryland 20892. Contact Person: Ronna Hill, NSABB Program Assistant, NIH Office of Biotechnology Activities...
2010-09-24
... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Office of Biotechnology Activities, Office of Science Policy, Office of the Director; Notice of Meeting Pursuant to section 10(a) of..., NSABB Program Assistant, NIH Office of Biotechnology Activities, 6705 Rockledge Drive, Suite 750...
Office of the Chief Financial Officer Annual Report 2009
Energy Technology Data Exchange (ETDEWEB)
Fernandez, Jeffrey
2009-12-15
Presented is the 2009 Chief Financial Officer's Annual Report. The data included in this report has been compiled from the Budget Office, the Controller, Procurement and Property Management and the Sponsored Projects Office.
76 FR 5391 - Office of Biotechnology Activities, Office of Science Policy, Office of the Director
2011-01-31
... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Office of Biotechnology Activities, Office of Science Policy, Office of the Director Amended Notice of Meeting Notice is hereby given of a change in the meeting of the National Science Advisory Board for Biosecurity (NSABB), February...
2010-03-30
... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Office of Biotechnology... Lewallen, Advisory Committee Coordinator, Office of Biotechnology Activities, Office of Science Policy..., Director, Office of Biotechnology Activities, National Institutes of Health. [FR Doc. 2010-6970 Filed 3-29...
A Firsthand Comparison of a System Office to a College Office
Hom, Willard C.
2010-01-01
System offices for community college institutional research differ in many ways from campus offices for community college institutional research. The other chapters in this volume describe salient characteristics of system IR offices, but many readers may want to see a direct comparison of system IR offices to campus IR offices in the community…
Griffis, Betty Ann
Defining the multinational as a producing enterprise motivated by profit and owning or controlling facilities in more than one country, this paper analyzes the process employed by United States multinationals in sending parent country nationals abroad for service in a subsidiary. It first examines the process in its fullest form by citing…
Solar heating and hot water system installed at office building, One Solar Place, Dallas, Texas
1980-01-01
A solar heating on cooling system is described which is designed to provide 87 percent of the space heating needs, 100 percent of the potable hot water needs and is sized for future absorption cooling. The collection subsystem consists of 28 solargenics, series 76, flat plate collectors with a total area of 1,596 square feet. The solar loop circulates an ethylene glyco water solution through the collectors into a hot water system exchanger. The water storage subsystem consists of a heat exchanger, two 2,300 gallon concrete hot water storage tanks with built in heat exchangers and a back-up electric boiler. The domestic hot water subsystem sends hot water to the 10,200 square feet floor area office building hot water water fixtures. The building cold water system provides make up to the solar loop, the heating loop, and the hot water concrete storage tanks. The design, construction, cost analysis, operation and maintenance of the solar system are described.
Muller, J A; Ross, R P; Sybesma, W F H; Fitzgerald, G F; Stanton, C
2011-10-01
The aim of this study was to investigate the influence of supplementing growth medium with unsaturated fatty acids on the technical properties of the probiotic strain Lactobacillus johnsonii NCC 533, such as heat and acid tolerance, and inhibition of Salmonella enterica serovar Typhimurium infection. Our results showed that the membrane composition and morphology of L. johnsonii NCC 533 were significantly changed by supplementing a minimal Lactobacillus medium with oleic, linoleic, and linolenic acids. The ratio of saturated to unsaturated plus cyclic fatty acids in the bacterial membrane decreased by almost 2-fold when minimal medium was supplemented with unsaturated fatty acids (10 μg/ml). The subsequent acid and heat tolerance of L. johnsonii decreased by 6- and 20-fold when the strain was grown in the presence of linoleic and linolenic acids, respectively, compared with growth in oleic acid (all at 10 μg/ml). Following acid exposure, significantly higher (P acid content was detected in the membrane when growth medium was supplemented with linoleic or linolenic acid, indicating that saturation of the membrane fatty acids occurred during acid stress. Cell integrity was determined in real time during stressed conditions using a fluorescent viability kit in combination with flow cytometric analysis. Following heat shock (at 62.5°C for 5 min), L. johnsonii was unable to form colonies; however, 60% of the bacteria showed no cell integrity loss, which could indicate that the elevated heat inactivated vital processes within the cell, rendering it incapable of replication. Furthermore, L. johnsonii grown in fatty acid-enriched minimal medium had different adhesion properties and caused a 2-fold decrease in S. enterica serovar Typhimurium UK1-lux invasion of HT-29 epithelial cells compared with bacteria grown in minimal medium alone. This could be related to changes in the hydrophobicity and fluidity of the membrane. Our study shows that technical properties
Macro-IML manual for DEC PDP 11 computer with controller DEC CA 11-A/BORER type 1,533 A
International Nuclear Information System (INIS)
Kubitz, M.; Kind, R.
1975-03-01
The IML-implementations follow the Macro-Syntax as given in Appendix A of the document 'CAMAC. The Definitior of IML (A Language For Use in CAMAC Systems)'. This document has been adopted as a description by ESONE and AEC NIM in August/September 74 and has been published in October 74. They have been designed for the DEC PDP 11 computer with the branch controller DEC CA 11-A and the Single Crate Controller BORER Type 1,533 A. For both DEC operating systems, DOS V08/09 and RSX-11D/M a full set of macros has been implemented except the block transfer on special LAM, X-error control statements and the subscript mode. Transfer modes not implemented by the hardware of the CA 11-A are simulated by software. (orig.) [de
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false The United States Patent and Trademark Office as a Designated Office or Elected Office. 1.414 Section 1.414 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES International Processing...
International Nuclear Information System (INIS)
Mohsen-Nia, M.; Memarzadeh, M.R.
2010-01-01
Isobaric (vapour + liquid) equilibrium measurements have been reported for the binary mixture of (1-pentanol + propionic acid) at (53.3 and 91.3) kPa. Liquid phase activity coefficients were calculated from the equilibrium data. The thermodynamic consistency of the experimental results was checked using the area test and direct test methods. According to these criteria, the measured (vapour + liquid) equilibrium results were found to be consistent thermodynamically. The obtained results showed a maximum boiling temperature azeotrope at both pressures studied. The measured equilibrium results were satisfactorily correlated by the models of Wilson, UNIQUAC, and NRTL activity coefficients. The results obtained indicate that the performance of the NRTL model is superior to the Wilson and UNIQUAC models for correlating the measured isobaric (vapour + liquid) equilibrium data.
SharePoint Office Pocket Guide
Webb, Jeff
2009-01-01
With this handy reference as your guide, you can reap all the benefits of SharePoint--Microsoft's amazing information-sharing tool. It shows you, in plain language, how to construct a web site where individuals from all over can capture and share ideas. Learn how to upload documents, edit content, send alerts, track work items, add new team members, and much more.
Challenges in sending large radiology images over military communications channels
Cleary, Kevin R.; Levine, Betty A.; Norton, Gary S.; Mundur, Padmavathi V.
1997-05-01
In cooperation with the US Army, Georgetown University Medical Center (GUMC) deployed a teleradiology network to sites in Bosnia-Herzegovina, Hungary, and Germany in early 1996. This deployment was part of Operation Primetime III, a military project to provide state-of-the-art medical care to the 20,000 US troops stationed in Bosnia-Herzegovina.In a three-month time frame from January to April 1996, the Imaging Sciences and Information Systems (ISIS) Center at GUMC worked with the Army to design, develop, and deploy a teleradiology network for the digital storage and transmission of radiology images. This paper will discuss some of the problems associated with sending large files over communications networks with significant delays such as those introduced by satellite transmissions.Radiology images of up to 10 megabytes are acquired, stored, and transmitted over the wide area network (WAN). The WAN included leased lines from Germany to Hungary and a satellite link form Germany to Bosnia-Herzegovina. The communications links provided at least a T-1 bandwidth. The satellite link introduces a round-trip delay of approximately 500 milliseconds. This type of high bandwidth, high delay network is called a long fat network. The images are transferred across this network using the Transmission Control Protocol (TCP/IP). By modifying the TCP/IP software to increase the window size, the throughput of the satellite link can be greatly improved.
76 FR 65512 - Agency Forms Undergoing Paperwork Reduction Act Review
2011-10-21
... (CDC) publishes a list of information collection requests under review by the Office of Management and....gov . Send written comments to CDC Desk Officer, Office of Management and Budget, Washington, DC 20503... parents; brand ambassadors; educators; school leadership; program implementers; community representatives...
da Silveira, Marina Bonfogo; Lima, Kelvin Furtado; da Silva, Andrea Renata; Dos Santos, Robson Augusto Souza; Moraes, Karen C M
2017-12-04
Lung tumors are a frequent type of cancer in humans and a leading cause of death, and the late diagnostic contributes to high mortality rates. New therapeutic strategies are needed, and the heptapeptide angiotensin-(1-7) [ang-(1-7)] demonstrated the ability to control cancer growth rates and migration in vitro and in vivo. However, the possible use of the heptapeptide in clinical trials demands deeper analyses to elucidate molecular mechanisms of its effect in the target cells. In this study, we investigated relevant elements that control pro-inflammatory environment and cellular migration, focusing in the post-transcription mechanism using lung tumor cell line. In our cellular model, the microRNA-513a-3p was identified as a novel element targeting ITG-β8, thereby controlling the protein level and its molecular function in the controlling of migration and pro-inflammatory environment. These findings provide useful information for future studies, using miR-513a-3p as an innovative molecular tool to control lung tumor cell migration, which will support more effective clinical treatment of the patients with the widely used chemotherapeutic agents, increasing survival rates.
76 FR 9814 - Proposed Collection, Comment Request
2011-02-22
... 25, 2011. ADDRESSES: Send comments to Nora Kincaid, BLS Clearance Officer, Division of Management... INFORMATION CONTACT: Nora Kincaid, BLS Clearance Officer, at 202-691-7628 (this is not a toll free number...
Czech Academy of Sciences Publication Activity Database
Svoboda, Jiří
2008-01-01
Roč. 7, č. 10 (2008), s. 82-85 ISSN 1213-9394 Institutional research plan: CEZ:AV0Z80010507 Keywords : Neandertals * Czech Republic * Slovak Republic Subject RIV: AC - Archeology, Anthropology, Ethnology
Effects of office innovation on office workers' health and performance
Meijer, Eline M.; Frings-Dresen, Monique H. W.; Sluiter, Judith K.
2009-01-01
The implementation of an innovative office concept (e.g. open-plan, flexible workplaces and a paperless office concept) on health and productivity among office workers was evaluated with questionnaires of 138 workers at baseline and 6 and 15 months afterwards. Work-related fatigue, general health,
Hikmet Hassa; Basar Tekin; H. Mete Tanir; Bulent Cakmak
2007-01-01
Although hysteroscopy has evolved in recent years, its use in the office setting was not made practical until early 1980s with the introduction of small caliber hysteroscopes of less than 5- mm outer diameter.This innovation simplifies ambulatory uterine exploration and the office evaluation of patients with abnormal uterine bleeding. This article reviews current trends in office hysteroscopy and its areas of application in different forms of gynecological problems.
Doyle, Kevin S.
The New Jersey Interdistrict School Choice Program allows parents to send their students to schools outside of their local school district. Determining why parents send their students to choice schools is important to school leaders who are trying to attract new students, as well as those who are trying to retain their current students. This study examined the reasons why parents decided to send their students to the Magnet Program for Math and Science (MP4M&S), a school choice program in a suburban school district in northwest New Jersey, during the 2015- 2016 school year. A large volume of research has focused on school choice programs in urban and poor communities. This study addressed the gap in the research by focusing on an affluent suburban school district. This mixed methods study focused on three areas, why parents choose to send their students to the MP4M&S, what criteria they used to make their decision, and where they got their information. Research shows that these three areas of focus can be influenced by parental level of education, socioeconomic status, geographic location, academic rigor, school quality, and school environment. Parents from different groups, based upon their out-of-district status, were interviewed. The information from the interviews was used to focus a survey that was given to the families of all 137 students in the MP4M&S during the 2015-2016 school year. The results of this study show that parents found the academic focus, academic rigor, the school environment, the original research project, the activity offerings, and the economics involved in attending the program to be important attractors. The study also found that the Information Nights, the school website, and interactions with members of the MP4M&S community to be important sources of information. Finally, the study found that there were few differences between in and out-of-district parents when assigning importance to both the attractors and the sources in the study
2010-03-05
... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Office of Biotechnology... meeting, please contact Ms. Laurie Lewallen, Advisory Committee Coordinator, Office of Biotechnology...: March 1, 2010. Amy P. Patterson, Director, Office of Biotechnology Activities, National Institutes of...
Marmel, Elaine
2013-01-01
A basic introduction to learn Office 2013 quickly, easily, and in full color Office 2013 has new features and tools to master, and whether you're upgrading from an earlier version or using the Office applications for the first time, you'll appreciate this simplified approach. Offering a clear, visual style of learning, this book provides you with concise, step-by-step instructions and full-color screen shots that walk you through the applications in the Microsoft Office 2013 suite: Word, Excel, PowerPoint, Outlook, and Publisher.Shows you how to tackle dozens of Office 2013
Muller, J. A.; Ross, R. P.; Sybesma, W. F. H.; Fitzgerald, G. F.; Stanton, C.
2011-01-01
The aim of this study was to investigate the influence of supplementing growth medium with unsaturated fatty acids on the technical properties of the probiotic strain Lactobacillus johnsonii NCC 533, such as heat and acid tolerance, and inhibition of Salmonella enterica serovar Typhimurium infection. Our results showed that the membrane composition and morphology of L. johnsonii NCC 533 were significantly changed by supplementing a minimal Lactobacillus medium with oleic, linoleic, and linolenic acids. The ratio of saturated to unsaturated plus cyclic fatty acids in the bacterial membrane decreased by almost 2-fold when minimal medium was supplemented with unsaturated fatty acids (10 μg/ml). The subsequent acid and heat tolerance of L. johnsonii decreased by 6- and 20-fold when the strain was grown in the presence of linoleic and linolenic acids, respectively, compared with growth in oleic acid (all at 10 μg/ml). Following acid exposure, significantly higher (P acid content was detected in the membrane when growth medium was supplemented with linoleic or linolenic acid, indicating that saturation of the membrane fatty acids occurred during acid stress. Cell integrity was determined in real time during stressed conditions using a fluorescent viability kit in combination with flow cytometric analysis. Following heat shock (at 62.5°C for 5 min), L. johnsonii was unable to form colonies; however, 60% of the bacteria showed no cell integrity loss, which could indicate that the elevated heat inactivated vital processes within the cell, rendering it incapable of replication. Furthermore, L. johnsonii grown in fatty acid-enriched minimal medium had different adhesion properties and caused a 2-fold decrease in S. enterica serovar Typhimurium UK1-lux invasion of HT-29 epithelial cells compared with bacteria grown in minimal medium alone. This could be related to changes in the hydrophobicity and fluidity of the membrane. Our study shows that technical properties
Directory of Open Access Journals (Sweden)
Hikmet Hassa
2007-06-01
Full Text Available Although hysteroscopy has evolved in recent years, its use in the office setting was not made practical until early 1980s with the introduction of small caliber hysteroscopes of less than 5- mm outer diameter.This innovation simplifies ambulatory uterine exploration and the office evaluation of patients with abnormal uterine bleeding. This article reviews current trends in office hysteroscopy and its areas of application in different forms of gynecological problems.
28 CFR 0.118 - Office of Chief Administrative Hearing Officer.
2010-07-01
... Officer. 0.118 Section 0.118 Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION OF THE DEPARTMENT OF JUSTICE Executive Office for Immigration Review § 0.118 Office of Chief Administrative Hearing... Law Judges in performance of their duties in accordance with 8 U.S.C. 1324 A and B. ...
Study of the reaction 35Cl(p,γγ)36Ar at the proton energy Esub(p) = 533 keV
International Nuclear Information System (INIS)
Grosswendt, B.
1972-01-01
Triple correlation experiments were carried out on the 35 Cl(p,γγ) 36 Ar reaction at the proton energy of Esub(p) = 533 keV for studies of the 9.025 MeV state in the 36 Ar nucleus. The analysis of the gamma cascades between the 36 Ar states at 9.025 MeV, 1.97 MeV and the ground state resulted in the spin assignment of J 1 =2 + for the proton capture level. Comparison of the 36 Ar level scheme with states in the isobar 36 Cl nucleus indicated that the 2 + state in 36 Ar as measured in this study may be the isobar state analogous with 2 + level at 1.949 MeV in the 36 Cl spectrum. (orig./RF) [de
Withee, Ken
2012-01-01
The information you need to create a virtual office that can be accessed anywhere Microsoft Office 365 is a revolutionary technology that allows individuals and companies of all sizes to create and maintain a virtual office in the cloud. Featuring familiar Office Professional applications, web apps, Exchange Online, and Lync Online, Office 365 offers business professionals added flexibility and an easy way to work on the go. This friendly guide explains the cloud, how Office 365 takes advantage of it, how to use the various components, and the many possibilities offered by Office 365. It provi
77 FR 11534 - Privacy Act of 1974; Systems of Records
2012-02-27
...: [CHANGE TO READ] Chief Financial Officer, Federal Retirement Thrift Investment Board, 77 K Street NE..., Washington, DC 20002. SYSTEM MANAGERS AND ADDRESS: [CHANGE TO READ] The Chief Financial Officer maintains the... information about themselves should send inquiries to the Chief Financial Officer at Federal Retirement Thrift...
76 FR 53935 - Delegation Authority for the Office of the Chief Financial Officer
2011-08-30
... Office of the Chief Financial Officer AGENCY: Office of the Secretary, HUD. ACTION: Notice of delegation of authority. SUMMARY: In this notice, the Secretary of HUD, pursuant to the Chief Financial Officers Act of 1990 (CFO Act), which established the position of the Chief Financial Officer within HUD, is...
41 CFR 109-25.104 - Acquisition of office furniture and office machines.
2010-07-01
... furniture and office machines. 109-25.104 Section 109-25.104 Public Contracts and Property Management... furniture and office machines. DOE offices and designated contractors shall make the determination as to whether requirements can be met through the utilization of DOE owned furniture and office machines. ...
Directory of Open Access Journals (Sweden)
Nayana H Patel
2016-01-01
Full Text Available CONTEXT: Genetic profiling of embryos (also known as preimplantation genetic diagnosis before implantation has dramatically enhanced the success quotient of in vitro fertilization (IVF in recent times. The technology helps in avoiding selective pregnancy termination since the baby is likely to be free of the disease under consideration. AIM: Screening of embryos free from c.1537G>A; p.G513S mutation within the COL4A1 gene for which the father was known in before be in heterozygous condition. SUBJECTS AND METHODS: Processing of trophectoderm biopsies was done from twelve embryos for c.1537G>A; p.G513S mutation within the COL4A1 gene. DNA extracted from isolated cells were subjected to whole genome amplification using an isothermal amplification and strand displacement technology. Oligonucleotide primers bracketing the mutation were synthesized and used to amplify 162 base pairs (bp polymerase chain reaction amplicons originating from each embryo which were subsequently sequenced to detect the presence or absence of the single base polymorphism. RESULTS: Three out of 12 embryos interrogated in this study were found to be normal while 9 were found to harbor the mutation in heterozygous condition. Implantation of one of the normal embryos following by chorionic villus sampling at 11 th week of pregnancy indicated that the baby was free from c.1537G>A; p.G513S mutation within the COL4A1 gene. CONCLUSIONS: Single-cell sequencing is a helpful tool for preimplantation embryo profiling. This is the first report from India describing the birth of a normal child through IVF procedure where a potential pathogenic COL4A1 allele was avoided using this technology.
76 FR 53939 - Order of Succession for the Office of the Chief Financial Officer
2011-08-30
... Office of the Chief Financial Officer AGENCY: Office of the Secretary, HUD. ACTION: Notice of Order of... Chief Financial Officer. This Order of Succession supersedes all prior Orders of Succession for the Office of the Chief Financial Officer. DATES: Effective Date: August 19, 2011. FOR FURTHER INFORMATION...
... for Children & Families Office of Child Care By Office Administration for Native Americans (ANA) Administration on Children, ... about the Child Care Rule > What is the Office of Child Care (OCC)? The Office of Child ...
2010-03-31
... mins) 50 Optometry Privileges 21 1 0.33 (20 mins) 7 Psychology Privileges 30 1 0.17 (10 mins) 5..., Attention: Desk Officer for IHS, New Executive Office Building, Room 10235, Washington, DC 20503. Send...
International Nuclear Information System (INIS)
Cowle, E.S.; Hall, L.D.; Koss, P.; Saheb, E.; Setrakian, V.
1995-01-01
This paper addresses the viability of multi-office project engineering as has been made possible in a large part by the computer age. Brief discussions are provided on two past projects describing the authors' initial efforts at multi-office engineering, and an in-depth discussion is provided on a current Bechtel project that demonstrates their multi-office engineering capabilities. Efficiencies and cost savings associated with executing an engineering project from multiple office locations was identified as a viable and cost-effective execution approach. The paper also discusses how the need for multi-office engineering came about, what is required to succeed, and where they are going from here. Furthermore, it summarizes the benefits to their clients and to Bechtel
2013-12-19
... DEPARTMENT OF COMMERCE International Trade Administration [C-533-856] Steel Threaded Rod From..., International Trade Administration, Department of Commerce. SUMMARY: The Department of Commerce (``the... CONTACT: Brooke Kennedy, AD/CVD Operations, Office III, Enforcement and Compliance, International Trade...
Annual Report 2008 -- Office of the Chief Financial Officer (OCFO)
Energy Technology Data Exchange (ETDEWEB)
Fernandez, Jeffrey
2008-12-22
It is with great pleasure that I present to you the 2008 Chief Financial Officer's Annual Report. The data included in this report has been compiled from the Budget Office, the Controller, Procurement and Property Management and the Sponsored Projects Office. Also included are some financial comparisons with other DOE Laboratories and a glossary of commonly used acronyms.
77 FR 11539 - Agency Forms Undergoing Paperwork Reduction Act Review
2012-02-27
... (CDC) publishes a list of information collection requests under review by the Office of Management and... . Send written comments to CDC Desk Officer, Office of Management and Budget, Washington, DC 20503 or by... where participants include: Middle school students age 11 to 14 years; middle school parents; brand...
Physician offices marketing: assessing patients' views of office visits.
Emmett, Dennis; Chandra, Ashish
2010-01-01
Physician offices often lack the sense of incorporating appropriate strategies to make their facilities as marketer of their services. The patient experience at a physician's office not only incorporates the care they receive from the physician but also the other non-healthcare related aspects, such as the behavior of non-health professionals as well as the appearance of the facility itself. This paper is based on a primary research conducted to assess what patients assess from a physician office visit.
2010-01-01
... officer and chief financial officer. 1710.17 Section 1710.17 Banks and Banking OFFICE OF FEDERAL HOUSING... Corporate Practices and Procedures § 1710.17 Certification of disclosures by chief executive officer and chief financial officer. The chief executive officer and the chief financial officer of an Enterprise...
Help! A simple method for getting back-up help to the reference desk
Directory of Open Access Journals (Sweden)
Kenneth Furuta
2008-03-01
Full Text Available Using the "net send" command, native to Windows XP, librarians at the University of California, Riverside created a "help button" for the reference desk. The simple script file sends a message to librarians' workstations in their offices and logs the date and time of use. This paper describes that program.
76 FR 67472 - Order of Succession for the Office of the Chief Information Officer
2011-11-01
...: Juanita Galbreath, Deputy Chief Information Officer for Cyber Security and Privacy, Office of the Chief...) Deputy Chief Information Officer, for IT Operations; (3) Deputy Chief Information Officer, for Cyber Security and Privacy; (4) Deputy Chief Information Officer, for Business and IT Modernization. These...
Discovery Monday - 'The hunt for the phantom particles: sending neutrinos through the Alps'
2004-01-01
Work on the decay tube for the CERN Neutrinos to Gran Sasso (CNGS) Project. Each second, billions of neutrinos bombard every square centimetre of the Earth's surface and therefore pass through our bodies, without us realising it. These phantom particles only rarely interact with matter. They provide physicists with much food for thought, as they are difficult to 'catch' in detectors. Neutrinos are all the more elusive as they are capable of metamorphosis. There are in fact three types of neutrino, the electron neutrino, the muon neutrino and the tau neutrino, and each can mutate into the other. In 2006 CERN will send a beam of muon neutrinos through the Earth's crust to the Gran Sasso National Laboratory (Italy) some 730 kilometres away, in order to better understand the metamorphoses which the neutrino undergoes. At the next Discovery Monday, light will be shed on the path that these intriguing particles will take to Gran Sasso. You will also learn about the methods physicists use to try and catch them in or...
2010-06-11
... the types of internal controls and risk management procedures that the agencies (OCC, Board of... information collection unless it displays a currently valid Office of Management and Budget (OMB) control..., please send a copy of your comments to OCC Desk Officer, 1557-0229, by mail to U.S. Office of Management...
76 FR 32212 - Agency Forms Undergoing Paperwork Reduction Act Review
2011-06-03
... (CDC) publishes a list of information collection requests under review by the Office of Management and....gov . Send written comments to CDC Desk Officer, Office of Management and Budget, Washington, DC or by... to fill funding gaps in programs that deal with the leading causes of death and disability. Block...
2010-06-17
... collection request (ICR) described below has been submitted to the Office of Management and Budget (OMB) for..., Attention: Desk Officer for OTS, U.S. Office of Management and Budget, 725 17th Street, NW., Room 10235... statement the institution sends to the consumer. Regulation DD contains rules for advertisements of deposit...
Kuijper, P.J.
2011-01-01
Case C-533/08, the so-called TNT case, is concerned with the interpretation of Article 71 of Regulation No. 44/2001 on jurisdiction and the recognition and enforcement of judgments in civil and commercial matters (hereinafter ‘Brussels Regulation’) and with the relation between this Regulation and
Fermilab Education Office - FAQ
Search The Education Office FAQ - Frequently Asked Questions Click on the question to see the answer and the difference between the Education Office and the Lederman Science Center? The Education Office is store selling logo items and science toys. The Education Office staff works on both the 15th floor of
Directory of Open Access Journals (Sweden)
Shahin Taghavinejad-Namin
2015-08-01
Full Text Available Background and objectives : This study has been accomplished with the aim of investigating the relationship between managers' communication skills and conflict management in elementary schools in the city of Ardabil. Material and Methods: This is a cross-sectional study. The statistical population consisted of 150 elementary school principals in Ardabil. 106 participants were selected by using Krejcie-Morgan table randomly and through stratified sampling method. Data were collected through Jerabek communication skills questionnaire and Robbins conflict management questionnaire. Questionnaire’s face validity was reviewed and confirmed by the experts. Their reliability coefficient was (0.82 for communication skills and (0.95 for conflict management by using Cronbach's alpha. Data were analyzed using analytical and descriptive statistical methods (Pearson correlation coefficient test, single-sample t-test, and multiple regression. Results: Results showed that there are positive and significant relationship between communication skills (effective listening, understanding and sending messages, regulating emotions, insight into learning process, and decisiveness in communication and conflict management strategies(denial of opposition, control, solution orientation. Conclusion: Communication skills such as effective listening can be a good predictor for solving conflicts in conflict management but understanding and sending messages cannot predict conflict management abilities of managers.
76 FR 69031 - Order of Succession for the Office of the Chief Human Capital Officer
2011-11-07
... Office of the Chief Human Capital Officer AGENCY: Office of the Chief Human Capital Officer, HUD. ACTION: Notice of order of succession. SUMMARY: In this notice, the Chief Human Capital Officer for the... Human Capital Officer. DATES: Effective Date: October 20, 2011. FOR FURTHER INFORMATION CONTACT: Lynette...
Jsub(Ic)-testing of A-533 B - statistical evaluation of some different testing techniques
International Nuclear Information System (INIS)
Nilsson, F.
1978-01-01
The purpose of the present study was to compare statistically some different methods for the evaluation of fracture toughness of the nuclear reactor material A-533 B. Since linear elastic fracture mechanics is not applicable to this material at the interesting temperature (275 0 C), the so-called Jsub(Ic) testing method was employed. Two main difficulties are inherent in this type of testing. The first one is to determine the quantity J as a function of the deflection of the three-point bend specimens used. Three different techniques were used, the first two based on the experimentally observed input of energy to the specimen and the third employing finite element calculations. The second main problem is to determine the point when crack growth begins. For this, two methods were used, a direct electrical method and the indirect R-curve method. A total of forty specimens were tested at two laboratories. No statistically significant different results were obtained from the respective laboratories. The three methods of calculating J yielded somewhat different results, although the discrepancy was small. Also the two methods of determination of the growth initiation point yielded consistent results. The R-curve method, however, exhibited a larger uncertainty as measured by the standard deviation. The resulting Jsub(Ic) value also agreed well with earlier presented results. The relative standard deviation was of the order of 25%, which is quite small for this type of experiment. (author)
Perceived office environments and occupational physical activity in office-based workers.
Sawyer, A; Smith, L; Ucci, M; Jones, R; Marmot, A; Fisher, A
2017-06-01
Individuals in office-based occupations have low levels of physical activity but there is little research into the socio-ecological correlates of workplace activity. To identify factors contributing to office-based workers' perceptions of the office environment and explore cross-sectional relationships between these factors and occupational physical activity. Participants in the Active Buildings study reported perceptions of their office environment using the Movement at Work Survey. A principal component analysis (PCA) was conducted on survey items. A sub-sample wore the ActivPAL3TM accelerometer for ≥3 workdays to measure occupational step count, standing, sitting and sit-to-stand transitions. Linear regression analyses assessed relationships between environmental perceptions and activity. There were 433 participants, with accelerometer data available for 115 participants across 11 organ izations. The PCA revealed four factors: (i) perceived distance to office destinations, (ii) perceived office aesthetics and comfort, (iii) perceived office social environment and (iv) perceived management discouragement of unscheduled breaks. Younger participants perceived office destinations as being closer to their desk. Younger and female participants perceived more positive office social environments; there were no other socio-demographic differences. Within the sub-sample with accelerometer data, perceived discouragement of breaks by management was related to occupational step count/hour (B = -64.5; 95% CI -109.7 to -19.2). No other environmental perceptions were related to activity or sitting. Perceived managerial discouragement of breaks could be related to meaningful decreases in occupational step count. Future research should aim to elucidate the role of the workplace socio-cultural environment in occupational walking, with a focus on the role of management. © The Author 2017. Published by Oxford University Press on behalf of the Society of Occupational Medicine. All
Laanemets, Mari, 1975-
2008-01-01
Kunsti kaasamisest arhitektuuripraktikasse ja -projektidesse. Keskkonna kujundamisest: värvimisest tehismaastikeni. Kui uuslinnadest saavad varemed. Kunstnik-arhitekt: kunstniku-müüdi kultiveerimine arhitektuuris. "Ka mina olen maalija". Näitus kui vahend ja manifest. Bibliograafia lk. 82-85
2013-09-03
... ( http://ecos.fws.gov/docs/five_year_review/doc2551.pdf ). On December 21, 2011, we received a petition...., IPCC 2007, p. 30; Solomon et al. 2007, pp. 35-54, 82-85). Within central-western California (i.e...
International Nuclear Information System (INIS)
Li Jingsong; Durry, Georges; Cousin, Julien; Joly, Lilian; Parvitte, Bertrand; Zeninari, Virginie
2010-01-01
The self-broadening coefficients of acetylene at room temperature have been measured for 10 lines in the P branch of the ν 1 +ν 3 (Σ u + )-0(Σ g + ) bands of 12 C 2 H 2 and 13 C 12 CH 2 near 1.533 μm, using a high resolution tunable diode laser spectrometer developed for the Martian space mission PHOBOS-Grunt. The collisional widths are obtained by fitting each recorded line with the Voigt profile as well as the Rautian profile accounting for the collisional Dicke narrowing effect. The standard Voigt model provides slightly smaller broadening coefficients than the Rautian model. Our data are thoroughly compared to the main atmospheric molecule database HITRAN and previous values in various bands of acetylene. Moreover, it is worth noting that a large number of new transitions not listed in the latest HITRAN08 were measured and identified for the first time.
Wang, Wallace
2013-01-01
Office 2013 For Dummies is the key to your brand new Office! Packed with straightforward, friendly instruction, this update to one of the bestselling Office books of all time gets you thoroughly up to speed and helps you learn how to take full advantage of the new features in Office 2013. After coverage of the fundamentals, you'll discover how to spice up your Word documents, edit Excel spreadsheets and create formulas, add pizazz to your PowerPoint presentation, and much more.Helps you harness the power of all five Office 2013 applications: Word, Excel, PowerPoint,
Rodriguez-Borja, Enrique; Corchon-Peyrallo, Africa; Barba-Serrano, Esther; Villalba Martínez, Celia; Carratala Calvo, Arturo
2018-02-03
We assessed the impact of several "send & hold" clinical decision support rules (CDSRs) within the electronical request system for vitamins A, E, K, B1, B2, B3, B6 and C for all outpatients at a large health department. When ordered through electronical request, providers (except for all our primary care physicians who worked as a non-intervention control group) were always asked to answer several compulsory questions regarding main indication, symptomatology, suspected diagnosis, vitamin active treatments, etc., for each vitamin test using a drop-down list format. After samples arrival, tests were later put on hold internally by our laboratory information system (LIS) until review for their appropriateness was made by two staff pathologists according to the provided answers and LIS records (i.e. "send & hold"). The number of tests for each analyte was compared between the 10-month period before and after CDSRs implementation in both groups. After implementation, vitamins test volumes decreased by 40% for vitamin A, 29% for vitamin E, 42% for vitamin K, 37% for vitamin B1, 85% for vitamin B2, 68% for vitamin B3, 65% for vitamin B6 and 59% for vitamin C (all p values 0.03 or lower except for vitamin B3), whereas in control group, the majority increased or remained stable. In patients with rejected vitamins, no new requests and/or adverse clinical outcome comments due to this fact were identified. "Send & hold" CDSRs are a promising informatics tool that can support in utilization management and enhance the pathologist's leadership role as tests specialist.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Office. 401.18 Section 401.18 Labor Regulations Relating to Labor OFFICE OF LABOR-MANAGEMENT STANDARDS, DEPARTMENT OF LABOR LABOR-MANAGEMENT STANDARDS MEANING OF TERMS USED IN THIS SUBCHAPTER § 401.18 Office. Office means the Office of Labor-Management Standards...
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Office. 583.13 Section 583.13 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY DEFINITIONS FOR REGULATIONS AFFECTING SAVINGS AND LOAN HOLDING COMPANIES § 583.13 Office. The term Office means the Office of Thrift Supervision. ...
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Office. 561.34 Section 561.34 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY DEFINITIONS FOR REGULATIONS AFFECTING ALL SAVINGS ASSOCIATIONS § 561.34 Office. The term Office means the Office as established in section 3 of the...
41 CFR 101-25.104 - Acquisition of office furniture and office machines.
2010-07-01
... furniture and office machines. 101-25.104 Section 101-25.104 Public Contracts and Property Management... PROCUREMENT 25-GENERAL 25.1-General Policies § 101-25.104 Acquisition of office furniture and office machines... machines. The acquisition of new items shall be limited to those requirements which are considered...
Czech Academy of Sciences Publication Activity Database
Lukešová, Alena; Worland, M. R.; Kaftan, David; Lukeš, Martin
2004-01-01
Roč. 3, č. 1 (2004), s. 82-85 ISSN 1336-1120 Grant - others:Evropská unie(XE) QLRI-CT--2001-01645 Institutional research plan: CEZ:AV0Z6066911 Keywords : cryomicroscopy * cryopreservation * differential scanning calorimetry Subject RIV: EH - Ecology, Behaviour
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 10. Learning Earthquake Design and Construction – 6. How Architectural Features Affect Building During Earthquakes? C V R Murty. Classroom Volume 9 Issue 10 October 2004 pp 82-85 ...
2013-08-06
... Unit of Engineering, Operations & Technology, Print Services. 82,758 Republic Steel, Massillon... number Subject firm Location Impact date 82,513 Veyance Technologies, Inc., Lincoln, NE Adecco Services..., Advertisement Division. 82,819 Vaughan Furniture Company, Galax, VA Corporate Office, 816 Glendale Road. 82,819A...
Office Computers: Ergonomic Considerations.
Ganus, Susannah
1984-01-01
Each new report of the office automation market indicates technology is overrunning the office. The impacts of this technology are described and some ways to manage and physically "soften" the change to a computer-based office environment are suggested. (Author/MLW)
2009-01-01
20 years ago, in the summer of 1989, an office was created to assist the thousands of users who come to CERN each year, working over the broad range of projects and collaborations. Chris Onions (right), head of the Users’ Office, with Bryan Pattison (left), the Office’s founder.Before the inception of the Users Office, it was common for users to spend at least an entire day moving from office to office in search of necessary documentation and information in order to make their stay official. "Though the Office has undergone various changes throughout its lifetime, it has persisted in being a welcoming bridge to facilitate the installation of visitors coming from all over the world", says Chris Onions, head of the Users Office. This September, the Office will celebrate its 20-year anniversary with a drink offered to representatives of the User community, the CERN management and staff members from the services with whom the Office is involved. &...
2012-11-21
... manufacturers' estimates of the future vehicle population, and fuel economy improvements and incremental costs...: Kenneth R. Katz, Fuel Economy Division, Office of International Policy, Fuel Economy and Consumer Programs... Parts 531 and 533 Passenger Car Average Fuel Economy Standards--Model Years 2016-2025; Light Truck...
Pascual Osés, Maite
2007-01-01
The aim of this project is to develop an auxiliary office chair, which favorably will compete with the existing chairs on the market. Evolutions of ergonomical survey in the work environment and on the configuration of offices require new products which fulfill the requirements properly. In order to achieve it a survey about office chairs has been carried out: types, characteristics, ways of usage and products on the market besides a large antropometrical study and ergonomics related to work ...
Office of the Chief Financial Officer 2012 Annual Report
Energy Technology Data Exchange (ETDEWEB)
Williams, Kim [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2013-01-31
Fiscal Year 2012 was a year of progress and change in the Office of the Chief Financial Officer (OCFO) organization. The notable accomplishments outlined below strengthened the quality of the OCFO’s stewardship and services in support of the scientific mission of Lawrence Berkeley National Laboratory (LBNL). Three strategies were key to this progress: organizational transformation aligned with our goals; process redesign and effective use of technology to improve efficiency, and innovative solutions to meet new challenges. Over the next year we will continue to apply these strategies to further enhance our contributions to the Lab’s scientific mission. What follows is the budget, funding and costs for the office for FY 2012.
Fermilab Education Office - Physicists
on Education Server, but to take full advantage of all of this site's features, you should turn Custom Search Connect with the Fermilab Education Office! Facebook Fermilab Education Office Join these groups: Science Adventures Group Teacher Resource Center Group Twitter Fermilab Education Office For more
Fermilab Education Office - Contacts
Search The Office of Education and Public Outreach: Contacts All telephone numbers require area code Presentations for Presenters 840-3094 Office of Education and Public Outreach Spencer Pasero spasero@fnal.gov Education Office 840-3076 Fermilab Friends for Science Education General Questions Susan Dahl sdahl@fnal.gov
International Nuclear Information System (INIS)
Liu Guorong; Zhang Xiangyang; Liu Xuesheng; Ye Feng
2003-01-01
This paper introduced a method on remote control of DART spectrometer and data Acquisition and dynamic send of the results through Internet by using the JOB function of MEASTRO 32 software and a software programmed with VB. This gave an idea to realize the special networked measurement of spectrometer without the developed tool kit
Libraries in New Jersey: MedlinePlus
... deborah.org/ Camden Cooper University Hospital Cooper Medical School of Rowan University Library 1 Cooper Plaza Camden, NJ 08103 856-342- ... 8285 http://www.valleyhealth.com Stratford Rowan University School of Osteopathic Medicine ... Library 1 Medical Center Drive Stratford, NJ 08084-1504 ...
Learning Earthquake Design and Construction 20. How do Beam ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 6. Learning Earthquake Design and Construction – How do Beam–Column Joints in RC Buildings Resist Earthquakes? C V R Murty. Classroom Volume 10 Issue 6 June 2005 pp 82-85 ...
Shedlin, Michele G.; Decena, Carlos U.; Noboa, Hugo; Betancourt, Óscar
2013-01-01
BACKGROUND This study explored factors affecting the health and well being of recent refugees from Colombia in Ecuador. Data collection focused on how sending-country violence and structural violence in a new environment affect immigrant health vulnerability and risk behaviors. METHODS A qualitative approach included ethnographic observation, media content analysis, focus groups, and individual interviews with refugees (N=137). The focus groups (5) provided perspectives on the research domains by sex workers; drug users; male and female refugees; and service providers. RESULTS Social and economic marginalization are impacting the health and well being of this growing refugee population. Data illustrate how stigma and discrimination affect food and housing security, employment and health services, and shape vulnerabilities and health risks in a new receiving environment. DISCUSSION Widespread discrimination in Ecuador reflects fears, misunderstanding, and stereotypes about Colombian refugees. For this displaced population, the sequelae of violence, combined with survival needs and lack of support and protections, shape new risks to health and well-being. PMID:23377565
10 CFR 1.31 - Office of the Chief Financial Officer.
2010-01-01
... management policy including accounting principles and standards for the agency and provides policy guidance... accounting and financial management system, including an accounting system, and financial reporting and... 10 Energy 1 2010-01-01 2010-01-01 false Office of the Chief Financial Officer. 1.31 Section 1.31...
6 CFR 7.10 - Authority of the Chief Security Officer, Office of Security.
2010-01-01
...) Direct and administer DHS implementation and compliance with the National Industrial Security Program in... 6 Domestic Security 1 2010-01-01 2010-01-01 false Authority of the Chief Security Officer, Office of Security. 7.10 Section 7.10 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE...
1989-06-19
since S and dm/dt can be determined from the combined light scattering aid velocity measure- ments. This product, kfC H ], is termed the specific surface...Patterson AFB OH 45433-6563 Cleveland OH 44135-3127 (513)255-7431 AV785-7431 Dr Bruce Masson Dr. James McDonald AFWL/ARDF Code 6110 Kirtland AFB NM
Staff Association
2014-01-01
At the office, I do as I would at home At the office, just as at home, we need to stay warm, have light, be equipped (with office material, furniture). We thus need energy and raw materials. This consumption is not without consequences for our environment. How to reduce our consumption? In everyday life, we already have behaviours that allow us to save energy and resources, to sort our waste. At the office it is important to act in the same way as at home, as we spend a lot of time at our workplace. How to act more responsibly at the office, to reduce the environmental impact, and how to stay motivated? Computer, printer, copy machine… or coffee machine. There are quite a few electrical appliances which are indispensable in our office. Always turned on, or almost, they are also often inactive, and it is during these phases of inactivity that two thirds of their consumption occurs. The way one uses the computer is important in order to limit its consumption. Use the sleep mode with care. A c...
Office 2010 Web Apps For Dummies
Weverka, Peter
2010-01-01
Enhance your Microsoft Office 2010 experience with Office 2010 Web Apps!. Office Web Apps complement Office, making it easy to access and edit files from anywhere. It also simplifies collaboration with those who don't have Microsoft Office on their computers. This helpful book shows you the optimum ways you can use Office Web Apps to save time and streamline your work. Veteran For Dummies author Peter Weverka begins with an introduction to Office Web Apps and then goes on to clearly explain how Office Web Apps provide you with easier, faster, more flexible ways to get things done.: Walks you t
76 FR 71308 - Notice of Intent To Grant Exclusive License
2011-11-17
.../487,179, ``THE USE OF GNRH AND ANALOGS THEREOF FOR THE PREVENTION AND TREATMENT OF PET FERRET..., 2011. ADDRESSES: Send comments to: USDA, ARS, Office of Technology Transfer, 5601 Sunnyside Avenue, Rm. 4-1174, Beltsville, Maryland 20705-5131. FOR FURTHER INFORMATION CONTACT: June Blalock of the Office...
75 FR 45130 - Draft Compliance Policy Guide Sec. 690.800 Salmonella
2010-08-02
... humans, such as pet food and pet treats, contaminated with Salmonella and also on regulatory policy... Compliance Policy (HFC-230), Office of Enforcement, Food and Drug Administration, 5600 Fishers Lane, Rockville, MD 20857. Send two self-addressed adhesive labels to assist that office in processing your...
2013-03-22
... during the continuation of the customer relationship. Sec. 1016.8--Disclosure (institution)--Revised... customer relationship terminates, the customer's opt out direction continues to apply. Type of Review..., please send a copy of your comments by mail to: OCC Desk Officer, 1557-0216, U.S. Office of Management...
78 FR 42543 - Call for Nominations for the Rio Grande Natural Area Commission, Colorado
2013-07-16
...: Send completed Council nominations to Tom Heinlein, District Manager, BLM Front Range District Office... Relay Service (FIRS) at 1- 800-877-8339 to contact the above individual during normal business hours... (BLM) San Luis Valley Field Office will review the nomination packages in coordination with the...
7 CFR 1951.881 - Loan servicing.
2010-01-01
... when in conflict with these regulations. The loan is governed by terms of existing legal documents of... accounting records for each intermediary. The Finance Office will: (1) Coordinate with the Administrator or... of the proper accounting procedure. (2) Send monthly statements to the National Office reflecting all...
76 FR 38108 - Notice of Intent to Grant Exclusive License
2011-06-29
... Research Service, intends to grant to P & M Signs, Inc. of Mountainair, New Mexico, an exclusive license to... July 29, 2011. ADDRESSES: Send comments to: USDA, ARS, Office of Technology Transfer, 5601 Sunnyside... Office of Technology Transfer at the Beltsville address given above; telephone: 301-504-5989...
75 FR 35096 - Federal Employees' Retirement System; Present Value Factors
2010-06-21
... by the Board of Actuaries of the Civil Service Retirement System. DATES: The revised present value.... ADDRESSES: Send requests for actuarial assumptions and data to the Board of Actuaries, care of Gregory Kissel, Actuary, Office of Planning and Policy Analysis, Office of Personnel Management, Room 4307, 1900...
76 FR 43651 - Forestry Research Advisory Council
2011-07-21
... send their names and proposals by August 1, 2011 to Daina Apple, Designated Federal Officer, Forestry... INFORMATION CONTACT: Daina Apple, Forest Service Office of the Deputy Chief for Research and Development, (202) 205-1665. SUPPLEMENTARY INFORMATION: The meeting is open to the public. Council discussion is limited...
2010-04-27
... Hancock Avenue Athens, Georgia 30601-2768 (706) 546-2164 TDD (706) 546-2034 Dawn Pilgrim Hawaii State Office (Services all Hawaii, American Samoa, Guam, and Western Pacific) Room 311, Federal Building 154 Waianuenue Avenue Hilo, Hawaii 96720 (808) 933-8300 TDD (808) 933-8321 Gayle Kuheana Idaho State Office Suite...
International Nuclear Information System (INIS)
2001-01-01
Full text: Vienna/Nairobi - Mohamed ElBaradei, the Director-General of the International Atomic Energy Agency (IAEA) and Klaus Toepfer, Executive Director of the United Nations Environment Programme (UNEP), have agreed to consider ways and means to respond to requests for fact-finding missions to Bosnia-Herzegovina, the Federal Republic of Yugoslavia and Iraq where depleted uranium (DU) was used during military conflicts. The two organizations will co-ordinate their action with the World Health Organization, which has recently decided to send a team to study the health effects of depleted uranium in Iraq, as well as with other relevant UN system organizations. Pekka Haavisto, Chairman of UNEP's Depleted Uranium Assessment Team, is meeting today with UN officials in Sarajevo for consultations on a possible future mission to Bosnia-Herzegovina. Mr. Haavisto will visit Belgrade tomorrow to meet with officials of the Federal Republic of Yugoslavia. The IAEA is considering holding a training course to improve the understanding and skills of specialist staff from concerned countries. The main focus will be on measurement methods and the assessment of risks from depleted uranium and other radioactivity. The possibility of sending fact-finding missions to Bosnia-Herzegovina, the Federal Republic of Yugoslavia and Iraq follows last year's mission to Kosovo by the UNEP-led DU Assessment Team. UNEP will wait for the scientific findings of the report of the Kosovo mission, expected to be released in early March, before it embarks on new DU field assessments. (author)
Mansfield, Richard
2010-01-01
A comprehensive guide to the language used to customize Microsoft Office. Visual Basic for Applications (VBA) is the language used for writing macros, automating Office applications, and creating custom applications in Word, Excel, PowerPoint, Outlook, and Access. This complete guide shows both IT professionals and novice developers how to master VBA in order to customize the entire Office suite for specific business needs.: Office 2010 is the leading productivity suite, and the VBA language enables customizations of all the Office programs; this complete guide gives both novice and experience
Walkenbach, John; Groh, Michael R
2010-01-01
The best of the best from the bestselling authors of Excel, Word, and PowerPoint Bibles !. Take your pick of applications from the Office 2010 suite and your choice of leading experts to show you how to use them. This Office 2010 Bible features the best-of-the-best content from the Excel 2010 Bible , by "Mr. Spreadsheet" John Walkenbach; the Word 2010 Bible by Microsoft MVP Herb Tyson; the PowerPoint 2010 Bible , by PowerPoint expert Faithe Wempen; and coverage of Access 2010 from Microsoft MVP Michael Alexander. If you want to quickly and effectively begin using Office 2010, start i
Office Space: How Will Technology Affect the Education Office Environment?
Day, C. William
2009-01-01
The office environment 10 years from now will be different from the one today. More office personnel will be organized around processes rather than functions. More work activities will be done by teams rather than individuals, and those teams will change over time, as will the nature of the work projects and the people who constitute the team. The…
49 CFR 1325.3 - Federal office.
2010-10-01
... 49 Transportation 9 2010-10-01 2010-10-01 false Federal office. 1325.3 Section 1325.3... FEDERAL OFFICE OR THEIR REPRESENTATIVES § 1325.3 Federal office. For the purposes of this section, Federal office means the office of President or Vice President of the United States; or of Senator or...
75 FR 39289 - Submission for OMB Review; Comment Request
2010-07-08
... Securities and Exchange Commission (the ``Commission'') has submitted to the Office of Management and Budget...) the investment company's assets and liabilities, (iv) the events leading to the request to deregister... Management and Budget, Room 10102, New Executive Office Building, Washington, DC 20503 or send an e-mail to...
2013-09-05
... Other Bad Actors Disclosure Statement,'' to the Office of Management and Budget (OMB) for review and... Management and Budget, Room 10102, New Executive Office Building, Washington, DC 20503, or by sending an... may have the impression that Rule 506 offerings occurring after the effective date of the rule...
76 FR 34070 - Secretary of Energy Advisory Board, Natural Gas Subcommittee
2011-06-10
... INFORMATION CONTACT: Renee Stone, Deputy Designated Federal Officer, U.S. Department of Energy, 1000... insufficient time to address the committee are invited to send a written statement to Renee Stone, U.S... June 6, 2011. LaTanya R. Butler, Acting Deputy Committee Management Officer. [FR Doc. 2011-14438 Filed...
76 FR 32243 - Federal Employees' Retirement System; Present Value Factors
2011-06-03
... adopted by the Board of Actuaries of the Civil Service Retirement System. DATES: The revised present value.... ADDRESSES: Send requests for actuarial assumptions and data to the Board of Actuaries, care of Gregory Kissel, Actuary, Office of Planning and Policy Analysis, Office of Personnel Management, Room 4307, 1900...
2013-08-29
..., until October 15, 2013. ADDRESSES: Send written comments to the BLM Field Manager, Carlsbad Field Office... include classrooms, gymnasiums, parking lots, etc. The middle school will also include a football field... to do so. Only written comments submitted to the Field Manager, BLM Carlsbad Field Office, will be...
2013-10-24
... business hours at the office below. Send your comments or requests by any one of the following methods... drop-off: You may drop off information during regular business hours at the above office address. FOR... existence of federally listed fish, wildlife, or plants. Applicant's Proposal The applicant is requesting...
2013-04-05
... business hours at the office below. Send your comments or requests by any one of the following methods...-person drop-off: You may drop off information during regular business hours at the above office address... criteria, an incidental take permit's proposed actions must not jeopardize the existence of federally...
Directory of Open Access Journals (Sweden)
Amy L Lee
Full Text Available Expanded polyglutamine repeats in different proteins are the known determinants of at least nine progressive neurodegenerative disorders whose symptoms include cognitive and motor impairment that worsen as patients age. One such disorder is Huntington's Disease (HD that is caused by a polyglutamine expansion in the human huntingtin protein (htt. The polyglutamine expansion destabilizes htt leading to protein misfolding, which in turn triggers neurodegeneration and the disruption of energy metabolism in muscle cells. However, the molecular mechanisms that underlie htt proteotoxicity have been somewhat elusive, and the muscle phenotypes have not been well studied. To generate tools to elucidate the basis for muscle dysfunction, we engineered Caenorhabditis elegans to express a disease-associated 513 amino acid fragment of human htt in body wall muscle cells. We show that this htt fragment aggregates in C. elegans in a polyglutamine length-dependent manner and is toxic. Toxicity manifests as motor impairment and a shortened lifespan. Compared to previous models, the data suggest that the protein context in which a polyglutamine tract is embedded alters aggregation propensity and toxicity, likely by affecting interactions with the muscle cell environment.
Teach yourself visually Office 2013
Marmel, Elaine
2013-01-01
Learn the new Microsoft Office suite the easy, visual way Microsoft Office 2013 is a power-packed suite of office productivity tools including Word, Excel, PowerPoint, Outlook, Access, and Publisher. This easy-to-use visual guide covers the basics of all six programs, with step-by-step instructions and full-color screen shots showing what you should see at each step. You'll also learn about using Office Internet and graphics tools, while the additional examples and advice scattered through the book give you tips on maximizing the Office suite. If you learn best when you can see how
2010-01-01
... Communications has responsibility for maintaining the flow of information to the mass communications media... Secretary and the Office of Communications. 1.25 Section 1.25 Agriculture Office of the Secretary of... Secretary and the Office of Communications. (a) For the Office of the Secretary and for the Office of...
Directory of Open Access Journals (Sweden)
A. Cobaleda Cordero
2018-01-01
Full Text Available The Smart Sustainable Offices project (SSO is a product of years of research with large sets of data collected from more than 30 office buildings in Switzerland, Sweden, and Spain. Based on scientific evidence, the concept of SSO, initially conceived as a research plan to address the interdependencies between office users and their working environment in a European context, is now used as a qualitative and quantitative mixed method approach for office diagnosis and ideation. At the current stage, the SSO methodology aims to implement a new paradigm of user-oriented, lower carbon footprint and resilient office design solutions. The main strategy is articulated around the “office DNA” of every organisation, decoded as a compound of work patterns, operational and individual needs, and their potential to define design criteria. The practical application of SSO and its tentative findings exemplified through three pilot test office-demonstrators are described in this paper.
12 CFR 4.4 - Washington office.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Washington office. 4.4 Section 4.4 Banks and... EXAMINERS Organization and Functions § 4.4 Washington office. The Washington office of the OCC is the main office and headquarters of the OCC. The Washington office directs OCC policy, oversees OCC operations...
Antitubercular and Phytochemical Investigation of Methanol Extracts ...
African Journals Online (AJOL)
Erah
Palacios IDP, Luna-Herrera J. Activity against. Drug Resistant-Tuberculosis Strains of Plants used in Mexican Traditional Medicine to treat. Tuberculosis and Other Respiratory Diseases. Phytother. Res. 2008; 22: 82-85. 13. Saludes JP, Garson MJ, Franzblau SG, Aguinaldo. AM. Antitubercular Constituents from the. Hexane ...
International Nuclear Information System (INIS)
1997-08-01
On July 2, 1997 at approximately 6:00 A.M., two operators (Workers 1 and 2), wearing approved personal protective equipment (PPE), began a shredding operation of HEPA filters for volume reduction in Building 513 (B-513) at Lawrence Livermore National Laboratory (LLNL). The waste requisitions indicated they were shredding filters containing ≤ 1 μCi of americium-241 (Am-241). A third operator (Worker 3) provided support to the shredder operators in the shredding area (hot area) from a room that was adjacent to the shredding area (cold area). At Approximately 8:00 A.M., a fourth operator (Worker 4) relieved Worker 2 in the shredding operation. Sometime between 8:30 A.M. and 9:00 A.M., Worker 3 left the cold area to make a phone call and set off a hand and foot counter in Building 514. Upon discovering the contamination, the shredding operation was stopped and surveys were conducted in the shredder area. Surveys conducted on the workers found significant levels of contamination on their PPE and the exterior of their respirator cartridges. An exit survey of Worker 1 was conducted at approximately 10:05 A.M., and found contamination on his PPE, as well as on the exterior and interior of his respirator. Contamination was also found on his face, chest, back of neck, hair, knees, and mustache. A nose blow indicated significant contamination, which was later determined to be curium-244
2010-07-01
... document with your current legal name and address. For example, you might send a bank or financial... to ORA such as the signed statements of two or more people with personal knowledge of the death... address. For example, you might send a bank or financial statement or a monthly utility bill. Submit...
Hill, E. Jeffrey; Ferris, Maria; Martinson, Vjollca
2003-01-01
A comparison was made of IBM employees in traditional offices (n=4,316), virtual offices (n=767), and home offices (n=441). Home office teleworking helped balance work and family and enhanced business performance with cost savings. Virtual office teleworking was associated with less work-family balance and less successful personal/family life.…
2013-03-05
... Milton Koch, AD/CVD Operations, Office 6, Import Administration, International Trade Administration, U.S... film, sheet, and strip (PET Film) from Taiwan.\\1\\ The period of review covered July 1, 2010, through... an incorrect case number associated with PET Film from Taiwan (i.e., incorrect case number A-533-824...
Fermilab Education Office: Science Adventures
Search The Education Office: Science Adventures Adventure Catalog Search for Adventures Calendar Class Facebook Group. Contact: Science Adventures Registrar, Education Office Fermilab, MS 777, P.O. Box 500 it again." Opportunities for Instructors The Education Office has openings for instructors who
78 FR 68442 - Sunshine Act Meeting; Open Commission Meeting; Thursday, November 14, 2013
2013-11-14
.... a new FCC Speed Test App for Android smartphones. This crowdsourcing app will expand the Measuring... implementation. 3 OFFICE OF ENGINEERING & TITLE: Expanding Measuring Broadband TECHNOLOGY AND OFFICE OF America.... Send an email to: [email protected]fcc.gov or call the Consumer & Governmental Affairs Bureau at 202-418-0530...
32 CFR 807.1 - General requirements.
2010-07-01
... Libraries for public use according to AFR 4-61. They will also advise requesters that these libraries are... disclosure policy office and to HQ USAF/CVAII, Washington DC 20330-5000. Also send information copies of such requests to the base public affairs office. Commands will supplement this requirement to include policies...
Office 2010 all-in-one for dummies
Weverka, Peter
2010-01-01
The leading book on Microsoft Office, now fully updated for Office 2010 Microsoft Office, the world's leading productivity suite, has been updated with new tools. Veteran Office users as well as newcomers will need the comprehensive information in this bestselling All-in-One guide. With a self-contained minibook devoted to each Office application plus minibooks on how Office works together and how you can expand its usefulness, Office 2010 All-in-One For Dummies gets you up to speed and answers the questions you'll have down the road.Microsoft Office is the office pro
Shedlin, Michele G; Decena, Carlos U; Noboa, Hugo; Betancourt, Óscar
2014-02-01
This study explored factors affecting the health and well being of recent refugees from Colombia in Ecuador. Data collection focused on how sending-country violence and structural violence in a new environment affect immigrant health vulnerability and risk behaviors. A qualitative approach included ethnographic observation, media content analysis, focus groups, and individual interviews with refugees (N = 137). The focus groups (5) provided perspectives on the research domains by sex workers; drug users; male and female refugees; and service providers. Social and economic marginalization are impacting the health and well being of this growing refugee population. Data illustrate how stigma and discrimination affect food and housing security, employment and health services, and shape vulnerabilities and health risks in a new receiving environment. Widespread discrimination in Ecuador reflects fears, misunderstanding, and stereotypes about Colombian refugees. For this displaced population, the sequelae of violence, combined with survival needs and lack of support and protections, shape new risks to health and well-being.
2010-07-01
... Palestinian Authority Presidency, including only the Office of the President, Presidential Security, General Intelligence Apparatus, Governors and Governorate staff, the Attorney General's Office, the Palestine... Information Services); (2) The Palestinian Judiciary, including the Higher Judicial Council; (3) Members of...
International Nuclear Information System (INIS)
Williford, R.E.; Mohr, C.L.; Lanning, D.D.; Cunningham, M.E.; Rausch, W.N.
1980-06-01
The effects of the thermally-induced cracking and subsequent relocation of UO2 fuel pellets on the thermal and mechanical behavior of light-water reactor fuel rods during irradiation are quantified in this report. Data from the Nuclear Regulatory Commission/Pacific Northwest Laboratory Halden experiments on instrumented fuel assemblies (IFA) IFA-431, IFA-432, and IFA-513 are analyzed. Beginning-of-life in-reactor measurements of fuel center temperatures, linear heat ratings, and cladding axial elongations are used in a new model to solve for the effective thermal conductivity and elastic moduli of the cracked fuel column. The primary assumptions of the new model are that (1) the cracked fuel is in a hydrostatic state of stress in the (r,theta) plane, and that (2) there is no axial slipping between fuel and cladding. Three basic parameters are used to describe the cracked fuel: (1) the crack pattern, (2) the crack roughness, and (3) the fuel surface (gap) roughness. Recommendations are made on refining the model
Instructed officers Radiation Protection
International Nuclear Information System (INIS)
2007-01-01
This law contains instructions on the prevention of radiological and contains 4 articles Article I: describe the responsibilities of the institutions that operate within the scope of radiological protection in terms of the number of radiation protection officers and personal Supervisors who available in the practices radiation field. Article II: talking about the conditions of radiation protection officers that must be available in the main officers and working field in larg institutions and thecondition of specific requirements for large enterprises of work permits in the field of radiological work that issued by the Council. Article III: the functions and duties of officers in the prevention of radiological oversee the development of radiation protection programmes in the planning stages, construction and preparing the rules of local labour and what it lead of such tasks.Article IV: radiation protection officers powers: to modify and approve the programme of prevention and radiation safety at the company, stop any unsafe steps, amend the steps of the usage, operation of materials, devices and so on
Ergonomics in the office environment
Courtney, Theodore K.
1993-01-01
Perhaps the four most popular 'ergonomic' office culprits are: (1) the computer or visual display terminal (VDT); (2) the office chair; (3) the workstation; and (4) other automated equipment such as the facsimile machine, photocopier, etc. Among the ergonomics issues in the office environment are visual fatigue, musculoskeletal disorders, and radiation/electromagnetic (VLF,ELF) field exposure from VDT's. We address each of these in turn and then review some regulatory considerations regarding such stressors in the office and general industrial environment.
7 CFR 2003.14 - Field Offices.
2010-01-01
...) ADMINISTRATIVE REGULATIONS ORGANIZATION Functional Organization of the Rural Development Mission Area § 2003.14... Office Program Directors. State Directors may organizationally structure their offices based on the... tier program delivery structure. In a three tier system, Local offices report to an Area office, that...
2010-09-14
... DEPARTMENT OF EDUCATION Office of Special Education Programs, Office of Special Education and Rehabilitative Services, Department of Education; Notice of Final Extension of Project Period and Waiver for the... Transition Technical Assistance Center (NSTTAC). Currently, the Office of Special Education Programs (OSEP...
21 CFR 807.87 - Information required in a premarket notification submission.
2010-04-01
... § 807.93. (i) A financial certification or disclosure statement or both, as required by part 54 of this... class III under section 513(b) of the act: (1) Which was introduced or delivered for introduction into.... (Information collection requirements in this section were approved by the Office of Management and Budget (OMB...
Analytical Studies of Three-Dimensional Combustion Processes
1989-05-01
Include Area Code) 22c OFFICE SYMBOL Raghunath S. Boray 513-255-9991 WRDC/POPT DD Form 1473, JUN 86 Previous editions are obsolete. SECURITY...enthalpy, and momentum are calculated for each finite volume by summing the contributions from all groups of droplets. Thus, ( Sm )i,J N ((PpM-p)in
Owen Barwell - Chief Financial Officer | NREL
Owen Barwell - Chief Financial Officer Owen Barwell - Chief Financial Officer A photo of Owen , analysis, and management. He previously served as the Acting Chief Financial Officer and Deputy Chief Financial Officer of the U.S. Department of Energy (DOE), where he was directly responsible for DOE's
77 FR 3506 - Copyright Office Fees
2012-01-24
... creativity. The copyright law itself is designed to promote and protect authorship and this includes... LIBRARY OF CONGRESS Copyright Office [Docket No. 2012-1] Copyright Office Fees AGENCY: Copyright Office, Library of Congress. ACTION: Notice of Inquiry; Fees. SUMMARY: The U.S. Copyright Office is in...
Office design's impact on sick leave rates.
Bodin Danielsson, Christina; Chungkham, Holendro Singh; Wulff, Cornelia; Westerlund, Hugo
2014-01-01
The effect of office type on sickness absence among office employees was studied prospectively in 1852 employees working in (1) cell-offices; (2) shared-room offices; (3) small, (4) medium-sized and (5) large open-plan offices; (6) flex-offices and (7) combi-offices. Sick leaves were self-reported two years later as number of (a) short and (b) long (medically certified) sick leave spells as well as (c) total number of sick leave days. Multivariate logistic regression analysis was used, with adjustment for background factors. A significant excess risk for sickness absence was found only in terms of short sick leave spells in the three open-plan offices. In the gender separate analysis, this remained for women, whereas men had a significantly increased risk in flex-offices. For long sick leave spells, a significantly higher risk was found among women in large open-plan offices and for total number of sick days among men in flex-offices. A prospective study of the office environment's effect on employees is motivated by the high rates of sick leaves in the workforce. The results indicate differences between office types, depending on the number of people sharing workspace and the opportunity to exert personal control as influenced by the features that define the office types.
McNamara, William J; Lam, Patrick H; Murrell, George A C
2016-11-16
Retear and stiffness are not uncommon outcomes of rotator cuff repair. The purpose of this study was to evaluate the relationship between rotator cuff repair healing and shoulder stiffness. A total of 1,533 consecutive shoulders had an arthroscopic rotator cuff repair by a single surgeon. Patients assessed their shoulder stiffness using a Likert scale preoperatively and at 1, 6, 12, and 24 weeks (6 months) postoperatively, and examiners evaluated passive range of motion preoperatively and at 6, 12, and 24 weeks postoperatively. Repair integrity was determined by ultrasound evaluation at 6 months. After rotator cuff repair, there was an overall significant loss of patient-ranked and examiner-assessed shoulder motion at 6 weeks compared with preoperative measurements (p rotator cuff integrity at 6 months postoperatively (r = 0.11 to 0.18; p rotation at 6 weeks postoperatively was 7%, while the retear rate of patients with >20° of external rotation at 6 weeks was 15% (p rotator cuff repair was more likely to heal. Therapeutic Level III. See Instructions for Authors for a complete description of levels of evidence. Copyright © 2016 by The Journal of Bone and Joint Surgery, Incorporated.
Lee, Sangbok; Park, Myoung Hwan; Jeong, Byung Yong
2018-06-01
This study investigates differences between male and female public office workers' satisfaction levels, sick building syndrome (SBS) symptoms and musculoskeletal disorder (MSD) complaints in workplace and office environments. Questionnaire surveys were performed in 30 offices from 15 public institutions. Male and female workers of the same age were coupled and selected from each office, gathering a total of 120 male and 120 female subjects. The results show that differences exist between genders in noise and lighting satisfaction levels, SBS-related symptoms (eye, nose, skin) and MSD complaints of hand/wrist/finger, while there is no difference in overall satisfaction level of office environments. The study also suggests that office design for public office workers should take into account gender differences in preventing MSDs and also SBS. The findings of this study are expected to serve as basic data for designing effective public office environments.
2010-09-14
... DEPARTMENT OF EDUCATION Office of Special Education Programs, Office of Special Education and Rehabilitative Services, Department of Education; Notice of Final Extension of Project Period and Waiver for the... this award, the Office of Special Education Programs (OSEP) funds NCEO to address national, State, and...
76 FR 34071 - Secretary of Energy Advisory Board, Natural Gas Subcommittee; Meeting
2011-06-10
... INFORMATION CONTACT: Renee Stone, Deputy Designated Federal Officer, U.S. Department of Energy, 1000... address the committee are invited to send a written statement to Renee Stone, U.S. Department of Energy.... LaTanya R. Butler, Acting Deputy Committee Management Officer. [FR Doc. 2011-14439 Filed 6-9-11; 8:45 am...
2010-07-01
... receipt, the disbursing officer will furnish the Navy Finance Center, Cleveland, Ohio 44199, with the decedent's basic monthly pay [plus any special (see § 716.1), incentive, and proficiency pay] in the event... there. The CACP officer shall also send a copy of his message to the Navy Finance Center with the...
NOAA Workforce Management Office
Management Fellows (PMFs) Program Coordination Office - Leadership Development Program (PCO-LDP) Employee (NRAP) Presidential Management Fellows (PMFs) Program Coordination Office - Leadership Development ) NOAA Leadership Seminar (NLS) NOAA Rotational Assignment Program (NRAP) Presidential Management Fellows
Department of Housing and Urban Development — HUD is organized in 10 Regions. Each Region is managed by a Regional Administrator, who also oversees the Regional Office. Each Field Office within a Region is...
12 CFR 561.39 - Principal office.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Principal office. 561.39 Section 561.39 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY DEFINITIONS FOR REGULATIONS AFFECTING ALL SAVINGS ASSOCIATIONS § 561.39 Principal office. The term principal office means the home...
48 CFR 908.7103 - Office machines.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Office machines. 908.7103... PLANNING REQUIRED SOURCES OF SUPPLIES AND SERVICES Acquisition of Special Items 908.7103 Office machines. Acquisitions of office machines by DOE offices and its authorized contractors shall be in accordance with FPMR...
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Office. 300.9 Section 300.9 Housing... NATIONAL MORTGAGE ASSOCIATION, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT GENERAL § 300.9 Office. The Association directs its operations from its office located at 451 Seventh Street, SW., Washington DC 20410. ...
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Dual office. 7.17 Section 7.17 Agriculture Office of... STATE, COUNTY AND COMMUNITY COMMITTEES § 7.17 Dual office. (a) County committee membership. A member of... any other county office employee. (b) Community committee membership. A member of the community...
31 CFR 50.2 - Responsible office.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Responsible office. 50.2 Section 50.2 Money and Finance: Treasury Office of the Secretary of the Treasury TERRORISM RISK INSURANCE PROGRAM General Provisions § 50.2 Responsible office. The office responsible for the administration of the...
2012-05-25
... of May 21, 2012 Designation of Officers of the Millennium Challenge Corporation To Act as Chief Executive Officer of the Millennium Challenge Corporation Memorandum for the Chief Executive Officer of the... following officers of the Millennium Challenge Corporation (MCC), in the order listed, shall act as and...
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false State office. 90.19 Section 90.19...¢ Training ⢠Officers ⢠Prosecutors) Violence Against Women Formula Grant Program § 90.19 State office. (a... office for the purposes of: (1) Certifying qualifications for funding under this subpart B; (2...
International Nuclear Information System (INIS)
Joyce, James A.
1988-01-01
During the past three years a test method has been developed for dynamic testing of fracture mechanics specimens which is specifically designed for application to the upper transition temperature range. The method uses drop tower loading rates of 2.5 m/sec and obtains a J IC or a J-R curve using an analytical key curve approach verified by initial and final crack length measurements obtained from the fracture surface. A J-R curve is obtained from each specimen and contains crack growth corrections so that it is directly comparable with static results obtained in accordance with the ASTM E1152 J-R curve test method. The test procedure has been applied to A106 steel, A533B steel and US Navy HY80 and HY100 steels at temperatures from -200F to 150F. Standard 1T three point bend specimens were used for the A533B and the HY100 steel. Static test results have shown that the J at cleavage initiation (which is presently an unstandardized quantity) is specimen a/W independent throughout the ductile to brittle transition but of course demonstrates considerable statistical scatter in the vicinity of the ductile upper shelf. Dynamic J-R tests have shown an increase in J IC with test rate for most, but not for all, materials. Separation of J into elastic and plastic components shows that the elastic J component increases with test rate in a fashion consistent with the materials tensile sensitivity to test rate but the plastic J component decreases with test rate - an apparent visco-plastic phenomena. For A106 steel the plastic J decrease exceeds the elastic J increase and the upper shelf toughness falls - while the other materials have demonstrated a relatively larger increase in the elastic J component and a smaller decrease in the plastic J component giving an overall increase in upper shelf toughness. Separation of the J integral into elastic and plastic components has demonstrated that J EL is specimen scale and geometry dependent while J PL is relatively scale and geometry
Office of the Chief Financial Officer Strategic Plan2008-2012
Energy Technology Data Exchange (ETDEWEB)
Various
2007-11-19
This is an update to the Office of the Chief Financial Officer's (OCFO's) multi-year strategy to continue to build a highly effective, efficient and compliant financial and business approach to support the scientific mission of Lawrence Berkeley National Laboratory (LBNL). The guiding principles of this strategy are to provide the greatest capability for the least cost while continually raising the standards of professional financial management in service to the LBNL science mission.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Offices. 2.3 Section 2.3 Postal Service UNITED STATES POSTAL SERVICE THE BOARD OF GOVERNORS OF THE U.S. POSTAL SERVICE GENERAL AND TECHNICAL PROVISIONS (ARTICLE II) § 2.3 Offices. The principal office of the Postal Service is located in Washington, DC, with...
Prof. M. G. K. Menon | History | About IASc | Indian Academy of ...
Indian Academy of Sciences (India)
... DRDO 74-78; CSIR: Director General 78-81; Department of Environment: Secy. 80-81; DST: Secy. 78-82; Commission for Additional Sources of Energy: Chairman 81-82; Science Advisory Committee to the Cabinet: Chairman 82-85; Scientific Advisor to Prime Minister 86-89; Planning Commission Member 82-89; Minister ...
75 FR 25913 - Alternative Transportation in Parks and Public Lands Program
2010-05-10
... headquarters office to coordinate the availability of funds to that unit. National Park Service: Mark H Hartsoe, Mark_H[email protected] ; tel: 202-513-7025, fax: 202-371-6675, mail: 1849 C Street, NW., (MS2420....; Washington, DC 20250-1101. Bureau of Land Management: Victor F. Montoya, Victor_Montoya@blm.gov , tel: 202...
Natural phenomena evaluation of the Department of Energy-field office Oak Ridge office buildings
International Nuclear Information System (INIS)
Rucker, R.W.; Fricke, K.E.; Hunt, R.J.
1991-01-01
The Department of Energy - Field Office Oak Ridge (DOE-OR) is performing natural phenomena evaluations of existing office buildings located in the city of Oak Ridge, Tennessee. The natural phenomena considered are earthquake, wind, and flood. The evaluations are being performed to determine if the facilities are in compliance with DOE General Design Criteria 6430.IA. This paper presents results of the evaluations for three of the office buildings
2012-03-22
...This notice advises the public that the HUD/OIG Office of Investigation plans to reclassify its Denver, Colorado field office as a regional office. The planned reorganization is intended to: 1. Improve the alignment of limited investigative resources, to promote more efficient responses to HUD or Congressional requests involving critical program issues; 2. Redeploy resources to prevent and detect fraud in new program delivery of CPD, FHA and other HUD programs; and 3. Improve management control and effectiveness, and reduce travel costs of management by reducing region size. 4. Return to the traditional Regional alignment of HUD OIG Regional offices and HUD Regional offices.
Using Office 365 with Windows 8
Wilson, Kevin
2014-01-01
Learn Office the easy way, no jargon. Clear, concise and to the point... Using Microsoft Office 365, is the essential step by step guide to getting the most out of the traditional Microsoft Office applications (not SharePoint), providing a complete resource for both the beginner and the enthusiast.Techniques are illustrated step-by-step using photography and screen prints throughout, together with concise, easy to follow text from an established expert in the field, provide a comprehensive guide to office applications. Whether you are new to Microsoft Office, an experienced user or studying a
International Nuclear Information System (INIS)
Adi Abimanyu; Nurhidayat; Jumari
2013-01-01
Aspects of safety and security of radioactive substances from the sender to the receiver is to be secured for not to harm humans. In general, monitoring the transport of radioactive materials is done by communication with a telephone conversation to determine the location and rate of exposure radioactive substances. From the aspect of safety, communication through telephone conversations easily interpreted by others, in addition the possibility of human-error is quite high. SMS service is known for its ease in terms of use so that SMS can be used as a substitute for communication through telephone conversations to monitor the rate of radiation exposure and the position of radioactive substances in the transport of radioactive substances. The system monitors the transport of radioactive materials developed by implement vigenere algorithms using a microcontroller for sending SMS (Short Message Service) to communicate. Tests was conducted to testing encryption and description and computation time required. From the test results obtained they have been successfully implemented vigenere algorithm to encrypt and decrypt the messages on the transport of radioactive monitoring system and the computational time required to encrypt and decrypt the data is 13.05 ms for 36 characters and 13.61 for 37 characters. So for every single character require computing time 0.56 ms. (author)
International Nuclear Information System (INIS)
Krompholz, K.; Ullrich, G.
1985-01-01
J-integral experiments at room temperature were performed on three point bend type specimens of the nuclear pressure vessel material A 533 B1 with a/w-ratios of 0.3 and 0.5. Following the ASTM-proposal for the multi-specimen technique a value is obtained close to the value obtained in the HSST round robin test. On the other hand, from the measurement of the Jsub(IC)-value by means of the potential drop technique there is an indication that a lower value of Jsub(IC) is correct. This is in agreement with the multi-specimen technique using linear regression lines without excluding 'invalid' points. That is reasonable if fractographic investigations gives clear indications that stable crack growth has occurred as is the case in this work. (Auth.)
Kennedy, Emma-Kate
2015-01-01
A key principle upon which the Revised Special Educational Needs and Disability (SEND) Code of Practice 0-25 (2015) is based is children's involvement in decision-making that affects them, and a significant change is the removal of the term "behaviour" and an emphasis on social, emotional and mental health (SEMH) needs. To ensure that…
Behrens, Susan
2013-01-01
A colleague can't make a coffee date at a time the author proposes because it would conflict with his office hour. No student has actually made an appointment with him during the hour, but he is committed to being in his office as promised in case someone drops by. The author's reaction to her colleague's faithfulness to his posted office hour…
2011-10-21
... Governmentwide Policy; Office of Federal High- Performance Green Buildings; the Green Building Advisory Committee... meeting of the Green Building Advisory Committee Meeting (the Committee). The meeting is open to the..., Office of Federal High-Performance Green Buildings, Office of Governmentwide Policy, General Services...
From Four to Two: Transformation of the Army Ordnance Officer and Warrant Officer Corps
National Research Council Canada - National Science Library
Napier, Joyce
2003-01-01
.... This study will examine how senior leaders within the Army and specifically the Ordnance Corps must change the officer and warrant officer force structure education system and leader development...
76 FR 30984 - Submission for OMB Review; Comment Request
2011-05-27
... registered with the Commission; The Securities Industry Automation Corporation (``SIAC'') and The Nasdaq... 10102, New Executive Office Building, Washington, DC 20503 or by sending an e-mail to: Shagufta_Ahmed...
Holland, Walter
2013-01-01
This complete training package makes learning the new Office 2013 even easier! Featuring both a video training DVD and a full-color book, this training package is like having your own personal instructor guiding you through each lesson of learning Office 2013, all while you work at your own pace. The self-paced lessons allow you to discover the new features and capabilities of the new Office suite. Each lesson includes step-by-step instructions and lesson files, and provides valuable video tutorials that complement what you're learning and clearly demonstrate how to do tasks. This essential
2013-04-30
... Office of Preparedness and Emergency Operations (ANC), establish five Divisions under the Office of Preparedness and Emergency Operations (ANC), and rename one existing Division. The changes are as follows. I..., Paragraph C, Office of Preparedness and Emergency Operations (ANC): a. Replace all references to the...
Office type's association to employees' welfare: Three studies.
Danielsson, Christina Bodin
2016-08-12
The workplace is important for employees' daily life and well-being. This article investigates exploratory the office design's role for employees' welfare from different perspectives. By comparing different studies of the office, type's influence on different factors of employees' welfare the aim is to see if any common patterns exist in office design's impact. The three included studies investigate office type's association with employees' welfare by measuring its influence on: a) perception of leadership, b) sick leave, and c) job satisfaction.The sample consists of office employees from a large, national representative work environment survey that work in one of the seven identified office types in contemporary office design: (1) cell-offices; (2) shared-room offices; (3) small, (4) medium-sized and (5) large open-plan offices; (6) flex-offices and (7) combi-offices. Statistical method used is multivariate logistic and linear regression analysis with adjustment for background factors. Overall results show that shared-room office, traditional open plan offices and flex-office stand out negatively, but to different degree(s) on the different outcomes measured. This explorative comparison of different studies finds a pattern of office types that repeatedly show indications of negative influence on employees' welfare, but further studies are needed to clarify this.
2004-01-01
http://www.cern.ch/cern50/ The French Post Office has issued ten commemorative envelopes bearing original images depicting CERN and its history. This special fiftieth anniversary collector's edition will be available on the French Post Office (« La Poste ») stand at the Open Day on 16 October, in the CMS experiment hall at Cessy. Information for collectors: a pictorial postmark and date stamp have been specially designed and produced for the occasion with the assistance of CERN's graphics team. Sending a philatelic souvenir is a great way to commemorate the Open Day, so La Poste will be setting up a large post-box for that very purpose next to its stand. A perfect way to send images of CERN all around the world...
Office of Equal Opportunity Programs
Chin, Jennifer L.
2004-01-01
The NASA Glenn Office of Equal Opportunity Programs works to provide quality service for all programs and/or to assist the Center in becoming a model workplace. During the summer of 2004, I worked with Deborah Cotleur along with other staff members to create and modify customer satisfaction surveys. This office aims to assist in developing a model workplace by providing functions as a change agent to the center by serving as an advisor to management to ensure equity throughout the Center. In addition, the office serves as a mediator for the Center in addressing issues and concerns. Lastly, the office provides assistance to employees to enable attainment of personal and organizational goals. The Office of Equal Opportunities is a staff office which reports and provides advice to the Center Director and Executive Leadership, implements laws, regulations, and presidential executive orders, and provides center wide leadership and assistance to NASA GRC employees. Some of the major responsibilities of the office include working with the discrimination complaints program, special emphasis programs (advisory groups), management support, monitoring and evaluation, contract compliance, and community outreach. During my internship in this office, my main objective was to create four customer satisfaction surveys based on EO retreats, EO observances, EO advisory boards, and EO mediation/counseling. I created these surveys after conducting research on past events and surveys as well as similar survey research created and conducted by other NASA centers, program for EO Advisory group members, leadership training sessions for supervisors, preventing sexual harassment training sessions, and observance events. I also conducted research on the style and format from feedback surveys from the Marshall Equal Opportunity website, the Goddard website, and the main NASA website. Using the material from the Office of Equal Opportunity Programs at Glenn Research Center along with my
Automated Office Blood Pressure Measurement.
Myers, Martin G
2018-04-01
Manual blood pressure (BP) recorded in routine clinical practice is relatively inaccurate and associated with higher readings compared to BP measured in research studies in accordance with standardized measurement guidelines. The increase in routine office BP is the result of several factors, especially the presence of office staff, which tends to make patients nervous and also allows for conversation to occur. With the disappearance of the mercury sphygmomanometer because of environmental concerns, there is greater use of oscillometric BP recorders, both in the office setting and elsewhere. Although oscillometric devices may reduce some aspects of observer BP measurement error in the clinical setting, they are still associated with higher BP readings, known as white coat hypertension (for diagnosis) or white coat effect (with treated hypertension). Now that fully automated sphygmomanometers are available which are capable of recording several readings with the patient resting quietly, there is no longer any need to have office staff present when BP is being recorded. Such readings are called automated office blood pressure (AOBP) and they are both more accurate than conventional manual office BP and not associated with the white coat phenomena. AOBP readings are also similar to the awake ambulatory BP and home BP, both of which are relatively good predictors of cardiovascular risk. The available evidence suggests that AOBP should now replace manual or electronic office BP readings when screening patients for hypertension and also after antihypertensive drug therapy is initiated. Copyright © 2018. The Korean Society of Cardiology.
78 FR 48898 - Receipt of Applications for Endangered Species Permits
2013-08-12
... Regional Office (see ADDRESSES section) or send them via electronic mail (email) to: [email protected] scrub lupine (Lupinus aridorum) for the purpose of seed harvesting, germ plasm storage, and germination...
2013-02-26
... 20852- 1448. Send one self-addressed adhesive label to assist the office in processing your requests... of Dockets Management (HFA-305), Food and Drug Administration, 5630 Fishers Lane, rm. 1061, Rockville...
2013-06-20
... 20993-0002. Send one self-addressed adhesive label to assist that office in processing your requests..., 5630 Fishers Lane, Rm. 1061, Rockville, MD 20852. FOR FURTHER INFORMATION CONTACT: Kris Andr[eacute...
The effects of moderate heat stress and open-plan office noise distraction on office work
DEFF Research Database (Denmark)
Witterseh, Thomas; Wyon, David; Clausen, Geo
2002-01-01
Thirty subjects clothed for comfort at 22 deg.C performed simulated office work for 3 hours at 22/26/30 deg.C (7.4 g/kg dry air, i.e. 45/35/28 %RH) in quiet and recorded open-plan office noise (55 dBA) conditions. Warmth decreased perceived air quality (P......Thirty subjects clothed for comfort at 22 deg.C performed simulated office work for 3 hours at 22/26/30 deg.C (7.4 g/kg dry air, i.e. 45/35/28 %RH) in quiet and recorded open-plan office noise (55 dBA) conditions. Warmth decreased perceived air quality (P...
A nuclear medicine information system that allows reporting and sending images through intranet
International Nuclear Information System (INIS)
Anselmi, C.E.; Anselmi, O.E.
2002-01-01
A nuclear medicine information system that allows reporting and sending images through intranet. Aim: This system was developed in order to improve the processes of typing, correcting, verifying and distribution of the reports and images, improving the efficiency of the personnel in the nuclear medicine department and reducing the time between the creation of the report and its reading by the referring physician. Materials and Methods: The system runs a web server (Personal Web Server, Microsoft) which serves web pages written in hypertext markup language (HTML) and active server pages (ASP). The database utilized is Microsoft Access 97. The whole communication between the web server and the database is performed by the programs written in ASP. Integrating the images from the patients is done through a 486 ibm-pc running Red Hat Linux, which serves as an intermediary between the isolated nuclear medicine network and the hospital's network. Results: The time from report verification and referring physician reading has decreased from approximately 24 hours to 12 hours. It is possible to run queries in the system in order to get productivity reports or clinical research. Imaging storage allows for correlation of current and previous studies. Conclusion: Bureaucratic processes have diminished to a certain extent in the department. Reports are now online as soon as they are verified by the nuclear medicine physician. There is no need to install dedicated software in the viewing stations since the whole system runs in the server
COMPARATIVE STUDY ON FISCAL-ADMINISTRATIVE SOLICITOR'S OFFICE AND FISCAL SOLICITOR'S OFFICE
OCTAVIA MARIA CILIBIU
2012-01-01
The fiscal-administrative solicitor's office represents the activity of solving litigations between tax payers and the fiscal administration, litigations whose purpose is to cancel totally or partially a fiscal administrative document, document considered by the tax payer harmful for his legitimate right or interest recognized by law. The fiscal solicitor's office represents the activity of solving litigations whose purpose is to cancel or correction of acts of enforcement of tax claims. Rese...
Retrospective Analysis of 513 Cases Diagnosed with Rib Fracture Secondary to Blunt Thorax Trauma
Directory of Open Access Journals (Sweden)
Serdar Ozkan
2017-05-01
Full Text Available Aim: This study aimed to analyze blunt chest trauma cases who were diagnosed with rib fracture and to examine the regional differences likely to appear in trauma cases and treatment approaches. Material and Method: 513 cases who applied to the Emergency Service and Department of Thoracic Surgery between October 2013 and December 2014 due to blunt trauma and were diagnosed with rib fracture were retrospectively examined. The cases were evaluated in terms of etiological factors, thoracic, and other system injuries accompanying the rib fracture, prognosis, and the treatments applied. Results: Isolated rib fracture was present in 266 of the cases. Thoracic organ injuries such as pneumothorax, hemothorax, hemopneumothorax, lung contusion, or laceration and sternal fracture accompanying the rib fracture were present in 247 of the cases. While one or two rib fractures were detected in 298 cases, six or more rib fractures were present in 28 cases. 78.2% of hemothorax cases, 85.3% of pneumothorax cases, 95.4% of hemopneumothorax cases, 81.8% of bilateral pneumothorax cases, 26% of bilateral hemothorax cases, and 71.4% of bilateral hemopneumothorax cases were treated by applying tube thoracostomy. 129 cases diagnosed with thoracic organ injury in addition to rib fracture but not subjected to surgical intervention, and 266 cases diagnosed with isolated rib fracture were discharged with full recovery after appropriate medical treatment. Discussion: Most of the rib fractures occurring due to blunt trauma are treated successfully with medical treatments and conservative approaches and do not need advanced surgical treatments.
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-03-01
With an objective to further improve efficiency of power demand by office automation devices and suppress increase in the power demand, investigations were carried out on the actual power consumption by office automation devices, and discussions were given on energy saving effects in the office automation devices. In the investigations, measurements were conducted for small offices as the subject thereof with regard to electric power consumed by such presentation tools and their peripheral devices as personal computers, word processors, copying machines, facsimile machines, electronic whiteboards and overhead projectors. Power consumption particularly in a standby condition was also investigated. As a result of the investigations, the following characteristics were revealed: the number of office automation devices used to deal with the Energy Star is increasing rapidly; power consumption believed to have been reduced by the Energy Star transferring to lower power consumption is estimated to be 3% in average for personal computers, 26% for copying machines, and 68% for facsimile machines; and while facsimile machines are left in operating condition for 24 hours, their operation rate at night is very low, wherein there is a large room for saving energy in this time band. 65 figs., 21 tabs.
46 CFR 11.505 - Engineer officer structure.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Engineer officer structure. 11.505 Section 11.505... OFFICER ENDORSEMENTS Professional Requirements for Engineer Officer § 11.505 Engineer officer structure. The following diagram illustrates the engineering endorsement structure including cross over points...
The importance of role sending in the sensemaking of change agent roles.
Tucker, Danielle A; Hendy, Jane; Barlow, James
2015-01-01
The purpose of this paper is to investigate what happens when a lack of role-sending results in ambiguous change agent roles during a large scale organisational reconfiguration. The authors consider the role of sensemaking in resolving role ambiguity of middle manager change agents and the consequences of this for organisational restructuring. Data were collected from a case study analysis of significant organisational reconfiguration across a local National Health Service Trust in the UK. Data consists of 82 interviews, complemented by analysis of over 100 documents and field notes from 51 hours of observations collected over five phases covering a three year period before, during and after the reconfiguration. An inductive qualitative analysis revealed the sensemaking processes by which ambiguity in role definition was resolved. The data explains how change agents collectively make sense of a role in their own way, drawing on their own experiences and views as well as cues from other organisational members. The authors also identified the organisational outcomes which resulted from this freedom in sensemaking. This study demonstrates that by leaving too much flexibility in the definition of the role, agents developed their own sensemaking which was subsequently very difficult to manipulate. In creating new roles, management first needs to have a realistic vision of the task and roles that their agents will perform, and second, to communicate these expectations to both those responsible for recruiting these roles and to the agents themselves. Much of the focus in sensemaking research has been on the importance of change agents' sensemaking of the change but there has been little focus on how change agents sensemake their own role in the change.
Empirical Essays on Office Market Dynamics
M.G.J. Jennen (Maarten)
2008-01-01
textabstractOffice buildings are a major investment vehicle, provide a working environment for numerous employees across the globe and determine the skyline of major cities. Put differently: office buildings matter. This dissertation consists of six studies and focuses on office buildings from a
Contact the Office of Communication | News
of Communication Fermilab news Search Useful links Symmetry magazine Interactions Interact Contact the Office of Communication Fermilab's Office of Communication serves as the link between the : 630-840-3351 Fax: 630-840-8780 Office of Communication Fermi National Accelerator Laboratory PO Box
2010-12-23
... Lane, Rockville, MD 20857. Send two self-addressed adhesive labels to assist that office in processing... Fishers Lane, Rm. 1061, Rockville, MD 20852. FOR FURTHER INFORMATION CONTACT: Monica Metz, Center for Food...
Move smoothly to Office 2007 or 2010
CERN. Geneva
2011-01-01
Overview of the user interface of Office 2007 and Office 2010 programs: Word, Excel, Powerpoint and Outlook. Special attention will be drawn to: changes of the user interface as compared with Office 2003, new features that improve user-productivity. At the beginning of the presentation, the demonstrations will focus on Office 2007, which is available on both Windows XP and Windows 7. Towards the end, the demonstrations will focus on Office 2010, which will soon become the default version of Office on Windows 7. Video and slides of the presentation: http://indico.cern.ch/conferenceDisplay.py?confId=95532-->
Office Courtesy: Diferensiasi pada Komunikasi Organisasi
Directory of Open Access Journals (Sweden)
Ulani Yunus
2012-04-01
Full Text Available Office etiquette or office courtesy is a procedure in a person with association or persons outside the organization. Etiquette teaches us to maintain good relations with the person / party. Etiquette becomes an inherent part of an organization because etiquette is not just a tool to assess an appropriate or inappropriate actions of members of the organization, but also the adhesive in the activities of a business transaction; that office image courtesy instrumental in building the organization. Through the courtesy of its contextual office applied through: adjustments to the organizational culture, attitudes toward seniors, standardization attitude towards the stakeholders. Thus, a typical office courtesy can be a differentiation of an organization.
22 CFR 1300.6 - Office location.
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Office location. 1300.6 Section 1300.6 Foreign Relations MILLENNIUM CHALLENGE CORPORATION ORGANIZATION AND FUNCTIONS OF THE MILLENNIUM CHALLENGE CORPORATION § 1300.6 Office location. The principal offices of the Millennium Challenge Corporation are...
Office automation: a look beyond word processing
DuBois, Milan Ephriam, Jr.
1983-01-01
Approved for public release; distribution is unlimited Word processing was the first of various forms of office automation technologies to gain widespread acceptance and usability in the business world. For many, it remains the only form of office automation technology. Office automation, however, is not just word processing, although it does include the function of facilitating and manipulating text. In reality, office automation is not one innovation, or one office system, or one tech...
Office-based Management of Recurrent Respiratory Papilloma.
Motz, Kevin M; Hillel, Alexander T
2016-06-01
This review will highlight the indications and benefits of office-based therapy for recurrent respiratory papillomatosis (RRP) and discuss the utilization of photo-dynamic lasers and adjuvant medical therapy in office-based settings. Office-based management of RRP allows for more timely interventions, is preferred by the majority of patients, and negates the risk of general anesthesia. Current literature argues for the utilization of KTP laser over CO 2 laser for office-based treatment of RRP. Medical therapies for RRP are limited, but agents such as bevacizumab are promising and have been shown to reduce disease burden. Medical therapies that can induce disease remission are still needed. Office-based procedures save time and healthcare expenses compared to like procedures in the operating room. However, the increased frequency for office-based procedures predicts similar overall healthcare costs for office-based and OR laser excision of RRP. Office-based management of RRP is a feasible and well-tolerated strategy in appropriately selected patients with adequate local anesthesia.
Special considerations for hiring an office manager.
Sachs Hills, Laura
2004-01-01
Medical practice office managers come in many varieties. They can be hired from the outside or promoted from within. They can have a great deal of experience working in medical practices or practically none. Which type of office manager is the best choice for your practice? This article will help you decide. It describes three types of office managers and considers the pros and cons of each. It explores the characteristics, advantages, and disadvantages of lay administrators hired from the outside, office managers promoted from the ranks, and "super-aides" who are asked to manage while doing their old jobs. This article also offers a list of 10 characteristics to look for in office manager candidates, as well as six areas of overall responsibility for your office manager. Finally, it includes a quick checklist of 20 required duties of typical medical practice office managers that can help you shape your office manager's job description.
39 CFR 221.4 - Corporate officers.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Corporate officers. 221.4 Section 221.4 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION GENERAL ORGANIZATION § 221.4 Corporate officers. The Board of Governors determines the number of corporate officers and appoints the...
39 CFR 3002.11 - Administrative Office.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Administrative Office. 3002.11 Section 3002.11 Postal Service POSTAL REGULATORY COMMISSION PERSONNEL ORGANIZATION § 3002.11 Administrative Office. (a) The incumbent head of the office is responsible for exercising two executive functions of the...
22 CFR 196.4 - Administering office.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Administering office. 196.4 Section 196.4... AFFAIRS/GRADUATE FOREIGN AFFAIRS FELLOWSHIP PROGRAM § 196.4 Administering office. The Department of State's Bureau of Human Resources, Office of Recruitment is responsible for administering the Thomas R...
49 CFR 10.13 - Privacy Officer.
2010-10-01
... INDIVIDUALS General § 10.13 Privacy Officer. (a) To assist with implementation, evaluation, and administration issues, the Chief Information Officer appoints a principal coordinating official with the title Privacy... 49 Transportation 1 2010-10-01 2010-10-01 false Privacy Officer. 10.13 Section 10.13...
United States Army Officer Professional Development: Black Officers' Perspectives
National Research Council Canada - National Science Library
Johnson, Craig
1997-01-01
.... Even so, they have not fared statistically as well as their majority contemporaries. These statistics pose interesting questions about black officer professional development and career progress...
Becoming an Officer of Consequence
2007-01-01
ndupress .ndu.edu issue 44, 1st quarter 2007 / JFQ 6 Becoming an officer of Consequence m uch of the literature about military history...commander become officers of consequence because their commanders value their judgment and seek their counsel when making difficult choices...COVERED 00-00-2007 to 00-00-2007 4. TITLE AND SUBTITLE Becoming an Officer of Consequence 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM
Teachers' Conceptions about the Genetic Determinism of Human Behaviour: A Survey in 23 Countries
Castéra, Jérémy; Clément, Pierre
2014-01-01
This work analyses the answers to a questionnaire from 8,285 in-service and pre-service teachers from 23 countries, elaborated by the Biohead-Citizen research project, to investigate teachers' conceptions related to the genetic determinism of human behaviour. A principal components analysis is used to assess the main trends in all the interviewed…
7 CFR 2.28 - Chief Financial Officer.
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Chief Financial Officer. 2.28 Section 2.28 Agriculture....28 Chief Financial Officer. (a) The Chief Financial Officer, under the supervision of the Secretary, is responsible for executing the duties enumerated for agency Chief Financial Officers in the Chief...
32 CFR 1602.5 - Area office staff.
2010-07-01
... 32 National Defense 6 2010-07-01 2010-07-01 false Area office staff. 1602.5 Section 1602.5....5 Area office staff. The compensated employees, civilian and military, of the Selective Service System employed in an area office will be referred to as the area office staff. ...
The strategic security officer.
Hodges, Charles
2014-01-01
This article discusses the concept of the strategic security officer, and the potential that it brings to the healthcare security operational environment. The author believes that training and development, along with strict hiring practices, can enable a security department to reach a new level of professionalism, proficiency and efficiency. The strategic officer for healthcare security is adapted from the "strategic corporal" concept of US Marine Corps General Charles C. Krulak which focuses on understanding the total force implications of the decisions made by the lowest level leaders within the Corps (Krulak, 1999). This article focuses on the strategic organizational implications of every security officer's decisions in the constantly changing and increasingly volatile operational environment of healthcare security.
2010-10-01
... designation of a Program/Project Manager as the Contracting Officer's Technical Representative. 301.607-78... Contracting Officer designation of a Program/Project Manager as the Contracting Officer's Technical... acquisition. However, for those individuals serving as a Program or Project Manager under a FAC-P/PM...
Virtuelt skrivebord med open office
DEFF Research Database (Denmark)
Nielsen, Kurt Gammelgaard
2009-01-01
SDUs erfaringer med projektet Port 22: en virtuel platform med Open Office som kontorpakke til studerende.......SDUs erfaringer med projektet Port 22: en virtuel platform med Open Office som kontorpakke til studerende....
2010-07-01
... 32 National Defense 6 2010-07-01 2010-07-01 false Area office. 1602.4 Section 1602.4 National Defense Other Regulations Relating to National Defense SELECTIVE SERVICE SYSTEM DEFINITIONS § 1602.4 Area office. The Selective Service Office which is responsible for all administrative and operational support...
17 CFR 140.1 - Headquarters office.
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Headquarters office. 140.1..., FUNCTIONS, AND PROCEDURES OF THE COMMISSION Organization § 140.1 Headquarters office. (a) General. The headquarters office of the Commission is located at Three Lafayette Centre, 1155 21st Street, NW., Washington...
Influencing Organizational Commitment through Office Redesign
Morrow, Paula C.; McElroy, James C.; Scheibe, Kevin P.
2012-01-01
Prior research on the effects of office redesign on work-related outcomes has been largely a theoretical and yielded mixed and conflicting findings. Expanding on individual reactions to office design changes as specified by social interference theory, we propose that office redesign affects organizational commitment and this relationship is…
40 CFR 1600.6 - Office location.
2010-07-01
... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Office location. 1600.6 Section 1600.6 Protection of Environment CHEMICAL SAFETY AND HAZARD INVESTIGATION BOARD ORGANIZATION AND FUNCTIONS OF THE CHEMICAL SAFETY AND HAZARD INVESTIGATION BOARD § 1600.6 Office location. The principal offices of the...
2013-08-19
... send a courtesy copy of any comments to the U.S. Department of Labor-OASAM, Office of the Chief... Sector--businesses or other for-profits. Total Estimated Number of Respondents: 337. Total Estimated...
2013-10-29
... send a courtesy copy of any comments to the U.S. Department of Labor-OASAM, Office of the Chief... Sector--businesses or other for-profits. Total Estimated Number of Respondents: 21. Total Estimated...
77 FR 66601 - Electronic Tariff Filings; Notice of Change to eTariff Type of Filing Codes
2012-11-06
... for the Federal Power Marketing Administrations (PMAs): TOFC 1220: ``Rate Extensions''. This code will... Peter Radway, Office of Energy Market Regulation at (202) 502-8782 or send an email to [email protected
2013-06-20
.... 2201, Silver Spring, MD 20993-0002. Send one self-addressed adhesive label to assist the office in... comments to the Division of Dockets Management (HFA-305), Food and Drug Administration, 5630 Fishers Lane...
75 FR 22812 - Guidance for Industry on Tobacco Health Document Submission; Availability; Correction
2010-04-30
... Lane, Rockville, MD 20957, 301-827-7010. SUPPLEMENTARY INFORMATION: In FR Doc. 2010-9134, appearing on...: ``Send one self-addressed adhesive label to assist that office in processing your request or include a...
2013-01-14
... Spring, MD 20993-0002. Send one self-addressed adhesive label to assist that office in processing your... to the Division of Dockets Management (HFA-305), Food and Drug Administration, 5630 Fishers Lane, rm...
Interactive Board with Technology of Bluetooth Data Sending Through Tablet for Learning and Teaching
Directory of Open Access Journals (Sweden)
Chonlatee Photong
2017-06-01
Full Text Available Interactive boards are the boards that can be written, presented or showed multimedia materials; thus, They become the most famous devices for modern learning and teaching. However, interactive boards currently sold in marketplace are expensive, large size and heavy, which are inconvenient to be carried-away. This paper presented an interactive board that utilizes technology of bluetooth data sending through a tablet. The paper presented the details of the board and satisfaction results of using the board from 253 sampling students and staff of Mahasarakham University. The research results showed that the constructed board had small size and light-weight, which would be convenient to be carried-away. The cost of the board was approximately 3-8 times less than the conventional boards. In addition, the board could be operated in the large area covering the area with estimated radius of 13 meters. The satisfaction of using the board from questionnaires showed that the constructed board was useful and should be used for learning and teaching, 94.1% of correspondents were highly and very highly statified of using the board, 89.3% of correspondents agreed that the board was suitable equipment in smart classroom and 88.4% of correspondents felt excited and very excited when using the board while 83.0% of correspondents have never seen this kind of innovation for education before.
32 CFR 22.605 - Grants officers' responsibilities.
2010-07-01
... recipient, a copy is forwarded to the office designated to administer the grant or cooperative agreement, and another copy is forwarded to the finance and accounting office designated to make the payments to... and accounting office. On the first page of the copy forwarded to the recipient, the grants officer...
75 FR 47495 - Office of the Ombudsman
2010-08-06
... Office of Finance, and any person that has a business relationship with a regulated entity or the Office... entity or the Office of Finance that involves the provision of goods or services. The term business... Office of Finance of the Federal Home Loan Bank System. Person would mean an organization, business...
22 CFR Appendix C to Part 513 - Certification Regarding Drug-Free Workplace Requirements
2010-04-01
..., they may be identified in the grant application. If the grantee does not identify the workplaces at the... the workplace(s) on file in its office and make the information available for Federal inspection... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Certification Regarding Drug-Free Workplace...
12 CFR 545.96 - Agency office.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Agency office. 545.96 Section 545.96 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY FEDERAL SAVINGS ASSOCIATIONS-OPERATIONS § 545.96 Agency office. (a) General. A Federal savings association may establish or maintain an agency...
45 CFR 99.2 - Presiding officer.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Presiding officer. 99.2 Section 99.2 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND General § 99.2 Presiding officer. (a) (1) The presiding officer at a...
11 CFR 300.35 - Office buildings.
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Office buildings. 300.35 Section 300.35 Federal... FUNDS State, District, and Local Party Committees and Organizations § 300.35 Office buildings. (a) General provision. For the purchase or construction of its office building, a State or local party...
Office Operative Hysteroscopy: An Update.
Salazar, Christina Alicia; Isaacson, Keith B
2018-02-01
Hysteroscopy is considered the gold standard for the evaluation of intracavitary pathology in both premenopausal and postmenopausal patients associated with abnormal uterine bleeding, as well as for the evaluation of infertile patients with suspected cavity abnormalities. Office-based operative hysteroscopy allows patients to resume activities immediately and successfully integrates clinical practice into a "see and treat" modality, avoiding the added risks of anesthesia and the inconvenience of the operating room. For 2017, the Centers for Medicare and Medicaid Services has provided a substantial increase in reimbursement for a select number of office-based hysteroscopic procedures. This review provides an update on the indications, equipment, and procedures for office hysteroscopy, as well as the management of complications that may arise within an office-based practice. Copyright © 2018. Published by Elsevier Inc.
2010-01-01
... 4 Accounts 1 2010-01-01 2010-01-01 false Oath of office. 3.2 Section 3.2 Accounts GOVERNMENT ACCOUNTABILITY OFFICE PERSONNEL SYSTEM EMPLOYMENT § 3.2 Oath of office. The provisions of subchapter II of chapter 33 of title 5, U.S. Code, and Office of Personnel Management implementing regulations apply to...
International Nuclear Information System (INIS)
1994-10-01
The US Department of Energy (DOE) Office of Environmental Management, formerly the Office of Environmental Restoration and Waste Management (EM), was established in November 1989 as the first step toward correcting contamination problems resulting from nearly 50 years of nuclear weapons production and fuel processing activities. EM consolidates several DOE organizations previously responsible for the handling, treatment, and disposition of radioactive and hazardous waste. Within EM, the Office of Technology Development (OTD/EM-50) is responsible for developing technologies to meet DOE's goal for environmental restoration. OTD manages an aggressive national program of applied research, development, demonstration, testing, and evaluation (RDDT and E) for environmental cleanup, waste management, and related technologies. The program is designed to resolve major technical issues, to rapidly advanced beyond current technologies for environmental restoration and waste management operations, and to expedite compliance with applicable environmental laws and regulations. This report summarizes Fiscal Year 1994 (FY94) programmatic information, accomplishments, and planned activities relevant to the individual activities within OTD's RDDT and E
20 CFR 404.1073 - Public office.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Public office. 404.1073 Section 404.1073...- ) Employment, Wages, Self-Employment, and Self-Employment Income Self-Employment § 404.1073 Public office. (a) General. The performance of the functions of a public office is not a trade or business except under the...
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Home office. 545.91 Section 545.91 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY FEDERAL SAVINGS ASSOCIATIONS-OPERATIONS § 545.91 Home office. (a) All operations of a Federal savings association (“you”) are subject to...
32 CFR 552.90 - Permit office.
2010-07-01
... 32 National Defense 3 2010-07-01 2010-07-01 true Permit office. 552.90 Section 552.90 National... CEMETERIES REGULATIONS AFFECTING MILITARY RESERVATIONS Fort Lewis Land Use Policy § 552.90 Permit office... non-training acess to the range complex. The office is open 0700-1900 hours, seven days a week, for...
Asymmetric Properties of Office Rent Adjustment
D. Brounen (Dirk); M.G.J. Jennen (Maarten)
2009-01-01
textabstractIn this paper we use an error correction model for understanding the changes in real office rents for a panel of 15 U.S. MSA's over the period 1990-2007. We find that office rents in all cities react positively to a rise in office employment and lagged rent changes, while lagged
Migration Flows from the Perspective of Sending and Receiving Countries
DEFF Research Database (Denmark)
Pytlikova, Mariola
There are two specific phenomena that have had a large influence on the development in international migration during the last decades. First, while labor migration flows were dominating in the past, refugee immigrants and family reunion migrants from less developed non-Western countries have been......, the former communist countries have become a relatively new and large source of immigration. In my PhD thesis I analyze the recent developments in international migration by using a rich dataset, which I collected myself by contacting national statistical offices. I use state-of-art econometric tools in my...... area with the free movement of labor. The results of my analyses show that migrants respond strongly to the interregional differences in wages. On the other hand, the districts' unemployment rates do not seem to play an important role. Further, on average Czechs prefer to move to regions near...
2013-09-24
... send a courtesy copy of any comments to the U.S. Department of Labor-OASAM, Office of the Chief... Public: Private Sector--businesses or other for-profits and not-for-profit institutions. Total Estimated...
77 FR 11593 - Proposed Collection, Comment Request
2012-02-27
... in the Addresses section of this notice on or before April 27, 2012. ADDRESSES: Send comments to Nora... (this is not a toll free number). FOR FURTHER INFORMATION CONTACT: Nora Kincaid, BLS Clearance Officer...
42 CFR 401.130 - Materials available at social security district offices and branch offices.
2010-10-01
... (HIM-10). (13) Home Health Agency Manual (HIM-11). (14) Outpatient Physical Therapy Provider Manual... social security district offices and branch offices: (1) Claims Manual of the Social Security Administration. (2) Department Staff Manual on Organization, Department of Health and Human Services, Part F, CMS...
Office of Disability Employment Policy
... STATES DEPARTMENT OF LABOR Facebook Twitter RSS Email Office of Disability Employment Policy (ODEP) Menu About ODEP ... LABOR DEPARTMENT Español A to Z Index Agencies Office of Inspector General Leadership Team Contact Us Subscribe ...
20 CFR 404.1006 - Corporation officer.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Corporation officer. 404.1006 Section 404... Corporation officer. If you are an officer of a corporation, you are an employee of the corporation if you are... director of a corporation, we consider you to be self-employed when you work as a director. ...
The Office of Airline Information.
2015-01-01
The Office of Airline Information (OAI) mandate is to collect, validate, compile and disseminate data on airline traffic, performance, finances, and fares. Each quarter, BTS Office of Airline Information (OAI) processes more than 3,800 filings sub...
Energy Technology Data Exchange (ETDEWEB)
Shin, Young Kil [Dept. of Electircal Engineeirng, Kunsan National University, Kunsan (Korea, Republic of)
2013-12-15
An encircling send-receive type pulsed eddy current (PEC) probe is designed for use in aluminum tube inspection. When bare receive coils located away from the exciter were used, the peak time of the signal did not change although the distance from the exciter increased. This is because the magnetic flux from the exciter coil directly affects the receive coil signal. Therefore, in this work, both the exciter and the sensor coils were shielded in order to reduce the influence of direct flux from the exciter coil. Numerical simulation with the designed shielded encircling PEC probe showed the corresponding increase of the peak time as the sensor distance increased. Ferrite and carbon steel shields were compared and results of the ferrite shielding showed a slightly stronger peak value and a quicker peak time than those of the carbon steel shielding. Simulation results showed that the peak value increased as the defect size (such as depth and length) increased regardless of the sensor location. To decide a proper sensor location, the sensitivity of the peak value to defect size variation was investigated and found that the normalized peak value was more sensitive to defect size variation when the sensor was located closer to the exciter.
2013-11-08
... not required, to send a courtesy copy of any comments to the U.S. Department of Labor-OASAM, Office of... Refiling Survey. OMB Control Number: 1220-0032. Affected Public: Private Sector--business or other for...
75 FR 15437 - Agency Information Collection Activities: Proposed Collection; Comment Request
2010-03-29
...) hours 500 1 1.5 750 Send comments to Summer King, SAMHSA Reports Clearance Officer, Room 7-1044, One Choke Cherry Road, Rockville, MD 20857. Written comments should be received within 60 days of this...
Program Office Support Change Management System (POS CMS)
Office of Personnel Management — This application is used by the U.S. Office of Personnel Management (OPM)'s Office of the Chief Information Officer (CIO) for tracking software change requests for...
Directory of Open Access Journals (Sweden)
Koranteng
2015-08-01
Full Text Available The design of buildings in public educational institutions in Ghana predominantly adopts open-plan offices that are naturally ventilated with the aid of operable windows for reasons such as achieving adaptable spaces improved social climate and effective ventilation. However adoption of open-plan naturally ventilated offices in these educational institutions expose occupants to noise that emanates indoors and from outdoor sources which can interfere with and impede work performance. The study aimed at assessing noise exposure levels and occupants satisfaction with noise level in selected naturally ventilated open-plan offices in Ghana. The study employed an empirical assessment of the noise levels in and around three of the office buildings using a PCE222 Digital Sound Level Meter and a survey involving interviews to assess workers satisfaction of noise levels of the open-plan offices at the Kwame Nkrumah University of Science and Technology in Kumasi. The results show that mean outdoor noise levels for offices ranged from 11 per cent below to 5 per cent above the WHO permissible limits while mean indoor noise levels exceeded the limit by between 20-40 per cent during the course of the day. In spite of the high levels of noise occupants generally considered the overall noise level in their offices as acceptable. Likewise the results indicate that there are no significant differences in occupants exposure to noise from their various sitting positions in an office space and floor levels in an office building. The paper recommends strategies to manage and improve ambient noise quality within naturally ventilated open-plan office spaces in Ghana. The study will be of relevance as a useful guide to organizations and policy makers concerned with built environmental issues.
Learn Office 2011 for Mac OS X
Hart-Davis, Guy
2011-01-01
Office for Mac remains the leading productivity suite for Mac, with Apple's iWork and the free OpenOffice.org trailing far behind. And now it's being updated with a cleaner interface and more compatibility with Exchange and SharePoint. Learn Office 2011 for Mac OS X offers a practical, hands-on approach to using Office 2011 applications to create and edit documents and get work done efficiently. You'll learn how to customize Office, design, create, and share documents, manipulate data in a spreadsheet, and create lively presentations. You'll also discover how to organize your email, contacts,
Office of Disease Prevention and Health Promotion
... Health Literacy Health Care Quality Healthy People healthfinder Office of Disease Prevention and Health Promotion Spotlight: This ... 16/2017 This site is coordinated by the Office of Disease Prevention and Health Promotion, Office of ...
20 CFR 658.413 - Initial handling of complaints by the State or local office.
2010-04-01
... related, or if non-JS related, it alleges violations of employment related laws enforced by ESA or OSHA.... The JS official shall send a confirming letter to this effect to the complainant and shall give the...
International Nuclear Information System (INIS)
Benson, J.M.; Tait, R.B.; Garrett, G.G.
1981-10-01
At present there does not exist a realistic crack growth law which will provide a good description of the relationship between the alternating stress intensity factor and the crack growth per cycle of stress. Such a law should be applicable to either the pressurized water reactor environment (PWR) or boiling water reactor environmnt (BWR). This project was formulated with the aim of examining the fatigue crack growth rate of SA533-B steel (a nuclear pressure vessel steel) in the threshold region in a simulated PWR environment. The aim of this report is to develop a crack monitoring technique for use in corrosion fatigue studies. Factors affecting fatigue crack propagation include: frequency, stress range, the effect of irradiation, ageing and environment. The mechanisms of crack propagation that are discussed include: slip dissolution, hydrogen assisted cracking, corrosion potential, and morphology studies. D.C. electrical potential, the compliance technique and the back-faced strain gauge method can be used for crack monitoring. Details are also given on the experimental equipment and programme. The results of the experiment has shown that the potential difference technique for monitoring crack length is a valuable one and is well suited for use in fatigue testing applications
Priorities in Accommodating office user preferences : Impact on office users decision to stay or go
Remøy, HT; van der Voordt, Theo
2014-01-01
Purpose When current accommodation is unsatisfactory, office organisations consider relocating to new accommodation that optimally facilitates their main processes and supports image and financial yield. However, due to high vacancy levels, public opinion and governmental awareness oppose new office
Remøy, H.
2010-01-01
Office building vacancy is becoming an increasingly visible part of the cityscape. Billboards shout “for rent” and office locations look abandoned even in the middle of the day. Still, new office buildings and locations are being developed, adding up to the built environment. As hardly any office
Passport officers' errors in face matching.
White, David; Kemp, Richard I; Jenkins, Rob; Matheson, Michael; Burton, A Mike
2014-01-01
Photo-ID is widely used in security settings, despite research showing that viewers find it very difficult to match unfamiliar faces. Here we test participants with specialist experience and training in the task: passport-issuing officers. First, we ask officers to compare photos to live ID-card bearers, and observe high error rates, including 14% false acceptance of 'fraudulent' photos. Second, we compare passport officers with a set of student participants, and find equally poor levels of accuracy in both groups. Finally, we observe that passport officers show no performance advantage over the general population on a standardised face-matching task. Across all tasks, we observe very large individual differences: while average performance of passport staff was poor, some officers performed very accurately--though this was not related to length of experience or training. We propose that improvements in security could be made by emphasising personnel selection.
Passport officers' errors in face matching.
Directory of Open Access Journals (Sweden)
David White
Full Text Available Photo-ID is widely used in security settings, despite research showing that viewers find it very difficult to match unfamiliar faces. Here we test participants with specialist experience and training in the task: passport-issuing officers. First, we ask officers to compare photos to live ID-card bearers, and observe high error rates, including 14% false acceptance of 'fraudulent' photos. Second, we compare passport officers with a set of student participants, and find equally poor levels of accuracy in both groups. Finally, we observe that passport officers show no performance advantage over the general population on a standardised face-matching task. Across all tasks, we observe very large individual differences: while average performance of passport staff was poor, some officers performed very accurately--though this was not related to length of experience or training. We propose that improvements in security could be made by emphasising personnel selection.
Pregnancy Problems? Boost the Chance of Having a Baby
... español Send us your comments For those who dream of being parents, pregnancy problems can be tremendously ... Issues About Us Privacy Accessibility Freedom of Information Act No Fear Act Office of Inspector General USA. ...
Graves, Charlotte K.
1985-01-01
Office systems consultants, office administration faculty, and other collegiate business faculty (management, marketing, accounting, and finance) were asked to rate the importance of 42 concepts needed by managerial personnel in automated offices. Also, business faculty were asked to indicate which concepts were currently being taught in courses…
Energy Technology Data Exchange (ETDEWEB)
1994-10-01
The US Department of Energy (DOE) Office of Environmental Management, formerly the Office of Environmental Restoration and Waste Management (EM), was established in November 1989 as the first step toward correcting contamination problems resulting from nearly 50 years of nuclear weapons production and fuel processing activities. EM consolidates several DOE organizations previously responsible for the handling, treatment, and disposition of radioactive and hazardous waste. Within EM, the Office of Technology Development (OTD/EM-50) is responsible for developing technologies to meet DOE`s goal for environmental restoration. OTD manages an aggressive national program of applied research, development, demonstration, testing, and evaluation (RDDT and E) for environmental cleanup, waste management, and related technologies. The program is designed to resolve major technical issues, to rapidly advanced beyond current technologies for environmental restoration and waste management operations, and to expedite compliance with applicable environmental laws and regulations. This report summarizes Fiscal Year 1994 (FY94) programmatic information, accomplishments, and planned activities relevant to the individual activities within OTD`s RDDT and E.
2010-01-01
that ROTC programs were being staffed with lower performing and less qualified officers to educate young black officers. He based this conclusion on...come to mutually supporting conclusions. In a 2008 USAWC Strategy Research Project, while exploring the effects of ethnocentrism and its affect on
Ideas for Office Occupations Education.
Alverson, Ruby; And Others
Prepared by South Carolina office occupations teachers, this booklet contains ideas for effective and motivating teaching methods in office occupations courses on the secondary school level. Besides ideas generally applicable, suggestions are included for teaching the following specific subjects: (1) accounting, (2) recordkeeping, (3) cooperative…
Microsoft Office Word 2007 step by step
Cox, Joyce
2007-01-01
Experience learning made easy-and quickly teach yourself how to create impressive documents with Word 2007. With Step By Step, you set the pace-building and practicing the skills you need, just when you need them!Apply styles and themes to your document for a polished lookAdd graphics and text effects-and see a live previewOrganize information with new SmartArt diagrams and chartsInsert references, footnotes, indexes, a table of contentsSend documents for review and manage revisionsTurn your ideas into blogs, Web pages, and moreYour all-in-one learning experience includes:Files for building sk
Cross-cultural Training of Danish Police Officers
DEFF Research Database (Denmark)
Muhr, Sara Louise; Lorenzen, Julie
2016-01-01
. The empirical data for this case emanates from the collaboration between the Greenlandic and Danish police in 2015. Every summer, a group of Danish officers are sent to Greenland to assist the police force while local officers are on summer holidays. The case centers on a one-week course in January of 2015...... that is provided to the selected group of Danish officers going to Greenland the following summer. The main focus is kept on how a group of leaders from the Greenlandic police, with Danish and Greenlandic backgrounds, present the upcoming experience and work to the Danish officers, as well as the officers...
Donate Food to Free Your Boss | Poster
For the third year in a row, NCI at Frederick is participating in the Feds Feed Families campaign, which aims to stock food banks during the summer when donations are often limited. The 2016 campaign runs through August 31. This year, the Office of Scientific Operations (OSO) has decided to send the campaign off with a twist. Rich Folkers, public affairs specialist, Office of
2010-10-18
... interpreted the term, because, among the variety of services provided, family offices are in the business of...: Private Wealth Management in the Family Context, Wharton Global Family Alliance (Apr. 1, 2008), available..., management, and employment structures and arrangements employed by family offices.'' \\14\\ We have taken this...
The New Planned Giving Officer.
Jordan, Ronald R.; Quynn, Katelyn L.
1994-01-01
A planned giving officer is seen as an asset to college/university development for technical expertise, credibility, and connections. Attorneys, certified public accountants, bank trust officers, financial planners, investment advisers, life insurance agents, and real estate brokers may be qualified but probably also need training. (MSE)
The PR Officer's Survival Kit.
Woodrum, Robert L.
1996-01-01
A former corporate public relations (PR) professional shares strategies for communicating and cooperating with the chief executive officer, and particularly for coping with differences in perceptions of the public relations officer's role. Basic attributes of a successful PR professional are outlined: good communication skills, an analytical…
Richland Operations Office technology summary
International Nuclear Information System (INIS)
1994-05-01
This document has been prepared by the Department of Energy's Environmental Management Office of Technology Development to highlight its research, development, demonstration, testing, and evaluation activities funded through the Richland Operations Office. Technologies and processes described have the potential to enhance cleanup and waste management efforts
Richland Operations Office technology summary
Energy Technology Data Exchange (ETDEWEB)
1994-05-01
This document has been prepared by the Department of Energy`s Environmental Management Office of Technology Development to highlight its research, development, demonstration, testing, and evaluation activities funded through the Richland Operations Office. Technologies and processes described have the potential to enhance cleanup and waste management efforts.
Jansen, M.M.; Moelker, R.
2016-01-01
The Officer Corps constitutes the backbone of the military. Privates and NCOs come and go. Political leaders are replaced. But the officer corps, the military profession per se, endures. The focus of this paper is how the military profession is maintained by military academies. A profession is
Full Text Available ... and send a signed report to your primary care or referring physician , who will discuss the results ... widely available in emergency rooms, physician offices, ambulatory care centers, nursing homes and other locations, making it ...
47 CFR 0.101 - Functions of the office.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Functions of the office. 0.101 Section 0.101 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL COMMISSION ORGANIZATION Organization Office of Communications Business Opportunities § 0.101 Functions of the office. (a) The Office of Communications Business...
40 CFR 247.16 - Non-paper office products.
2010-07-01
... pressboard binders containing recovered paper; and solid plastic binders containing recovered plastic. (e... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Non-paper office products. 247.16...-paper office products. (a) Office recycling containers and office waste receptacles. (b) Plastic desktop...
International Nuclear Information System (INIS)
Rauth, A.M.; Mohindra, J.K.
1981-01-01
The chemotherapeutic agent 5-(3,3-dimethyl-1-triazeno)-imidazole-4-carboxamide (DTIC) is used in the treatment of malignant melanoma where response rates of 15 to 30% have been reported. Some current interest exists in combining DTIC chemotherapy with localized high-dose (800 rads)-per-fraction radiotherapy in the treatment of unresectable metastatic melanoma. The present work investigates the radiosensitizing and chemotherapeutic properties of DTIC in an in vitro system using Chinese hamster ovary or HeLa cells and in vivo, using the KHT transplantable murine tumor. No evidence of a radiosensitizing effect of DTIC was found towards hypoxic or aerobic cells either in vitro or in vivo. In vitro, high drug concentrations (1 mg/ml) were approximately 5 times more effective in killing hypoxic Chinese hamster ovary or HeLa cells than in killing aerobic cells over exposure times of 0 to 12 hr. The degree of toxicity was drug dose and temperature dependent but was not highly dependent on cell number or cell type. In vivo plasma levels of DTIC were measured with high-pressure liquid chromatography after i.p. injection of drug into C3H mice. At the highest drug doses tested, near the 50% lethal dose in mice for DTIC (0.5 mg/g), the drug was toxic to both aerobic and hypoxic tumor cells with some evidence of increased toxicity towards hypoxic cells. The present work suggests that DTIC may be more efficiently activated under hypoxic conditions as compared to aerobic conditions. The increased toxicity of DTIC under hypoxic versus aerobic conditions may prove to be a feature of this drug that can be exploited in its clinical use and in the design of new analogs of DTIC
48 CFR 4.101 - Contracting officer's signature.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contracting officer's signature. 4.101 Section 4.101 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL ADMINISTRATIVE MATTERS Contract Execution 4.101 Contracting officer's signature. Only contracting officers shall...
Office of Diversity Management and Equal Opportunity
Opportunity Office of Diversity Management and Equal Opportunity Home About ODMEO Leadership Documents News Skip to main content (Press Enter). Toggle navigation Office of Diversity Management and Equal Opportunity Search Search ODMEO: Search Search ODMEO: Search Office of Diversity Management and Equal
International Nuclear Information System (INIS)
Hou, Juan; Peng, Qunjia; Takeda, Yoichi; Kuniya, Jiro; Shoji, Tetsuo
2010-01-01
Research highlights: → High-angle misorientation at FB, type-II and type-I boundaries. → Highest residual strain and hardness in the zone between FB and type-II boundary. → Type-II and type-I boundaries had lower resistance to SCC growth than the FB. → Crack growth blunted by pitting at the FB. → Reactivation of crack growth from the pitting by oxidation along the grain boundary. - Abstract: Stress corrosion cracking (SCC) in the fusion boundary (FB) region of an Alloy 182-A533B low alloy steel (LAS) dissimilar weld joint in high temperature water doped with sulfate was studied following a microstructure characterization of the FB region. The microstructure characterization suggested the type-II and type-I boundaries in the dilution zone (DZ) adjacent to the FB had lower resistance to SCC growth than the FB. Crack propagating perpendicular to the FB in the DZ was observed to be blunted by pitting at the FB, followed by the reactivation from the pitting by localized oxidation along the grain boundary in LAS.
Patent office governance and patent system quality
PICARD, Pierre M.; VAN POTTELSBERGHE DE LA POTTERIE, Bruno
2011-01-01
The present paper discusses the role of quality in patent systems from the perspective of patent offices' behavior and organization. After documenting original stylized facts, the paper presents a model in which patent offices set patent fees and the quality level of their examination processes. Various objectives of patent offices' governors are considered. We show that the quality of the patent system is maximal for the patent offices that maximises either the social welfare or its own prof...
Zomerdijk, L.G.
2005-01-01
This dissertation presents the results of a research study that involved the development of a framework that provides insight in and so supports design decisions regarding front office and back office activities in service delivery processes. Building on the evidence from five case studies in the financial services sector, three design decisions have been elaborated. They are the definition of front office and back office activities, the decoupling decisions and organizational arrangements. T...
Reitenbach, E.F.R.; Jochems, A.J.; Molenbroek, J.F.M.; Ball, R.; Eijk, D.J.
2008-01-01
In Hong Kong it was noticed that female office and factory workers use chairs that are oversized and can't support their sitting posture in a comfortable way. In order to set up general recommendations to design a more appropriate office chair, a research of the user experience of office chairs was
2011-07-07
... Kirkwood. Western Pacific Territories, Served by Hawaii State Office. West Virginia, 530 Freedom Road..., parental status, religion, sexual orientation, genetic information, political beliefs, reprisal, or because...
47 CFR 0.17 - Functions of the Office.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Functions of the Office. 0.17 Section 0.17 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL COMMISSION ORGANIZATION Organization Office of Legislative Affairs § 0.17 Functions of the Office. The Office of Legislative Affairs is directly responsible...
47 CFR 0.31 - Functions of the Office.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Functions of the Office. 0.31 Section 0.31 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL COMMISSION ORGANIZATION Organization Office of Engineering and Technology § 0.31 Functions of the Office. The Office of Engineering and Technology has the...
Geothermal Technologies Office 2012 Peer Review Report
Energy Technology Data Exchange (ETDEWEB)
none,
2013-04-01
On May 7-10, 2012, the U.S. Department of Energy, Office of Energy Efficiency and Renewable Energy, Geothermal Technologies Office conducted its annual program peer review in Westminster, CO. In accordance with the EERE Peer Review Guide, the review provides an independent, expert evaluation of the strategic goals and direction of the office and is a forum for feedback and recommendations on future office planning. The purpose of the review was to evaluate DOE-funded projects for their contribution to the mission and goals of the office and to assess progress made against stated objectives. Project scoring results, expert reviewer comments, and key findings and recommendations are included in this report.
20 CFR 401.175 - Government Accountability Office.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Government Accountability Office. 401.175... RECORDS AND INFORMATION Disclosure of Official Records and Information § 401.175 Government Accountability Office. We disclose information to the Government Accountability Office when that agency needs the...
28 CFR 32.34 - PSOB Office determination.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false PSOB Office determination. 32.34 Section 32.34 Judicial Administration DEPARTMENT OF JUSTICE PUBLIC SAFETY OFFICERS' DEATH, DISABILITY, AND EDUCATIONAL ASSISTANCE BENEFIT CLAIMS Educational Assistance Benefit Claims § 32.34 PSOB Office determination...
47 CFR 0.151 - Functions of the Office.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Functions of the Office. 0.151 Section 0.151 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL COMMISSION ORGANIZATION Organization Office of Administrative Law Judges § 0.151 Functions of the Office. The Office of Administrative Law Judges consists of a...
47 CFR 0.13 - Functions of the Office.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Functions of the Office. 0.13 Section 0.13 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL COMMISSION ORGANIZATION Organization Office of Inspector General § 0.13 Functions of the Office. The Office of Inspector General is directly responsible to the...
47 CFR 0.21 - Functions of the Office.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Functions of the Office. 0.21 Section 0.21 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL COMMISSION ORGANIZATION Organization Office of Strategic Planning and Policy Analysis § 0.21 Functions of the Office. The Office of Strategic Planning and Policy...
47 CFR 0.41 - Functions of the Office.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Functions of the Office. 0.41 Section 0.41 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL COMMISSION ORGANIZATION Organization Office of General Counsel § 0.41 Functions of the Office. The Office of the General Counsel has the following duties and...
7 CFR 1230.634 - FSA county office report.
2010-01-01
... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... report. The FSA county office will notify the FSA State office of the results of the referendum. Each FSA county office will transmit the results of the referendum in its county to the FSA State office. Such...
32 CFR 776.67 - Judicial and legal officers.
2010-07-01
... PROFESSIONAL CONDUCT OF ATTORNEYS PRACTICING UNDER THE COGNIZANCE AND SUPERVISION OF THE JUDGE ADVOCATE GENERAL... covered attorney shall not make a statement that the covered attorney knows to be false or with reckless... officer, hearing officer, adjudicatory officer, or public legal officer, or of a candidate for election or...
Coding for urologic office procedures.
Dowling, Robert A; Painter, Mark
2013-11-01
This article summarizes current best practices for documenting, coding, and billing common office-based urologic procedures. Topics covered include general principles, basic and advanced urologic coding, creation of medical records that support compliant coding practices, bundled codes and unbundling, global periods, modifiers for procedure codes, when to bill for evaluation and management services during the same visit, coding for supplies, and laboratory and radiology procedures pertinent to urology practice. Detailed information is included for the most common urology office procedures, and suggested resources and references are provided. This information is of value to physicians, office managers, and their coding staff. Copyright © 2013 Elsevier Inc. All rights reserved.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Offices. 2200.5 Section 2200.5 Agriculture Regulations of the Department of Agriculture (Continued) LOCAL TELEVISION LOAN GUARANTEE BOARD ACCESS TO LOCAL... offices of the Board are at the U.S. Department of Agriculture, Rural Utilities Service, Room 2919-S, Stop...
46 CFR 15.915 - Engineer Officer Endorsements.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Engineer Officer Endorsements. 15.915 Section 15.915... REQUIREMENTS Equivalents § 15.915 Engineer Officer Endorsements. The following licenses and MMC officer... designated duty engineer license or endorsement authorizes service as chief or assistant engineer on vessels...
Dissociation of molecular iodine in RF discharge for oxygen-iodine laser
Czech Academy of Sciences Publication Activity Database
Jirásek, Vít; Schmiedberger, Josef; Čenský, Miroslav; Kodymová, Jarmila
2012-01-01
Roč. 66, č. 4 (2012), 1-6 ISSN 1434-6060 R&D Projects: GA ČR GA202/09/0310 Grant - others:European Office for Aerospace R&D(XE) FA8655-09-1-3092 Institutional research plan: CEZ:AV0Z10100523 Keywords : molecular iodine * RF discharge * dissociation * oxygen-iodine laser * COIL Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.513, year: 2012
18 CFR 3a.51 - Designation of security officers.
2010-04-01
... Top Secret Control Officer and Security Officer for classified material for the Federal Power Commission. The Director, OAO, will designate alternate Top Secret Control Officers and alternated Security... the duties for which the Top Secret Control Officer and Security Officer is responsible. As used...
Helland, Magne; Horgen, Gunnar; Kvikstad, Tor Martin; Garthus, Tore; Aarås, Arne
2011-11-01
This study investigated the effect of moving from small offices to a landscape environment for 19 Visual Display Unit (VDU) operators at Alcatel Denmark AS. The operators reported significantly improved lighting condition and glare situation. Further, visual discomfort was also significantly reduced on a Visual Analogue Scale (VAS). There was no significant correlation between lighting condition and visual discomfort neither in the small offices nor in the office landscape. However, visual discomfort correlated significantly with glare in small offices i.e. more glare is related to more visual discomfort. This correlation disappeared after the lighting system in the office landscape had been improved. There was also a significant correlation between glare and itching of the eyes as well as blurred vision in the small offices, i.e. more glare more visual symptoms. Experience of pain was found to reduce the subjective assessment of work capacity during VDU tasks. There was a significant correlation between visual discomfort and reduced work capacity in small offices and in the office landscape. When moving from the small offices to the office landscape, there was a significant reduction in headache as well as back pain. No significant changes in pain intensity in the neck, shoulder, forearm, and wrist/hand were observed. The pain levels in different body areas were significantly correlated with subjective assessment of reduced work capacity in small offices and in the office landscape. By careful design and construction of an office landscape with regard to lighting and visual conditions, transfer from small offices may be acceptable from a visual-ergonomic point of view. Copyright © 2011 Elsevier Ltd and The Ergonomics Society. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
1994-02-01
This report summarizes significant FY93 programmatic information and accomplishments relevant to the individual activities within the Office of Technology Development Program for Research, Development, Demonstration, Testing, and Evaluation (RDDT&E). A brief discussion of the mission of the Office of Environmental Restoration and Waste Management (EM) and the Office of Technology Development is presented. An overview is presented of the major problem areas confronting DOE. These problem areas include: groundwater and soils cleanup; waste retrieval and processing; and pollution prevention. The organizational elements within EM are highlighted. An EM-50 Funding Summary for FY92 and FY93 is also provided. RDDT&E programs are discussed and their key problem areas are summarized. Three salient program-formulating concepts are explained. They are: Integrated Demonstrations, Integrated Programs, and the technology window of opportunity. Detailed information for each of the programs within RDDT&E is presented and includes a fact sheet, a list of technical task plans and an accomplishments and objectives section.
International Nuclear Information System (INIS)
1994-02-01
This report summarizes significant FY93 programmatic information and accomplishments relevant to the individual activities within the Office of Technology Development Program for Research, Development, Demonstration, Testing, and Evaluation (RDDT ampersand E). A brief discussion of the mission of the Office of Environmental Restoration and Waste Management (EM) and the Office of Technology Development is presented. An overview is presented of the major problem areas confronting DOE. These problem areas include: groundwater and soils cleanup; waste retrieval and processing; and pollution prevention. The organizational elements within EM are highlighted. An EM-50 Funding Summary for FY92 and FY93 is also provided. RDDT ampersand E programs are discussed and their key problem areas are summarized. Three salient program-formulating concepts are explained. They are: Integrated Demonstrations, Integrated Programs, and the technology window of opportunity. Detailed information for each of the programs within RDDT ampersand E is presented and includes a fact sheet, a list of technical task plans and an accomplishments and objectives section
12 CFR 605.501 - Information Security Officer.
2010-01-01
... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Information Security Officer. 605.501 Section... Information Security Officer. (a) The Information Security Officer of the Farm Credit Administration shall be responsible for implementation and oversight of the information security program and procedures adopted by the...
50 CFR 10.22 - Law enforcement offices.
2010-10-01
... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false Law enforcement offices. 10.22 Section 10... GENERAL PROVISIONS Addresses § 10.22 Law enforcement offices. Service law enforcement offices and their areas of responsibility follow. Mail should be addressed: “Assistant Regional Director, Division of Law...
Office Courtesy: Diferensiasi pada Komunikasi Organisasi
Yunus, Ulani
2012-01-01
Office etiquette or office courtesy is a procedure in a person with association or persons outside the organization. Etiquette teaches us to maintain good relations with the person / party. Etiquette becomes an inherent part of an organization because etiquette is not just a tool to assess an appropriate or inappropriate actions of members of the organization, but also the adhesive in the activities of a business transaction; that office image courtesy instrumental in building the organizatio...
2012-05-09
... Pacific Territories, served by Hawaii State Office. West Virginia, 530 Freedom Road, Ripley, West Virginia..., religion, sexual orientation, genetic information, political beliefs, reprisal, or because all or part of...
Geraedts, Rob P.; van der Voordt, Theo
2003-01-01
A large number of office premises seem difficult to rent out because they no longer meet the demands of the market. A solution must be found for these premises and also for office buildings that have been empty for longer periods. Reallocation or transformation to other functions such as homes can
7 CFR 2.75 - Deputy Chief Financial Officer.
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Deputy Chief Financial Officer. 2.75 Section 2.75... AND GENERAL OFFICERS OF THE DEPARTMENT Delegations of Authority by the Chief Financial Officer § 2.75 Deputy Chief Financial Officer. Pursuant to § 2.28, the following delegation of authority is made by the...
76 FR 76449 - Post Office Closing
2011-12-07
... the closing of the Spring Dale, West Virginia post office has been filed. It identifies preliminary... Postal Service's determination to close the Spring Dale post office in Spring Dale, West Virginia. The...
2010-01-01
..., Nutrition, and Consumer Services; the Under Secretary for Natural Resources and Environment; the Under... OFFICERS OF THE DEPARTMENT General § 2.4 General officers. The work of the Department is under the...