Remaining Sites Verification Package for the 126-B-3, 184-B Coal Pit Dumping Area, Waste Site Reclassification Form 2005-028

Energy Technology Data Exchange (ETDEWEB)

L. M. Dittmer

2006-08-07

The 126-B-3 waste site is the former coal storage pit for the 184-B Powerhouse. During demolition operations in the 1970s, the site was used for disposal of demolition debris from 100-B/C Area facilities. The site has been remediated by removing debris and contaminated soils. The results of verification sampling demonstrated that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also showed that residual contaminant concentrations are protective of groundwater and the Columbia River.

Paleo-Productivity across the Paleocene-Eocene Thermal Maximum, Walvis Ridge Transect (ODP Sites 1262, 1263, and 1266)

Science.gov (United States)

Chun, C. O.; Delaney, M. L.; Zachos, J. C.

2005-12-01

Walvis Ridge transect (Ocean Drilling Program (ODP) Leg 208) provides the first high-resolution depth-transect of deep-sea sediments recovered from the south Atlantic across the P/E boundary. A geographically restricted depth transect (~ 2.2 km, water depths between 2500 and 4770 m) allows us to constrain the surface waters by assuming marine productivity conditions in the overlying water column are similar across all sites. The sediment record will reveal variations for processes that are water-depth dependent. We use the geochemical tracers; biogenic barium, phosphorus, calcium carbonate, and the redox sensitive trace elements manganese and uranium, to reconstruct nutrient burial, paleoproductivity, and bottom water redox chemistry across the Paleocene-Eocene Thermal Maximum (PETM). We calculate our concentrations on a calcium carbonate-free basis to account for dilution by non-carbonate sediments. Trace metal enrichment factors (EFs) are calculated relative to bulk crustal averages. We chose three sites from the depth transect: the shallowest (Site 1263, 2717 m water depth), an intermediate site (Site 1266, 3798 m water depth), and the deepest site (Site 1262, 4755 m water depth). We sampled each site at a sample resolution of ~ 1-2 kyr for 5 m.y. centered at 55 Ma. Uranium EFs at the shallow site exhibits values ~ 5 pre-event and drop to values near crustal averages during and after the carbon isotope excursion (CIE). No dramatic changes in U EFs across the P/E boundary are recorded at the deep and intermediate sites. Mn EFs range between 2.9 -8.6 prior to the event across all three sites, suggesting an oxygenated depositional environment. At the boundary, Mn EFs drop to crustal averages at all sites, then gradually return to pre-event values, indicating more reducing environments during the CIE, a possible explanation for the benthic extinction event (BEE) observed across this transect. Ba excess and reactive phosphorus exhibit decreased concentrations during

11 CFR 114.5 - Separate segregated funds.

Science.gov (United States)

2010-01-01

... Federal Elections FEDERAL ELECTION COMMISSION GENERAL CORPORATE AND LABOR ORGANIZATION ACTIVITY § 114.5... communication or solicitation than the corporation, labor organization, membership organization, cooperative, or... or corporation is not required to report the cost of any communication to its members or stockholders...

Remaining Sites Verification Package for the 126-B-3, 184-B Coal Pit Dumping Area. Attachment to Waste Site Reclassification Form 2005-028

International Nuclear Information System (INIS)

Dittmer, L.M.

2006-01-01

The 126-B-3 waste site is the former coal storage pit for the 184-B Powerhouse. During demolition operations in the 1970s, the site was used for disposal of demolition debris from 100-B/C Area facilities. The site has been remediated by removing debris and contaminated soils. The results of verification sampling demonstrated that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also showed that residual contaminant concentrations are protective of groundwater and the Columbia River

Late Paleocene-middle Eocene benthic foraminifera on a Pacific seamount (Allison Guyot, ODP Site 865): Greenhouse climate and superimposed hyperthermal events

Science.gov (United States)

Arreguín-Rodríguez, Gabriela J.; Alegret, Laia; Thomas, Ellen

2016-03-01

We investigated the response of late Paleocene-middle Eocene (~60-37.5 Ma) benthic foraminiferal assemblages to long-term climate change and hyperthermal events including the Paleocene-Eocene Thermal Maximum (PETM) at Ocean Drilling Program (ODP) Site 865 on Allison Guyot, a seamount in the Mid-Pacific Mountains. Seamounts are isolated deep-sea environments where enhanced current systems interrupt bentho-pelagic coupling, and fossil assemblages from such settings have been little evaluated. Assemblages at Site 865 are diverse and dominated by cylindrical calcareous taxa with complex apertures, an extinct group which probably lived infaunally. Dominance of an infaunal morphogroup is unexpected in a highly oligotrophic setting, but these forms may have been shallow infaunal suspension feeders, which were ecologically successful on the current-swept seamount. The magnitude of the PETM extinction at Site 865 was similar to other sites globally, but lower diversity postextinction faunas at this location were affected by ocean acidification as well as changes in current regime, which might have led to increased nutrient supply through trophic focusing. A minor hyperthermal saw less severe effects of changes in current regime, with no evidence for carbonate dissolution. Although the relative abundance of infaunal benthic foraminifera has been used as a proxy for surface productivity through bentho-pelagic coupling, we argue that this proxy can be used only in the absence of changes in carbonate saturation and current-driven biophysical linking.

NCBI nr-aa BLAST: CBRC-MLUC-01-1145 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-1145 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 93% ...

Archive of Historic Core Data from the Ocean Drilling Program (ODP) Legs 101-129 (Pre-JANUS)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Drilling Program (ODP) operated the drilling vessel JOIDES Resolution from 1984-2003 for over 100 cruises worldwide. The ODP was funded by the U.S....

NCBI nr-aa BLAST: CBRC-OANA-01-1145 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OANA-01-1145 ref|NP_334701.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosi...s CDC1551] gb|AAK44515.1| hypothetical protein MT0291.4 [Mycobacterium tuberculosis CDC1551] NP_334701.1 3e-22 34% ...

Radiolarian Indices of Paleoproductivity Variation in the late Pleistocene Benguela Upwelling System, ODP Site 1084

Science.gov (United States)

Bittniok, B. B.; Lazarus, D. B.; Diester-Haass, L.; Billups, K.; Meyers, P.

2006-12-01

Changes in export productivity play a significant role in ocean carbon budgets and global climate change. Proxies for export productivity can be difficult to interpret: benthic foraminifera accumulation rates (BFAR) can be affected by carbonate dissolution in organic-carbon rich sediments; bulk opal can be affected by silica limitation of source waters. Recent work (Lazarus et al. 2006; Mar. Micropal.) has shown that a new index based on radiolarian faunal changes (WADE ratio) correlates well to total organic carbon (TOC) values from the same samples over the long term (latest Miocene-Recent) history of productivity in the Benguela Upwelling System (BUS). We present new data on variation in export productivity proxies (WADE, TOC, carbonate, radiolarian opal, BFAR) for the last glacial-interglacial cycle from ODP Site 1084, located just offshore from the main coastal upwelling cells of the BUS. Our age model, from mean Quaternary sedimentation rates (Leg 175 Scientific Results), is in accordance with cyclic variation in other climate sensitive parameters (carbonate and color reflectance). Although opal content and radiolarian preservation is only moderate in our samples, WADE values vary significantly and suggest higher productivity during the last glacial, in accordance with current interpretations of BUS history. Radiolarian opal accumulation is also higher during the last glacial, suggesting that silica limitation (opal paradox) conditions did not dominate over this time period. Similar results for bulk opal have been reported from late Quaternary piston cores from the more northerly Congo upwelling region (Schneider et al, 1997; Paleoc.). We conclude that WADE ratios are a useful proxy for late Pleistocene productivity in the BUS at glacial- interglacial time scales.

Ocean Drilling Program: Web Site Access Statistics

Science.gov (United States)

web site ODP/TAMU Science Operator Home Ocean Drilling Program Web Site Access Statistics* Overview See statistics for JOIDES members. See statistics for Janus database. 1997 October November December

Late Neogene benthic stable isotope record of ODP Site 999: Implications for Caribbean paleoceanography, organic carbon burial and the Messininian salinity crisis

Science.gov (United States)

Bickert, T.; Haug, G.; Tiedemann, R.

2003-04-01

The late Neogene closure of the seaway between the North and South American continents is thought to have caused extensive changes in ocean circulation and Northern Hemisphere climate. The timing and consequences of the emergence of the Isthmus of Panama for the ocean circulation have been addressed in several papers which indicate a marked reorganization of surface and deep ocean circulation starting 4.6 million years ago. However, the biogeographic development of marine faunas and floras on both sides of the Panama Isthmus suggests that the paleoceanographic changes related to the closing of the isthmus started much earlier. Furthermore, the closing history of the Panama Seaway overlaps with the tectonic evolution of other ocean gateways in the late Miocene, especially the closure of the Strait of Gibraltar, which led to a transient isolation of the Mediterranean Sea from the Atlantic Ocean, known as the Messinian Salinity Crisis. We report on epibenthic foraminiferal d18O and d13C and percentage sand records of the carbonate fraction from Caribbean ODP Site 999 (12°44´N, 78° 44´W, water depth 2828 m) spanning the interval from 8.6 to 5.3 Ma. Low epibenthic d13C values and low sand contents indicate a poorly ventilated deep Caribbean throughout the late Miocene. At this time the deep Caribbean was dominated by a nutrient-rich Southern Ocean water mass. A mostly constant d13C gradient between the Caribbean and deep Atlantic records suggests that the fluctuations in d13C reflect rather global changes in d13C of the dissolved inorganic carbon due to varying erosion of organic carbon from terrigenous soils and shelf sediments. The observed 100-ky cyclicity of epibenthic d13C is in well accordance with the variability of the terrigenous input to the equatorial Atlantic as recorded by susceptibility records of the Ceara Rise. However, some gradient changes between 6.8 and 5.6 Ma indicate a poorer ventilation of the deep Atlantic related to a reduced production of

Geochemistry of Fast-Spreading Lower Oceanic Crust: Results from Drilling at the Hess Deep Rift (ODP Leg 147 and IODP Expedition 345; East Pacific Rise)

Science.gov (United States)

Godard, M.; Falloon, T.; Gillis, K. M.; Akizawa, N.; de Brito Adriao, A.; Koepke, J.; Marks, N.; Meyer, R.; Saha, A.; Garbe-Schoenberg, C. D.

2014-12-01

The Hess Deep Rift, where the Cocos Nazca Ridge propagates into the young, fast-spread East Pacific Rise crust, exposes a dismembered, but nearly complete, lower crustal section. The extensive exposures of the plutonic crust were drilled at 3 sites during ODP Leg 147 (Nov. 1992-Jan. 1993) and IODP Expedition 345 (Dec. 2012-Feb. 2013). We report preliminary results of a bulk rock geochemical study (major and trace elements) carried out on 109 samples representative of the different drilled lithologies. The shallowest gabbroic rocks were sampled at ODP Site 894. They comprise gabbronorite, gabbro, olivine gabbro and gabbronorite. They have evolved compositions with Mg# 39-55, Yb 4-8 x chondrite and Eu/Eu* 1-1.6. Olivine gabbro and troctolite were dominant at IODP Site U1415, with minor gabbro, gabbronorite and clinopyroxene oikocryst-bearing troctolite and gabbro. All U1415 gabbroic rocks have primitive compositions except for one gabbronorite rubble that is similar in composition to the shallow gabbros. Olivine gabbro, gabbro and gabbronorite overlap in composition: they have high Mg# (79-87) and Ni (130-570 ppm), low TiO2 (0.1-0.3 wt.%) and Yb (1.3-2.3 x chondrite) and positive Eu anomaly (Eu/Eu*=1.9-2.7). Troctolite has high Mg# (81-89), Ni (260-1500 ppm) and low TiO2 (4). ODP Site 895 recovered sequences of highly depleted harzburgite, dunite and troctolite (Yb down to <0.1xchondrite) that are interpreted as a mantle-crust transition zone. Basalts were recovered at Sites 894 and U1415: they have low Yb (0.5-0.9xN6MORB) and are depleted in the most incompatible elements (Ce/Yb=0.6-0.9xN-MORB). The main geochemical characteristics of Site U1415 and 894 gabbroic rocks are consistent with formation as a cumulate sequence from a common parental MORB melt; troctolites are the most primitive end-member of this sequence. They overlap in composition with the most primitive of slow and fast spread crust gabbroic rocks.

Revisiting the Ceara Rise, equatorial Atlantic Ocean: isotope stratigraphy of ODP Leg 154 from 0 to 5 Ma

Science.gov (United States)

Wilkens, Roy H.; Westerhold, Thomas; Drury, Anna J.; Lyle, Mitchell; Gorgas, Thomas; Tian, Jun

2017-07-01

Isotope stratigraphy has become the method of choice for investigating both past ocean temperatures and global ice volume. Lisiecki and Raymo (2005) published a stacked record of 57 globally distributed benthic δ18O records versus age (LR04 stack). In this study LR04 is compared to high-resolution records collected at all of the sites drilled during ODP Leg 154 on the Ceara Rise, in the western equatorial Atlantic Ocean. Newly developed software is used to check data splices of the Ceara Rise sites and better align out-of-splice data with in-splice data. Core images recovered from core table photos are depth and age scaled and greatly assist in the data analysis. The entire splices of ODP sites 925, 926, 927, 928 and 929 were reviewed. Most changes were minor although several were large enough to affect age models based on orbital tuning. A Ceara Rise composite record of benthic δ18O is out of sync with LR04 between 1.80 and 1.90 Ma, where LR04 exhibits two maxima but Ceara Rise data contain only one. The interval between 4.0 and 4.5 Ma in the Ceara Rise compilation is decidedly different from LR04, reflecting both the low amplitude of the signal over this interval and the limited amount of data available for the LR04 stack. A regional difference in benthic δ18O of 0.2 ‰ relative to LR04 was found. Independent tuning of Site 926 images and physical property data to the Laskar et al. (2004) orbital solution and integration of available benthic stable isotope data from the Ceara Rise provides a new regional reference section for the equatorial Atlantic covering the last 5 million years.

Revisiting the Ceara Rise, equatorial Atlantic Ocean: isotope stratigraphy of ODP Leg 154

Science.gov (United States)

Wilkens, Roy; Drury, Anna Joy; Westerhold, Thomas; Lyle, Mitchell; Gorgas, Thomas; Tian, Jun

2017-04-01

Isotope stratigraphy has become the method of choice for investigating both past ocean temperatures and global ice volume. Lisiecki and Raymo (2005) published a stacked record of 57 globally distributed benthic δ18O records versus age (LR04 stack). In this study LR04 is compared to high resolution records collected at all of the sites drilled during Ocean Drilling Program (ODP) Leg 154 on the Ceara Rise, in the western equatorial Atlantic Ocean. Newly developed software - the Code for Ocean Drilling Data (CODD) - is used to check data splices of the Ceara sites and better align out-of-splice data with in-splice data. CODD allows to depth and age scaled core images recovered from core table photos enormously facilitating data analysis. The entire splices of ODP Sites 925, 926, 927, 928 and 929 were reviewed. Most changes were minor although several large enough to affect age models based on orbital tuning. We revised the astronomically tuned age model for the Ceara Rise by tuning darker, more clay rich layers to Northern Hemisphere insolation minima. Then we assembled a regional composite benthic stable isotope record from published data. This new Ceara Rise stack provides a new regional reference section for the equatorial Atlantic covering the last 5 million years with an independent age model compared to the non-linear ice volume models of the LR04 stack. Comparison shows that the benthic δ18O composite is consistent with the LR04 stack from 0 - 4 Ma despite a short interval between 1.80 and 1.90 Ma, where LR04 exhibits 2 maxima but where Ceara Rise contains only 1. The interval between 4.0 and 4.5 Ma in the Ceara Rise compilation is decidedly different from LR04, reflecting both the low amplitude of the signal over this interval and the limited amount of data available for the LR04 stack. Our results also point out that precession cycles have been misinterpreted as obliquity in the LR04 stack as suggested by the Ceara Rise composite at 4.2 Ma.

New Magnetic and 10Be/9Be results from ODP site 851 (East Equatorial Pacific)

Science.gov (United States)

Valet, J. P.; Savranskaia, T.; Anojh, T.; Meynadier, L.; Thouveny, N.; Gacem, L.; L2NC, A. T.; Bassinot, F. C.; Simon, Q.

2017-12-01

The paleomagnetic record from ODP site 851 was the first long data of relative paleointensity that attempted to describe 4 Ma of geomagnetic variations. Among other features, it was characterized by an asymmetrical saw-tooth pattern of the intensity changes across reversals. The upper part of the record (0 to 1.1 Ma) was documented by stepwise alternating field (af) demagnetization of U-channels, while the deeper part could not be sampled by U-channels and instead combined shipboard measurements and stepwise demagnetized single samples within specific intervals. Thermal demagnetization was also conducted within specific intervals to assess the absence of viscous component. We performed a new detailed study using U-channels and single samples that were taken along a continuous splice section that covers the upper 80 meters of sediment. Stepwise demagnetization of the natural magnetization and of the anhysteretic magnetization were carried out for all samples and U-channels in order to improve the resolution and the reliability of relative paleointensity for the older part of the record. The new results improve the detailed magnetostratigraphy that was formerly established and provide additional details to the paleointensity results. In parallel, 10Be/9Be measurements were carried out at the same levels as the magnetic measurements to test further the controversial asymmetrical pattern of relative paleointensity. Unfortunately, the 10Be/9Be results did not provide any consistent signal. This failure most likely results from high carbonate concentration (about 85%) that yields poor adsorption of beryllium by the sediment particles and therefore generates large fluctuations. The reliability of the paleointensity record is linked to downcore homogeneity of the sediment that is characterized by little variability of carbonate content and therefore little changes in the magnetization response to the field. Summarizing poor clay content appears to be a favorable situation

Revisiting the Ceara Rise, equatorial Atlantic Ocean: isotope stratigraphy of ODP Leg 154 from 0 to 5 Ma

Directory of Open Access Journals (Sweden)

R. H. Wilkens

2017-07-01

Full Text Available Isotope stratigraphy has become the method of choice for investigating both past ocean temperatures and global ice volume. Lisiecki and Raymo (2005 published a stacked record of 57 globally distributed benthic δ18O records versus age (LR04 stack. In this study LR04 is compared to high-resolution records collected at all of the sites drilled during ODP Leg 154 on the Ceara Rise, in the western equatorial Atlantic Ocean. Newly developed software is used to check data splices of the Ceara Rise sites and better align out-of-splice data with in-splice data. Core images recovered from core table photos are depth and age scaled and greatly assist in the data analysis. The entire splices of ODP sites 925, 926, 927, 928 and 929 were reviewed. Most changes were minor although several were large enough to affect age models based on orbital tuning. A Ceara Rise composite record of benthic δ18O is out of sync with LR04 between 1.80 and 1.90 Ma, where LR04 exhibits two maxima but Ceara Rise data contain only one. The interval between 4.0 and 4.5 Ma in the Ceara Rise compilation is decidedly different from LR04, reflecting both the low amplitude of the signal over this interval and the limited amount of data available for the LR04 stack. A regional difference in benthic δ18O of 0.2 ‰ relative to LR04 was found. Independent tuning of Site 926 images and physical property data to the Laskar et al. (2004 orbital solution and integration of available benthic stable isotope data from the Ceara Rise provides a new regional reference section for the equatorial Atlantic covering the last 5 million years.

Magnetism, X-rays and accretion rates in WD 1145+017 and other polluted white dwarf systems

Science.gov (United States)

Farihi, J.; Fossati, L.; Wheatley, P. J.; Metzger, B. D.; Mauerhan, J.; Bachman, S.; Gänsicke, B. T.; Redfield, S.; Cauley, P. W.; Kochukhov, O.; Achilleos, N.; Stone, N.

2018-02-01

This paper reports circular spectropolarimetry and X-ray observations of several polluted white dwarfs including WD 1145+017, with the aim to constrain the behaviour of disc material and instantaneous accretion rates in these evolved planetary systems. Two stars with previously observed Zeeman splitting, WD 0322-019 and WD 2105-820, are detected above 5σ and 〈Bz〉 > 1 kG, while WD 1145+017, WD 1929+011, and WD 2326+049 yield (null) detections below this minimum level of confidence. For these latter three stars, high-resolution spectra and atmospheric modelling are used to obtain limits on magnetic field strengths via the absence of Zeeman splitting, finding B* Earth composition material falling on to the magnetic polar regions of white dwarfs, where X-rays and cyclotron radiation may contribute to accretion luminosity. This analysis is applied to X-ray data for WD 1145+017, WD 1729+371, and WD 2326+049, and the upper bound count rates are modelled with spectra for a range of plasma kT = 1-10 keV in both the magnetic and non-magnetic accretion regimes. The results for all three stars are consistent with a typical dusty white dwarf in a steady state at 108-109 g s-1. In particular, the non-magnetic limits for WD 1145+017 are found to be well below previous estimates of up to 1012 g s-1, and likely below 1010 g s-1, thus suggesting the star-disc system may be average in its evolutionary state, and only special in viewing geometry.

Remaining Sites Verification Package for the 100-B-18, 184-B Powerhouse Debris Pile. Attachment to Waste Site Reclassification Form 2007-020

International Nuclear Information System (INIS)

Dittmer, L.M.

2007-01-01

The 100-B-18 Powerhouse Debris Pile contained miscellaneous demolition waste from the decommissioning activities of the 184-B Powerhouse. The debris covered an area roughly 15 m by 30 m and included materials such as concrete blocks, mixed aggregate/concrete slabs, stone rubble, asphalt rubble, traces of tar/coal, broken fluorescent lights, brick chimney remnants, and rubber hoses. In accordance with this evaluation, the verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River

Study of the decay 184Hg→184Au (Tsub(1/2)=30s)

International Nuclear Information System (INIS)

Nettles, W.G.; Beraud, R.; Cole, J.D.; Hamilton, J.H.; Ramayya, A.V.; Kawakami, H.; Spejewski, E.H.

1978-01-01

The radioactive decay of 184 Hg to 184 Au was studied on line with the UNISOR isotope separator. The 184 mass chain was entered at 184 Tl and 184 Hg by bombarding an isotopically-enriched target of 180 W with 14 N ions of 177 MeV. Multiscale singles and γ-γ-time coincidence studies were carried out. No previous levels have been assigned to 184 Au. From the coincidence data eight levels at 156.2, 159.1, 247.7, 282.8, 295.1, 392.4, 418.0 and 412.4 keV are assigned and two tentative levels at 534.0 and 551.6 keV are proposed. By using the delayed coincidence technique, a half-life of 36+-6 nanoseconds was measured for the 156.2 keV first-excited level and upper limits of 2 nanoseconds were determined for the half-lives of levels at 159.1, 247.7, 295.1 and 392.4 keV [fr

40 CFR 180.1145 - Pseudomonas syringae; exemption from the requirement of a tolerance.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Pseudomonas syringae; exemption from... FOOD Exemptions From Tolerances § 180.1145 Pseudomonas syringae; exemption from the requirement of a tolerance. Pseudomonas syringae is exempted from the requirement of a tolerance on all raw agricultural...

Refining the Early and Middle Eocene Geomagnetic Polarity Time Scale: new results from ODP Leg 208 (Walvis Ridge)

Science.gov (United States)

Westerhold, T.; Roehl, U.; Frederichs, T.; Bohaty, S. M.; Florindo, F.; Zachos, J. C.; Raffi, I.; Agnini, C.

2015-12-01

Astronomical calibration of the Geomagnetic Polarity Time Scale (GPTS) for the Eocene (34-56 Ma) has advanced tremendously in recent years. Combining a cyclostratigraphic approach based on the recognition of the stable 405-kyr eccentricity cycle of Earth's orbit with high-resolution bio- and magnetostratigraphy from deep-sea sedimentary records (ODP Legs 171B, 189 and 207; IODP Exp. 320/321) resulted in a new calibration of the middle-to-late Eocene GPTS spanning Chrons C12r to C19n (30.9-41.3 Ma). A fully astronomically calibrated GPTS for the Eocene was established recently by integrating cyclo-bio-magnetostratigraphy from ODP Sites 702 and 1263 records spanning the middle Eocene with Site 1258 records covering the early Eocene. Comparison of this deep sea-derived GPTS with GTS2012 and GPTS calibration points from terrestrial successions show overall consistent results, but there are still major offsets for the duration of Chrons C20r, C22r and C23n.2n. Because of the relatively large uncertainty of the calibration point, a radioisotopic dated ash layer in DSDP 516F, at C21n.75 (46.24±0.5 Ma) the duration of C20r in GPTS2012 (2.292 myr) is uncertain. Offsets in durations of C22r and C23n.2n between GPTS2012 and the new astronomical GPTS (~400-kyr longer C22r; ~400-kyr shorter C23n.2n) could be due to uncertainties in the interpretation of Site 1258 magnetostratigraphic data. Here we present new results toward establishing a more accurate and complete bio-, magneto- and chemostratigraphy for South Atlantic Leg 208 sites encompassing magnetochrons C13 to C24 (33 to 56 Ma). Our study aims to integrate paleomagnetic records from multiple drilled sites with physical property data, stable isotope data and XRF core scanning data to construct an astronomically calibrated framework for refining GPTS age estimates. This effort will complete the Early-to-Middle Eocene GPTS and allow evaluation of the relative position of calcareous nannofossil events to magnetostratigraphy.

CAMAC/PDP 11-45 coupler

International Nuclear Information System (INIS)

Pascual, Joseph; Raoul, J.-C.

1978-04-01

The complex experimental devices used in high energy physics require the use of minicomputers. The latter are coupled to the detectors using the CAMAC standard which has been adopted by the majority of high energy physics laboratories, much to the ease of international collaboration. The performance of industrially available interfaces having shown to be inadequate, the DPhPE has undertaken the development of a multibranche CAMAC/PDP 11-45 coupler. This system can control up to 49 crates shared out between 7 branches. It consists of a programmed channel and up to three high speed (556 Kwords/second) automatic channels. The four channels can work simultaneously through time sharing. The coupler includes a LAM handling system. The correspondent software has been developed simultaneously: the monitor is an extended version of the RT 11 system supplied by the manufacturer. This interface has been used so far in five experiments on the CERN PS and SPS. Besides this publication, intended to give a description of the coupler, a user's utilisation manuel exists in English [fr

On the foundation for roles in RM-ODP: contributions from conceptual modelling

NARCIS (Netherlands)

Guizzardi, G.; Andrade Almeida, João; Linington, P.F.; Vallecillo, A.; Wood, B.

2007-01-01

In this paper, we attempt to provide a semantic foundation for the role-related concepts in the RM-ODP. We believe that some theories of conceptual modelling may help us to provide a well-founded underpinning for these concepts, and to harmonize competing proposals for them. As a starting point of

21 CFR 184.1400 - Lecithin.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Lecithin. 184.1400 Section 184.1400 Food and Drugs... Substances Affirmed as GRAS § 184.1400 Lecithin. (a) Commercial lecithin is a naturally occurring mixture of... isolated as a gum following hydration of solvent-extracted soy, safflower, or corn oils. Lecithin is...

21 CFR 184.1540 - Nitrogen.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Nitrogen. 184.1540 Section 184.1540 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1540 Nitrogen. (a) Nitrogen (empirical formula N2, CAS Reg. No. 7727-37-9...

21 CFR 184.1835 - Sorbitol.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Sorbitol. 184.1835 Section 184.1835 Food and Drugs... Substances Affirmed as GRAS § 184.1835 Sorbitol. (a) Sorbitol is the chemical 1,2,3,4,5,6-hexanehexol.... Sorbitol is produced by the electrolytic reduction, or the transition metal catalytic hydrogenation of...

21 CFR 184.1923 - Urea.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Urea. 184.1923 Section 184.1923 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1923 Urea. (a) Urea (CO(NH2)2, CAS Reg. No. 57-13-6) is the diamide of...

21 CFR 184.1979 - Whey.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Whey. 184.1979 Section 184.1979 Food and Drugs FOOD... Substances Affirmed as GRAS § 184.1979 Whey. (a)(1) Whey. Whey is the liquid substance obtained by separating the coagulum from milk, cream, or skim milk in cheesemaking. Whey obtained from a procedure, in which...

21 CFR 184.1695 - Riboflavin.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Riboflavin. 184.1695 Section 184.1695 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1695 Riboflavin. (a) Riboflavin (C17H20N4O6, CAS Reg. No. 83-88-5) occurs...

Low-lying states of 184W and 184Os nuclei

International Nuclear Information System (INIS)

Sharrad, F.I.; Abdullah, Hewa Y.; Al-Dahan, N.; Umran, N.M.; Okhunov, A.A.; Abu Kassim, H.

2013-01-01

The energy levels, transition energy, B(E2) values, intrinsic quadrupole moment Q 0 and potential energy surface for even-even 184 W and 184 Os nuclei were calculated using IBM-1. The predicted energy levels, transition energy, B(E2) values and intrinsic quadrupole moment Q 0 results are reasonably consistent with the experimental data. A contour plot of the potential energy surfaces shows that two interesting nuclei are deformed and have rotational characters. (authors)

The Pleistocene evolution of the East Antarctic Ice Sheet in the Prydz bay region: Stable isotopic evidence from ODP Site 1167

Science.gov (United States)

Theissen, K.M.; Dunbar, R.B.; Cooper, A. K.; Mucciarone, D.A.; Hoffmann, D.

2003-01-01

Ocean Drilling Program Leg 188, Prydz Bay, East Antarctica is part of a larger initiative to explore the Cenozoic history of the Antarctic Ice Sheet through direct drilling and sampling of the continental margins. In this paper, we present stable isotopic results from Ocean Drilling Program (ODP) Site 1167 located on the Prydz Channel Trough Mouth Fan (TMF), the first Antarctic TMF to be drilled. The foraminifer-based ??18O record is interpreted along with sedimentary and downhole logging evidence to reconstruct the Quaternary glacial history of Prydz Bay and the adjacent Lambert Glacier Amery Ice Shelf System (LGAISS). We report an electron spin resonance age date of 36. 9 ?? 3.3 ka at 0.45 m below sea floor and correlate suspected glacial-interglacial cycles with the global isotopic stratigraphy to improve the chronology for Site 1167. The ??18O record based on planktonic (Neogloboquadrina pachyderma (s.)) and limited benthic results (Globocassidulina crassa), indicates a trend of ice sheet expansion that was interrupted by a period of reduced ice volume and possibly warmer conditions during the early-mid-Pleistocene (0.9-1.38 Ma). An increase in ?? 18O values after ??? 900 ka appears to coincide with the mid-Pleistocene climate transition and the expansion of the northern hemisphere ice sheet. The ??18O record in the upper 50 m of the stratigraphic section indicates as few as three glacial-interglacial cycles, tentatively assigned as marine isotopic stages (MIS) 16-21, are preserved since the Brunhes/Matuyama paleomagnetic reversal (780 ka). This suggests that there is a large unconformity near the top of the section and/or that there may have been few extreme advances of the ice sheet since the mid-Pleistocene climate transition resulting in lowered sedimentation rates on the Prydz Channel TMF. The stable isotopic record from Site 1167 is one of the few available from the area south of the Antarctic Polar Front that has been linked with the global isotopic

Decreased expression of LamB and Odp1 complex is crucial for antibiotic resistance in Escherichia coli.

Science.gov (United States)

Lin, Xiang-min; Yang, Man-jun; Li, Hui; Wang, Chao; Peng, Xuan-Xian

2014-02-26

We previously revealed a negative regulation of LamB in chlortetracycline-resistant Escherichia coli strain. In the present study, we first showed that the negative regulation, which was characterized by decreased abundance of LamB with elevated growth of its gene-deleted mutant in medium with antibiotics, was a general response in resistance to different classes of antibiotics using 2-DE based proteomics or/and genetically gene-deletion mutant of LamB. Then, we revealed the interaction of LamB and Odp1 which catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2, and found the decrease of the complex in antibiotic-resistant strains with a minimum inhibitory concentration dose-dependent manner. Further spectrofluorometry assay indicated that LamB served as a porin to influx an antibiotic. Finally, we showed that the decreased expression of LamB and Odp1 was detected in almost of all 34 multidrug-resistant strains, which suggested that LamB and Odp1 were biomarkers for identification of antibiotic-resistant E. coli. Our results indicated that the interaction of an outer membrane protein with an energy metabolic enzyme constructed an efficient pathway to resist antibiotics. These findings provide novel insights into the mechanisms of antibiotic resistance. Our data indicate that the negative regulation by LamB is widely detected in antibiotic-resistant E. coli. LamB serves as a porin to influx an antibiotic and is interacted with Odp1. The complex decreases in antibiotic-resistant strains with a MIC dose-dependent manner. Our findings indicate that interaction of outer membrane protein with energy metabolic enzyme constructs an efficient pathway to resist antibiotics and provides novel insights into the mechanisms of antibiotic resistance. Copyright © 2014 Elsevier B.V. All rights reserved.

46 CFR 184.210 - Heating equipment.

Science.gov (United States)

2010-10-01

... 46 Shipping 7 2010-10-01 2010-10-01 false Heating equipment. 184.210 Section 184.210 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) VESSEL CONTROL AND MISCELLANEOUS SYSTEMS AND EQUIPMENT Cooking and Heating § 184.210 Heating equipment...

Late Pliocene/Pleistocene changes in Arctic sea-ice cover: Biomarker and dinoflagellate records from Fram Strait/Yermak Plateau (ODP Sites 911 and 912)

Science.gov (United States)

Stein, Ruediger; Fahl, Kirsten; Matthiessen, Jens

2014-05-01

Sea ice is a critical component in the (global) climate system that contributes to changes in the Earth's albedo (heat reduction) and biological processes (primary productivity), as well as deep-water formation, a driving mechanism for global thermohaline circulation. Thus, understanding the processes controlling Arctic sea ice variability is of overall interest and significance. Recently, a novel and promising biomarker proxy for reconstruction of Arctic sea-ice conditions was developed and is based on the determination of a highly-branched isoprenoid with 25 carbons (IP25; Belt et al., 2007; PIP25 when combined with open-water phytoplankton biomarkers; Müller et al., 2011). Here, we present biomarker data from Ocean Drilling Program (ODP) Sites 911 and 912, recovered from the southern Yermak Plateau and representing information of sea-ice variability, changes in primary productivity and terrigenous input during the last about 3.5 Ma. As Sites 911 and 912 are close to the modern sea-ice edge, their sedimentary records seem to be optimal for studying past variability in sea-ice coverage and testing the applicability of IP25 and PIP25 in older sedimentary sequences. In general, our biomarker records correlate quite well with other climate and sea-ice proxies (e.g., dinoflagellates, IRD, etc.). The main results can be summarized as follows: (1) The novel IP25/PIP25 biomarker approach has potential for semi-quantitative paleo-sea ice studies covering at least the last 3.5 Ma, i.e., the time interval including the onset (intensification) of major Northern Hemisphere Glaciation (NHG). (2) These data indicate that sea ice of variable extent was present in the Fram Strait/southern Yermak Plateau area during most of the time period under investigation. (3) Elevated IP25/PIP25 values indicative for an extended spring sea-ice cover, already occurred between 3.6 and 2.9 Ma, i.e., prior to the onset of major NHG. This may suggest that sea-ice and related albedo effects might

21 CFR 184.1631 - Potassium hydroxide.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Potassium hydroxide. 184.1631 Section 184.1631 Food... Specific Substances Affirmed as GRAS § 184.1631 Potassium hydroxide. (a) Potassium hydroxide (KOH, CAS Reg... pellets, flakes, sticks, lumps, and powders. Potassium hydroxide is obtained commercially from the...

46 CFR 184.220 - Cooking equipment.

Science.gov (United States)

2010-10-01

... 46 Shipping 7 2010-10-01 2010-10-01 false Cooking equipment. 184.220 Section 184.220 Shipping...) VESSEL CONTROL AND MISCELLANEOUS SYSTEMS AND EQUIPMENT Cooking and Heating § 184.220 Cooking equipment. (a) Doors on a cooking appliance must be provided with hinges and locking devices to prevent...

CRED Ocean Data Platform (ODP), Acoustic Doppler Profiler (ADP); Guam, SRR; Long: 144.41778, Lat: 12.83819 (WGS84); Sensor Depth: 20.42m; Data Range: 20051007-20070121.

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

CRED Ocean Data Platform (ODP), Acoustic Doppler Profiler (ADP); NWHI, PHR; Long: -175.88112, Lat: 27.78204 (WGS84); Sensor Depth: 21.34m; Data Range: 20060922-20070805.

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

CRED Ocean Data Platform (ODP), Acoustic Doppler Profiler (ADP); PRIA, BAK; Long: -176.46025, Lat: 00.19005 (WGS84); Sensor Depth: 18.90m; Data Range: 20020201-20040122.

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

CRED Ocean Data Platform (ODP), Acoustic Doppler Profiler (ADP); NWHI, PHR; Long: -175.88110, Lat: 27.78209 (WGS84); Sensor Depth: 21.34m; Data Range: 20070806-20070912.

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

CRED Ocean Data Platform (ODP), Acoustic Doppler Profiler (ADP); AMSM, SWA; Long: -171.09092, Lat: -11.05848 (WGS84); Sensor Depth: 15.00m; Data Range: 20020227-20021207.

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

CRED Ocean Data Platform (ODP), Acoustic Doppler Profiler (ADP); PRIA, JAR; Long: -160.01553, Lat: -00.37917 (WGS84); Sensor Depth: 15.00m; Data Range: 20020311-20040325.

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

CRED Ocean Data Platform (ODP), Acoustic Doppler Profiler (ADP); PRIA, BAK; Long: -176.46012, Lat: 00.18994 (WGS84); Sensor Depth: 19.81m; Data Range: 20080210-20100130.

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

CRED Ocean Data Platform (ODP), Acoustic Doppler Profiler (ADP); PRIA, BAK; Long: -176.46012, Lat: 00.18994 (WGS84); Sensor Depth: 18.80m; Data Range: 20060131-20080209.

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

CRED Ocean Data Platform (ODP), Acoustic Doppler Profiler (ADP); PRIA, BAK; Long: -176.46025, Lat: 00.19005 (WGS84); Sensor Depth: 18.90m; Data Range: 20040123-20060130.

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

Structure of doubly-odd nucleus 184Ir from the decay of 184Pt

International Nuclear Information System (INIS)

Ben Braham, A.; Bourgeois, C.; Kilcher, P.; Roussiere, B.; Sauvage, J.; Kreiner, A.J.; Porquet, M.G.

1987-01-01

States of 184 Ir populated through the β + /EC decay of 184 Pt, were studied using mass-separated sources and on-line γ-ray and e - spectroscopy techniques. A rather complete low-spin level scheme is established. Negative and positive parity structures are interpreted within the two-quasiparticle-plus-rotor model

21 CFR 184.1622 - Potassium chloride.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Potassium chloride. 184.1622 Section 184.1622 Food... Specific Substances Affirmed as GRAS § 184.1622 Potassium chloride. (a) Potassium chloride (KCl, CAS Reg... levels not to exceed current good manufacturing practice. Potassium chloride may be used in infant...

21 CFR 184.1643 - Potassium sulfate.

Science.gov (United States)

2010-04-01

... hydroxide or potassium carbonate. (b) The ingredient meets the specifications of the “Food Chemicals Codex... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Potassium sulfate. 184.1643 Section 184.1643 Food... Specific Substances Affirmed as GRAS § 184.1643 Potassium sulfate. (a) Potassium sulfate (K2SO4, CAS Reg...

21 CFR 184.1702 - Sheanut oil.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Sheanut oil. 184.1702 Section 184.1702 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1702 Sheanut oil. (a) Sheanut oil is produced from sheanuts derived from...

21 CFR 184.1555 - Rapeseed oil.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Rapeseed oil. 184.1555 Section 184.1555 Food and... Substances Affirmed as GRAS § 184.1555 Rapeseed oil. (a) Fully hydrogenated rapeseed oil. (1) Fully hydrogenated rapeseed oil is a mixture of triglycerides in which the fatty acid composition is a mixture of...

46 CFR 184.240 - Gas systems.

Science.gov (United States)

2010-10-01

... 46 Shipping 7 2010-10-01 2010-10-01 false Gas systems. 184.240 Section 184.240 Shipping COAST... CONTROL AND MISCELLANEOUS SYSTEMS AND EQUIPMENT Cooking and Heating § 184.240 Gas systems. Cooking systems... requirements: (a) The design, installation and testing of each LPG system must meet ABYC A-1, “Marine Liquefied...

21 CFR 184.1848 - Starter distillate.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Starter distillate. 184.1848 Section 184.1848 Food... Specific Substances Affirmed as GRAS § 184.1848 Starter distillate. (a) Starter distillate (butter starter distillate) is a steam distillate of the culture of any or all of the following species of bacteria grown on...

21 CFR 184.1351 - Gum tragacanth.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Gum tragacanth. 184.1351 Section 184.1351 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1351 Gum tragacanth. (a) Gum tragacanth is the exudate from one of several...

21 CFR 184.1978 - Carnauba wax.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Carnauba wax. 184.1978 Section 184.1978 Food and... Substances Affirmed as GRAS § 184.1978 Carnauba wax. (a) Carnauba wax (CAS Reg. No. 008-015-869) is obtained from the leaves and buds of the Brazilian wax palm Copernicia cerifera Martius. The wax is hard...

21 CFR 184.1443 - Magnesium sulfate.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Magnesium sulfate. 184.1443 Section 184.1443 Food... Specific Substances Affirmed as GRAS § 184.1443 Magnesium sulfate. (a) Magnesium sulfate (MgSO4·7H2O, CAS... magnesium oxide, hydroxide, or carbonate with sulfuric acid and evaporating the solution to crystallization...

21 CFR 184.1431 - Magnesium oxide.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Magnesium oxide. 184.1431 Section 184.1431 Food and... Substances Affirmed as GRAS § 184.1431 Magnesium oxide. (a) Magnesium oxide (MgO, CAS Reg. No. 1309-48-4... powder (light) or a relatively dense white powder (heavy) by heating magnesium hydroxide or carbonate...

21 CFR 184.1322 - Wheat gluten.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Wheat gluten. 184.1322 Section 184.1322 Food and... Substances Affirmed as GRAS § 184.1322 Wheat gluten. (a) Wheat gluten (CAS Reg. No. 8002-80-0) is the principal protein component of wheat and consists mainly of gliadin and glutenin. Wheat gluten is obtained...

21 CFR 184.1321 - Corn gluten.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Corn gluten. 184.1321 Section 184.1321 Food and... Substances Affirmed as GRAS § 184.1321 Corn gluten. (a) Corn gluten (CAS Reg. No. 66071-96-3), also known as corn gluten meal, is the principal protein component of corn endosperm. It consists mainly of zein and...

21 CFR 184.1865 - Corn syrup.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Corn syrup. 184.1865 Section 184.1865 Food and... Substances Affirmed as GRAS § 184.1865 Corn syrup. (a) Corn syrup, commonly called “glucose sirup” or “glucose syrup,” is obtained by partial hydrolysis of corn starch with safe and suitable acids or enzymes...

21 CFR 184.1859 - Invert sugar.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Invert sugar. 184.1859 Section 184.1859 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1859 Invert sugar. (a) Invert sugar (CAS Reg. No. 8013-17-0) is an aqueous...

21 CFR 184.1240 - Carbon dioxide.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Carbon dioxide. 184.1240 Section 184.1240 Food and... Substances Affirmed as GRAS § 184.1240 Carbon dioxide. (a) Carbon dioxide (empirical formula CO2, CAS Reg. No.... The solid form, dry ice, sublimes under atmospheric pressure at a temperature of −78.5 °C. Carbon...

21 CFR 184.1472 - Menhaden oil.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Menhaden oil. 184.1472 Section 184.1472 Food and... Substances Affirmed as GRAS § 184.1472 Menhaden oil. (a) Menhaden oil. (1) Menhaden oil is prepared from fish of the genus Brevoortia, commonly known as menhaden, by cooking and pressing. The resulting crude oil...

21 CFR 184.1138 - Ammonium chloride.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ammonium chloride. 184.1138 Section 184.1138 Food... Specific Substances Affirmed as GRAS § 184.1138 Ammonium chloride. (a) Ammonium chloride (NH4Cl, CAS Reg. No. 12125-02-9) is produced by the reaction of sodium chloride and an ammonium salt in solution. The...

21 CFR 184.1446 - Manganese chloride.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Manganese chloride. 184.1446 Section 184.1446 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Specific Substances Affirmed as GRAS § 184.1446 Manganese chloride. (a) Manganese chloride (MnCl2·4H2O, CAS...

21 CFR 184.1297 - Ferric chloride.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ferric chloride. 184.1297 Section 184.1297 Food and... Substances Affirmed as GRAS § 184.1297 Ferric chloride. (a) Ferric chloride (iron (III) chloride, FeC13, CAS Reg. No. 7705-08-0) may be prepared from iron and chlorine or from ferric oxide and hydrogen chloride...

21 CFR 184.1426 - Magnesium chloride.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Magnesium chloride. 184.1426 Section 184.1426 Food... Specific Substances Affirmed as GRAS § 184.1426 Magnesium chloride. (a) Magnesium chloride (MgC12·6H2O, CAS... hydrochloric acid solution and crystallizing out magnesium chloride hexahydrate. (b) The ingredient meets the...

21 CFR 184.1545 - Nitrous oxide.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Nitrous oxide. 184.1545 Section 184.1545 Food and... Substances Affirmed as GRAS § 184.1545 Nitrous oxide. (a) Nitrous oxide (empirical formula N2O, CAS Reg. No.... Nitrous oxide is manufactured by the thermal decomposition of ammonium nitrate. Higher oxides of nitrogen...

21 CFR 184.1742 - Sodium carbonate.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Sodium carbonate. 184.1742 Section 184.1742 Food... Specific Substances Affirmed as GRAS § 184.1742 Sodium carbonate. (a) Sodium carbonate (Na2CO3, CAS Reg. No... ore calcined to impure soda ash and then purified; or (3) synthesized from limestone by the Solvay...

21 CFR 184.1095 - Sulfuric acid.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Sulfuric acid. 184.1095 Section 184.1095 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1095 Sulfuric acid. (a) Sulfuric acid (H2SO4, CAS Reg. No. 7664-93-9), also...

21 CFR 184.1415 - Animal lipase.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Animal lipase. 184.1415 Section 184.1415 Food and... Substances Affirmed as GRAS § 184.1415 Animal lipase. (a) Animal lipase (CAS Reg. No. 9001-62-1) is an enzyme preparation obtained from edible forestomach tissue of calves, kids, or lambs, or from animal pancreatic...

Elemental concentration variations in Plio-Pleistocene sediments from ODP Site 1143 (southern South China Sea) obtained by XRF analyses

Science.gov (United States)

Tian, J.; Xie, X.; Jin, H.; Wang, P.; Jian, Z.

2009-12-01

Energy dispersive X-ray fluorescence (XRF) scanning technology provides the most accurate and most economic analytical methods for the determination of major and minor elements of the deep-sea sediment ranging from sodium (11) to uranium (92). Scanning on the smooth core surface by XRF Core scanner is reliable and non-destructive to the sediment, requiring little or no time to prepare the core. This method overcomes the drawback of the traditional analytical method by ICP-AES or ICP-MS which requires long time for sample preparation. Thus, it makes it viable to reconstruct long and high-resolution elemental time series from sediment cores. We have performed relatively elemental concentration analyses on the deep sea sediment cores from ODP site 1143 (southern SCS) down to 190.77 mcd (meters composite depth) by XRF core scanner. The depth resolution of the scanning is 1 cm, equivalent to a time resolution of ~250 years. The age model is based on tuning the benthic foraminiferal d18O at Site 1143 to obliquity and precession (Tian et al., 2002) which indicates that the 190.77 meters long sediment spans the past 5 Myr. We compared the records between 99.5 and 136.46 mcd with the elemental records from the same site obtained by Philips PW 2400 X-ray spectrometer (Wehausen et al., online publication). Comparison reveals, regardless of the absolute changes of the elements, that the elemental records (Si, Ti, Al, Fe, Mn, Ca, K, P, Ba, Rb, Sr) obtained by two methods are nearly the same. Results show that the relative concentration variations of the productivity related elements such as Ba and Ca display distinctive glacial-interglacial cycles for the past 5 Myr. These productivity cycles recorded show one-on-one relationship with the glacial-interglacial cycles of the global ice volume change recorded in the benthic foraminiferal d18O. The glacial-interglacial cycles in productivity and global ice volume changes are consistent with each other not only in amplitude but also

21 CFR 184.1625 - Potassium citrate.

Science.gov (United States)

2010-04-01

... acid with potassium hydroxide or potassium carbonate. It occurs as transparent crystals or a white... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Potassium citrate. 184.1625 Section 184.1625 Food... Specific Substances Affirmed as GRAS § 184.1625 Potassium citrate. (a) Potassium citrate (C6H5K3O7·H2O, CAS...

21 CFR 184.1207 - Calcium lactate.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Calcium lactate. 184.1207 Section 184.1207 Food and... Substances Affirmed as GRAS § 184.1207 Calcium lactate. (a) Calcium lactate (C6H10CaO6.xH2O, where x is any... calcium carbonate or calcium hydroxide. (b) The ingredient meets the specifications of the Food Chemicals...

21 CFR 184.1229 - Calcium stearate.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Calcium stearate. 184.1229 Section 184.1229 Food... Specific Substances Affirmed as GRAS § 184.1229 Calcium stearate. (a) Calcium stearate (Ca(C17H35COO)2, CAS Reg. No. 1529-23-0) is the calcium salt of stearic acid derived from edible sources. It is prepared as...

21 CFR 184.1206 - Calcium iodate.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Calcium iodate. 184.1206 Section 184.1206 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1206 Calcium iodate. (a) Calcium iodate [Ca(IO3)2·H2O, CAS Reg. No. 7789-80...

21 CFR 184.1210 - Calcium oxide.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Calcium oxide. 184.1210 Section 184.1210 Food and... Substances Affirmed as GRAS § 184.1210 Calcium oxide. (a) Calcium oxide (CaO, CAS Reg. No. 1305-78-8) is also known as lime, quick lime, burnt lime, or calx. It is produced from calcium carbonate, limestone, or...

21 CFR 184.1930 - Vitamin A.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Vitamin A. 184.1930 Section 184.1930 Food and Drugs... Substances Affirmed as GRAS § 184.1930 Vitamin A. (a)(1) Vitamin A (retinol; CAS Reg. No. 68-26-8) is the... odorless or have a mild fishy odor. Vitamin A is extracted from fish liver oils or produced by total...

21 CFR 184.1890 - α-Tocopherols.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true α-Tocopherols. 184.1890 Section 184.1890 Food and... Substances Affirmed as GRAS § 184.1890 α-Tocopherols. (a) The α-tocopherols that are the subject of this GRAS affirmation regulation are limited to the following: (1) d-α-Tocopherol (CAS Reg. No. 59-02-9) is the chemical...

21 CFR 184.1271 - L-Cysteine.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true L-Cysteine. 184.1271 Section 184.1271 Food and... Substances Affirmed as GRAS § 184.1271 L-Cysteine. (a) L-Cysteine is the chemical L-2-amino-3... of total L-cysteine per 100 parts of flour in dough as a dough strengthener as defined in § 170.3(o...

21 CFR 184.1193 - Calcium chloride.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Calcium chloride. 184.1193 Section 184.1193 Food... Specific Substances Affirmed as GRAS § 184.1193 Calcium chloride. (a) Calcium chloride (CaCl2·2H2O, CAS Reg. No. 10035-04-8) or anhydrous calcium chloride (CaCl2, CAS Reg. No. 10043-52-4) may be commercially...

21 CFR 184.1061 - Lactic acid.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Lactic acid. 184.1061 Section 184.1061 Food and... Substances Affirmed as GRAS § 184.1061 Lactic acid. (a) Lactic acid (C3H6O3, CAS Reg. Nos.: dl mixture, 598... hydrogen cyanide and subsequent hydrolysis to lactic acid. (b) The ingredient meets the specifications of...

21 CFR 184.1081 - Propionic acid.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Propionic acid. 184.1081 Section 184.1081 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1081 Propionic acid. (a) Propionic acid (C3H6O2, CAS Reg. No. 79-09-4) is...

21 CFR 184.1021 - Benzoic acid.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Benzoic acid. 184.1021 Section 184.1021 Food and... Substances Affirmed as GRAS § 184.1021 Benzoic acid. (a) Benzoic acid is the chemical benzenecarboxylic acid (C7H6O2), occurring in nature in free and combined forms. Among the foods in which benzoic acid occurs...

21 CFR 184.1065 - Linoleic acid.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Linoleic acid. 184.1065 Section 184.1065 Food and... Substances Affirmed as GRAS § 184.1065 Linoleic acid. (a) Linoleic acid ((Z, Z)-9, 12-octadecadienoic acid (C17H31COOH) (CAS Reg. No. 60-33-3)), a straight chain unsaturated fatty acid with a molecular weight of 280.5...

21 CFR 184.1091 - Succinic acid.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Succinic acid. 184.1091 Section 184.1091 Food and... Substances Affirmed as GRAS § 184.1091 Succinic acid. (a) Succinic acid (C4H6O4, CAS Reg. No. 110-15-6), also referred to as amber acid and ethylenesuccinic acid, is the chemical 1,4-butanedioic acid. It is...

21 CFR 184.1090 - Stearic acid.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Stearic acid. 184.1090 Section 184.1090 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1090 Stearic acid. (a) Stearic acid (C18H36O2, CAS Reg. No. 57-11-4) is a...

21 CFR 184.1261 - Copper sulfate.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Copper sulfate. 184.1261 Section 184.1261 Food and... Substances Affirmed as GRAS § 184.1261 Copper sulfate. (a) Copper sulfate (cupric sulfate, CuSO4·5H2O, CAS... the reaction of sulfuric acid with cupric oxide or with copper metal. (b) The ingredient must be of a...

MicroRNA-184 inhibits neuroblastoma cell survival through targeting the serine/threonine kinase AKT2

Directory of Open Access Journals (Sweden)

Murphy Derek M

2010-04-01

Full Text Available Abstract Background Neuroblastoma is a paediatric cancer of the sympathetic nervous system. The single most important genetic indicator of poor clinical outcome is amplification of the MYCN transcription factor. One of many down-stream MYCN targets is miR-184, which is either directly or indirectly repressed by this transcription factor, possibly due to its pro-apoptotic effects when ectopically over-expressed in neuroblastoma cells. The purpose of this study was to elucidate the molecular mechanism by which miR-184 conveys pro-apoptotic effects. Results We demonstrate that the knock-down of endogenous miR-184 has the opposite effect of ectopic up-regulation, leading to enhanced neuroblastoma cell numbers. As a mechanism of how miR-184 causes apoptosis when over-expressed, and increased cell numbers when inhibited, we demonstrate direct targeting and degradation of AKT2, a major downstream effector of the phosphatidylinositol 3-kinase (PI3K pathway, one of the most potent pro-survival pathways in cancer. The pro-apoptotic effects of miR-184 ectopic over-expression in neuroblastoma cell lines is reproduced by siRNA inhibition of AKT2, while a positive effect on cell numbers similar to that obtained by the knock-down of endogenous miR-184 can be achieved by ectopic up-regulation of AKT2. Moreover, co-transfection of miR-184 with an AKT2 expression vector lacking the miR-184 target site in the 3'UTR rescues cells from the pro-apoptotic effects of miR-184. Conclusions MYCN contributes to tumorigenesis, in part, by repressing miR-184, leading to increased levels of AKT2, a direct target of miR-184. Thus, two important genes with positive effects on cell growth and survival, MYCN and AKT2, can be linked into a common genetic pathway through the actions of miR-184. As an inhibitor of AKT2, miR-184 could be of potential benefit in miRNA mediated therapeutics of MYCN amplified neuroblastoma and other forms of cancer.

Study of the decay /sup 184/Hg. -->. /sup 184/Au (Tsub(1/2)=30s). [Lifetime, upper limits

Energy Technology Data Exchange (ETDEWEB)

Nettles, W G; Beraud, R; Cole, J D; Hamilton, J H; Ramayya, A V; Kawakami, H [Vanderbilt Univ., Nashville, TN (USA). Dept. of Physics; Sastry, K S.R. [Massachusetts Univ., Amherst (USA); Spejewski, E H

1978-04-01

The radioactive decay of /sup 184/Hg to /sup 184/Au was studied on line with the UNISOR isotope separator. The 184 mass chain was entered at /sup 184/Tl and /sup 184/Hg by bombarding an isotopically-enriched target of /sup 180/W with /sup 14/N ions of 177 MeV. Multiscale singles and ..gamma..-..gamma..-time coincidence studies were carried out. No previous levels have been assigned to /sup 184/Au. From the coincidence data eight levels at 156.2, 159.1, 247.7, 282.8, 295.1, 392.4, 418.0 and 412.4 keV are assigned and two tentative levels at 534.0 and 551.6 keV are proposed. By using the delayed coincidence technique, a half-life of 36+-6 nanoseconds was measured for the 156.2 keV first-excited level and upper limits of 2 nanoseconds were determined for the half-lives of levels at 159.1, 247.7, 295.1 and 392.4 keV.

A control and data processing system for neutron time-of-flight experiments at the Harwell linear accelerator based on a PDP-11/45 mini-computer

International Nuclear Information System (INIS)

Chapman, W.S.; Boyce, D.A.; Brisland, J.B.; Langman, A.E.; Morris, D.V.; Schomberg, M.G.; Webb, D.A.

1977-05-01

The subject is treated in sections, entitled: introduction (experimental method, need for the PDP-11/45 based system); features required in the control and data processing system; description of the selected system configuration (PDP 11/45 mini-computer and RSX-11 D operating system, the single parameter experimental stations (the CAMAC units, the time-of-flight scaler)); description of the applications software; system performance. (U.K.)

Uppermost Cretaceous to middle Oligocene carbon and oxygen isotope stratigraphy of Southwest Pacific : holes 1121B and 1124C, ODP Leg 181

International Nuclear Information System (INIS)

Wei, K.-Y.; Mii, H.-S.; Shu, I-T.; Lin, Y.-J.

2005-01-01

Oxygen and carbon isotopic ratios of bulk sediments from ODP Leg 181, holes 1121B and 1124C, in the Southwest Pacific were measured. The isotopic signals are mainly contributed by calcareous nannofossils with minimal diagenetic alteration. A complete section of the late Paleogene age between 60.7 and 57.5 Ma was recovered from Hole 1121B. However, the Paleogene sedimentary sequence of Hole 1124C was truncated by three major hiatuses: late Paleocene to middle Eocene (59-42 Ma), middle Eocene to early Oligocene (40-33.5 Ma), and early Oligocene to middle Oligocene (31.3-27.5 Ma). The middle Eocene shows the most negative δ 18 O values (c. -0.8 permille) compared to the early Paleocene (c. -0.2 to -0.3 permille) and Oligocene (c. 0.6-0.9 permille). The δ 18 O pattern is consistent with previous understanding of the Paleogene paleoclimate: a warmth optimum in the early-middle Eocene followed by a major glaciation in the early Oligocene at c. 34 Ma. The hiatus of 33.5-40 Ma indicates that the Tasmanian Gateway had deepened enough by 33.5 Ma, allowing the breakthrough of cold, bottom water and consequently the formation of the Deep Western Boundary Current (DWBC). With the aid of independent biochronological and magnetochronological markers, the Paleocene carbon isotopic profiles were correlated with that of DSDP 577 in the North Pacific. Both sites record the early part of the Paleocene carbon isotopic maximum event, while only Hole 1124C extends back to the early Paleocene and latest Cretaceous. A short hiatus of 60.5-62.5 Ma age may exist. Although the Cretaceous/Tertiary boundary is not directly recorded, a significant cooling trend across the boundary is evident. The surface water became warmer after 64.5 Ma, and reached a stable warmth level during 64-59 Ma. A major cooling took place during c. 59-57 Ma in the late Paleocene. The temperature gradients between the two sites (ODP 1121 and 1124, paleolatitudes 64 degrees S versus 53 degrees S) are estimated to be c

21 CFR 184.1185 - Calcium acetate.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Calcium acetate. 184.1185 Section 184.1185 Food and... Substances Affirmed as GRAS § 184.1185 Calcium acetate. (a) Calcium acetate (Ca (C2H3O2)2, CAS Reg. No. 62-54-4), also known as acetate of lime or vinegar salts, is the calcium salt of acetic acid. It may be...

21 CFR 184.1857 - Corn sugar.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Corn sugar. 184.1857 Section 184.1857 Food and... Substances Affirmed as GRAS § 184.1857 Corn sugar. (a) Corn sugar (C6H12O6, CAS Reg. No. 50-99-7), commonly... monohydrate form and is produced by the complete hydrolysis of corn starch with safe and suitable acids or...

21 CFR 184.1950 - Vitamin D.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Vitamin D. 184.1950 Section 184.1950 Food and Drugs... Substances Affirmed as GRAS § 184.1950 Vitamin D. (a) Vitamin D is added to food as the following food ingredients: (1) Crystalline vitamin D2 (C28H44O, CAS Reg. No. 50-14-6), also known as ergocalciferol, is the...

21 CFR 184.1005 - Acetic acid.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Acetic acid. 184.1005 Section 184.1005 Food and... Substances Affirmed as GRAS § 184.1005 Acetic acid. (a) Acetic acid (C2H4O2, CAS Reg. No. 64-19-7) is known as ethanoic acid. It occurs naturally in plant and animal tissues. It is produced by fermentation of...

CRED Ocean Data Platform (ODP), Temperature and Conductivity Recorder (SBE37); NWHI, PHR; Long: -175.88112, Lat: 27.78206 (WGS84); Sensor Depth: 21.64m; Data Range: 20080923-20100913.

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

CRED Ocean Data Platform (ODP), Temperature and Conductivity Recorder (SBE37); PRIA, JAR; Long: -160.01545, Lat: -00.37912 (WGS84); Sensor Depth: 15.24m; Data Range: 20060320-20080326.

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

CRED Ocean Data Platform (ODP), Temperature and Conductivity Recorder (SBE37); PRIA, JAR; Long: -160.01540, Lat: -00.37916 (WGS84); Sensor Depth: 14.63m; Data Range: 20080326-20100401.

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

CRED Ocean Data Platform (ODP), Temperature and Conductivity Recorder (SBE37); PRIA, BAK; Long: -176.46012, Lat: 00.18994 (WGS84); Sensor Depth: 19.81m; Data Range: 20080209-20100206.

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

CRED Ocean Data Platform (ODP), Temperature and Conductivity Recorder (SBE37); PRIA, BAK; Long: -176.46025, Lat: 00.19005 (WGS84); Sensor Depth: 18.90m; Data Range: 20020201-20031215.

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

CRED Ocean Data Platform (ODP), Temperature and Conductivity Recorder (SBE37); PRIA, BAK; Long: -176.46025, Lat: 00.19005 (WGS84); Sensor Depth: 18.90m; Data Range: 20040123-20050123.

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

CRED Ocean Data Platform (ODP), Temperature and Conductivity Recorder (SBE37); PRIA, JAR; Long: -160.01553, Lat: -00.37917 (WGS84); Sensor Depth: 15.00m; Data Range: 20020310-20031209.

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

Sedimentary Characterization of Nazca Ridge ODP Site 1237: Plio-Pleistocene Record of Continental Erosion and Bottom Water Influence

Science.gov (United States)

Dileo, K. V.; Joseph, L. H.

2005-12-01

Ocean Drilling Program (ODP) Site 1237 (16°0.421'S, 76°22.685'W), drilled ~140 km off the east coast of Peru on the easternmost flank of Nazca Ridge, provides an opportunity to study climatic shifts in the southeastern Pacific Ocean over the last thirty million years. Sediment deposition at this location has been influenced by movement through various oceanic current systems, from a relatively low productivity open ocean setting to a high productivity upwelling zone along the coast of Peru, as the tectonic plate subducts under South America. Today, near the eastern edge of the Peru-Chile current at a water depth of 3212 m, this site is located in the transition zone between Antarctic Circumpolar Deep Water and Pacific Central Water and is close enough to the continent to collect terrigenous sediment from South America. Plio-Pleistocene sediment (~100 mcd) from Site 1237 is comprised of white to light greenish gray clayey nannofossil ooze (Lithologic Unit IB) and clay to ooze with similar percentages of clay minerals, nannofossils, and diatoms (Unit IA). Shipboard results indicated linear sedimentation rates of ~20-30 m/my and siliciclastic mass accumulation rates (MARs) of ~1 g/cm2/ky during this time period. Approximately 90 Plio-Pleistocene samples were analyzed for bulk magnetic susceptibility, anisotropy of magnetic susceptibility (AMS; P' and T), organic carbon content, and calcium carbonate content to aid in interpretation of climatic and oceanic conditions that existed at the time of sediment deposition. Bulk magnetic susceptibility values are very low (10-6 to 10-7 SI, or negative) at the base of the record through ~60 mcd(~3 Ma), gradually increase to a peak value of ~3.7 x 10-4 SI at ~22 mcd (~1 Ma), decreasing and subsequently increasing for the remainder of the record. In the upper part of the record (above 60 mcd) where bulk magnetic susceptibility values are >10-6, P' values (strength of magnetic susceptibility), which can be used to interpret the

RM - ODP to express nuclear licensing

International Nuclear Information System (INIS)

Barbosa, E.A.; Martucci, M. Jr.

2002-01-01

The scope of CNEN (Comissao Nacional de Energia Nuclear) is established by standards and procedures, which allow one context where several activities for nuclear licensing are realized by persons, machines and other entities of real world and by software systems. The CNEN objectives for licensing nuclear installations can be specified and they define how the systems are consisted, its nature, and which important elements were considered relevant for its constitution. The behavior, where the software will be operated, was likely defined in this paper through all aspects of its business process, which means from its licensing context. The concepts and definition showed here defined one specifics business domain, through ODP context. The functionalities of nuclear licensing process, the relationship scope and the rules of interaction that contributed for to specify the nuclear licensing process were defined, too. Therefore, the definition of the domain follows the orientation of architecture concepts and allows to implement the reflection model, where, with the auxiliary from IDEF0 (Integration Definition for Function Modeling) diagrams, the interactions between extern domains were mapped

21 CFR 184.1195 - Calcium citrate.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Calcium citrate. 184.1195 Section 184.1195 Food and... Substances Affirmed as GRAS § 184.1195 Calcium citrate. (a) Calcium citrate (Ca3(C6H5O7)2·4H2O, CAS Reg. No. 813-0994-095) is the calcium salt of citric acid. It is prepared by neutralizing citric acid with...

21 CFR 184.1069 - Malic acid.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Malic acid. 184.1069 Section 184.1069 Food and... Substances Affirmed as GRAS § 184.1069 Malic acid. (a) Malic acid (C4H6O5, CAS Reg. No. of L-form 97-67-6, CAS Reg. No. of DL-form 617-48-1) is the common name for 1-hydroxy-1, 2-ethanedicarboxylic acid. L...

CONTRIBUIÇÃO AOS ESTUDOS DA PRECIPITAÇÃO NO ESTADO DO PARANÁ: A OSCILAÇÃO DECADAL DO PACÍFICO - ODP

Directory of Open Access Journals (Sweden)

Lindberg Nascimento Júnior

2016-04-01

Full Text Available A Oscilação Decadal do Pacífico – ODP tem sido discutida como a teleconexão de baixa frequência mais recorrente do Oceano Pacífico. A oscilação é caracterizada por meio das temperaturas da superfície do mar e pela temporalidade de atuação na escala de 20 a 30 anos. No Brasil, associações entre ODP nas dinâmicas climáticas regionais e locais são verificadas principalmente na variabilidade pluviométrica. No Paraná, estudos que associaram a oscilação à dinâmica pluviométrica e/ou climática foram obtidos de forma indireta. Neste contexto, o objetivo do trabalho é apresentar as características por meio de associações e correlações espaciais e temporais obtidas por testes estatísticos para a precipitação no estado. O intuito é contribuir aos estudos sobre a gênese das chuvas na região, considerando a variabilidade pluviométrica em escala decadal, e destacando a ODP como um fenômeno que auxilia na produção das chuvas no estado. Foram utilizadas séries históricas de 1976 a 2011: a com dados mensais de chuva e número de dias com chuva, agrupados em escalas trimestrais, sazonais e anuais; e b com índices anuais padronizados da ODP. A caracterização foi processada pela associação em função da similaridade temporal da ODP e das chuvas no Paraná e as correlações foram obtidas pelo coeficiente de correlação linear de Pearson. Em geral, a participação da ODP se mostrou com sinal fraco para chuvas, numa relação de 11% a 20%, considerando o coeficiente de determinação (r². Para os números de dias com chuva a correlação foi de 17 a 46%, sugerindo uma relação com sinal moderado-fraco. Os resultados corroboram para o melhor entendimento das gêneses das chuvas em regiões de clima tropical, especialmente para o Paraná, e aponta abordagens interpretativas dos impactos regionais e locais de teleconexões climáticas de baixa frequência.

21 CFR 820.184 - Device history record.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Device history record. 820.184 Section 820.184 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES QUALITY SYSTEM REGULATION Records § 820.184 Device history record. Each manufacturer shall...

46 CFR 184.704 - Marine sanitation devices.

Science.gov (United States)

2010-10-01

... 46 Shipping 7 2010-10-01 2010-10-01 false Marine sanitation devices. 184.704 Section 184.704... TONS) VESSEL CONTROL AND MISCELLANEOUS SYSTEMS AND EQUIPMENT Miscellaneous § 184.704 Marine sanitation devices. A vessel with installed toilet facilities must have a marine sanitation device that complies with...

46 CFR 184.404 - Radars.

Science.gov (United States)

2010-10-01

... within one mile of land must be fitted with a FCC Type Accepted general marine radar system for surface... Federal Communications Commission (FCC) type accepted general marine radar system for surface navigation... 46 Shipping 7 2010-10-01 2010-10-01 false Radars. 184.404 Section 184.404 Shipping COAST GUARD...

Molybdenum-UO2 cerment irradiation at 1145 K

Science.gov (United States)

Mcdonald, G.

1971-01-01

Two molybdenum-UO2 cermet fuel pins were fission heated in a helium-cooled loop at a temperature of 1145 K and to a total burnup of 5.3 % of the U-235. After irradiation the fuel pins were measured to check dimensional stability, punctured at the plenums to determine fission gas release, and examined metallographically to determine the effect of irradiation. Burnup was determined in several sections of the fuel pin. The results of the postirradiation examination indicated: (1) There was no visible change in the fuel pins on irradiation under the above conditions. (2) The maximum swelling of the fuel pins was less than 1%. (3) There was no migration of UO2 and no visible interaction between the molybdenum and the UO2. (4) Approximately 12% of the fission gas formed was released from the cermet cone into the gas plenum.

10 CFR 72.184 - Safeguards contingency plan.

Science.gov (United States)

2010-01-01

... 10 Energy 2 2010-01-01 2010-01-01 false Safeguards contingency plan. 72.184 Section 72.184 Energy... Protection § 72.184 Safeguards contingency plan. (a) The requirements of the licensee's safeguards contingency plan for responding to threats and radiological sabotage must be as defined in appendix C to part...

21 CFR 184.1259 - Cocoa butter substitute.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Cocoa butter substitute. 184.1259 Section 184.1259... FOR HUMAN CONSUMPTION (CONTINUED) DIRECT FOOD SUBSTANCES AFFIRMED AS GENERALLY RECOGNIZED AS SAFE Listing of Specific Substances Affirmed as GRAS § 184.1259 Cocoa butter substitute. (a) The common or...

21 CFR 184.1983 - Bakers yeast extract.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Bakers yeast extract. 184.1983 Section 184.1983... Listing of Specific Substances Affirmed as GRAS § 184.1983 Bakers yeast extract. (a) Bakers yeast extract... a selected strain of yeast, Saccharomyces cerevisiae. It may be concentrated or dried. (b) The...

21 CFR 184.1563 - Ozone.

Science.gov (United States)

2010-04-01

...: Category of food Maximum treatment level in food Functional use Bottled water that prior to ozonation meets... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ozone. 184.1563 Section 184.1563 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...

50 CFR 216.184 - Mitigation.

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Mitigation. 216.184 Section 216.184 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... the coast from 47°07′ N. to 48°30′ N. latitude December January, March and May. (9) Flower Garden...

46 CFR 184.710 - First-aid kits.

Science.gov (United States)

2010-10-01

... 46 Shipping 7 2010-10-01 2010-10-01 false First-aid kits. 184.710 Section 184.710 Shipping COAST... CONTROL AND MISCELLANEOUS SYSTEMS AND EQUIPMENT Miscellaneous § 184.710 First-aid kits. A vessel must carry either a first-aid kit approved under approval series 160.041 or a kit with equivalent contents...

21 CFR 184.1034 - Catalase (bovine liver).

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Catalase (bovine liver). 184.1034 Section 184.1034... Listing of Specific Substances Affirmed as GRAS § 184.1034 Catalase (bovine liver). (a) Catalase (bovine liver) (CAS Reg. No. 81457-95-6) is an enzyme preparation obtained from extracts of bovine liver. It is...

A Tracer Experiment to Understand Dispersion Characteristics at a Nuclear Power Plant Site-Focusing on the Comparison with Predictive Results using Reg. Guide 1.145 model

Energy Technology Data Exchange (ETDEWEB)

Jeong, Hyojoon; Kim, Eunhan; Jeong, Haesun; Hwang, Wontae; Han, Moonhee [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

2014-10-15

There remains disagreement regarding the application of a Gaussian plume model in PAVAN, as it relates to the complicated geographical features of a coastal area. Therefore, this study was performed in order to figure out the characteristics of the PAVAN program that was developed based on the equations of Gaussian Plume Model, which reflected the actual measured concentration of radioactive materials released to the air. It also evaluated the appropriateness of using a Gaussian plume model for assessing the environmental impact of radiation from a nuclear power plant. In order to analyze the dispersion characteristics of radioactive materials released into the air from the Wolsong nuclear power plant, SF{sub 6} gas was released from the site at night for one hour under stable atmospheric conditions disadvantageous to dilute a tracer gas in this study. The measured concentrations were compared with theoretical estimates derived from meteorological data observed during the experiment period to evaluate the prediction capabilities of the Gaussian plume model. This study conducted a tracer dispersion experiment at the site of Wolsong Nuclear Power Plant site in Korea to analyze the atmospheric dispersion characteristics of radioactive materials. It compared the experimental value with the calculated value using the Gaussian Plume Model as suggested in Reg. 1.145, based on the meteorological data observed in the experiment time period, and evaluated the conservative estimate of the calculated value. In the area where the calculated value is relatively high, the calculated value tends to show higher than the experimental value, which confirmed the conservative manner of the estimating of the calculated value using the Gaussian Plume Model. The short-term exposure of radiation to a human body caused by a nuclear accident would be higher in the area where the atmospheric concentration of radiation is high. Therefore, it is a sufficiently conservative manner to use the

A Tracer Experiment to Understand Dispersion Characteristics at a Nuclear Power Plant Site-Focusing on the Comparison with Predictive Results using Reg. Guide 1.145 model

International Nuclear Information System (INIS)

Jeong, Hyojoon; Kim, Eunhan; Jeong, Haesun; Hwang, Wontae; Han, Moonhee

2014-01-01

There remains disagreement regarding the application of a Gaussian plume model in PAVAN, as it relates to the complicated geographical features of a coastal area. Therefore, this study was performed in order to figure out the characteristics of the PAVAN program that was developed based on the equations of Gaussian Plume Model, which reflected the actual measured concentration of radioactive materials released to the air. It also evaluated the appropriateness of using a Gaussian plume model for assessing the environmental impact of radiation from a nuclear power plant. In order to analyze the dispersion characteristics of radioactive materials released into the air from the Wolsong nuclear power plant, SF 6 gas was released from the site at night for one hour under stable atmospheric conditions disadvantageous to dilute a tracer gas in this study. The measured concentrations were compared with theoretical estimates derived from meteorological data observed during the experiment period to evaluate the prediction capabilities of the Gaussian plume model. This study conducted a tracer dispersion experiment at the site of Wolsong Nuclear Power Plant site in Korea to analyze the atmospheric dispersion characteristics of radioactive materials. It compared the experimental value with the calculated value using the Gaussian Plume Model as suggested in Reg. 1.145, based on the meteorological data observed in the experiment time period, and evaluated the conservative estimate of the calculated value. In the area where the calculated value is relatively high, the calculated value tends to show higher than the experimental value, which confirmed the conservative manner of the estimating of the calculated value using the Gaussian Plume Model. The short-term exposure of radiation to a human body caused by a nuclear accident would be higher in the area where the atmospheric concentration of radiation is high. Therefore, it is a sufficiently conservative manner to use the Gaussian

21 CFR 184.1063 - Enzyme-modified lecithin.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Enzyme-modified lecithin. 184.1063 Section 184.1063... Listing of Specific Substances Affirmed as GRAS § 184.1063 Enzyme-modified lecithin. (a) Enzyme-modified lecithin is prepared by treating lecithin with either phospholipase A2 (EC 3.1.1.4) or pancreatin. (b) The...

21 CFR 184.1272 - L-Cysteine monohydrochloride.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true L-Cysteine monohydrochloride. 184.1272 Section 184... Listing of Specific Substances Affirmed as GRAS § 184.1272 L-Cysteine monohydrochloride. (a) L-Cysteine... ingredient is used to supply up to 0.009 part of total L-cysteine per 100 parts of flour in dough as a dough...

16 CFR 1145.3 - Extremely flammable contact adhesives; risk of burns from explosive vapor ignition and flashback...

Science.gov (United States)

2010-01-01

... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Extremely flammable contact adhesives; risk... TO OTHER ACTS UNDER THE CONSUMER PRODUCT SAFETY ACT § 1145.3 Extremely flammable contact adhesives... associated with certain extremely flammable contact adhesives under the Consumer Product Safety Act rather...

IMPLICATIONS OF A HIGH ANGULAR RESOLUTION IMAGE OF THE SUNYAEV-ZEL'DOVICH EFFECT IN RXJ1347-1145

International Nuclear Information System (INIS)

Mason, B. S.; Cotton, W. D.; Dicker, S. R.; Korngut, P. M.; Devlin, M. J.; Aguirre, J. E.; Koch, P. M.; Molnar, S. M.; Sievers, J.; Benford, D.; Staguhn, J. G.; Moseley, H.; Irwin, K. D.; Ade, P.

2010-01-01

The most X-ray luminous cluster known, RXJ1347-1145 (z = 0.45), has been the object of extensive study across the electromagnetic spectrum. We have imaged the Sunyaev-Zel'dovich effect (SZE) at 90 GHz (λ = 3.3 mm) in RXJ1347-1145 at 10'' resolution with the 64 pixel MUSTANG bolometer array on the Green Bank Telescope, confirming a previously reported strong, localized enhancement of the SZE 20'' to the southeast of the center of X-ray emission. This enhancement of the SZE has been interpreted as shock-heated (>20 keV) gas caused by an ongoing major (low mass ratio) merger event. Our data support this interpretation. We also detect a pronounced asymmetry in the projected cluster pressure profile, with the pressure just east of the cluster core ∼1.6x higher than just to the west. This is the highest resolution image of the SZE made to date.

21 CFR 184.1560 - Ox bile extract.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ox bile extract. 184.1560 Section 184.1560 Food and... Substances Affirmed as GRAS § 184.1560 Ox bile extract. (a) Ox bile extract (CAS Reg. No. 8008-63-7), also..., partly bitter, disagreeable taste. It is the purified portion of the bile of an ox obtained by...

Paleoclimate of Quaternary Costa Rica: Analysis of Sediment from ODP Site 1242 in the Eastern Tropical Pacific to Explore the Behavior of the Intertropical Convergence Zone (ITCZ) and Oceanic Circulation

Science.gov (United States)

Buczek, C. R.; Joseph, L. H.

2017-12-01

Studies of grain size, magnetic fabric, and terrigenous mass accumulation rates (MAR) on oceanic sediment can provide insights into climatic conditions present at or near the time of deposition by helping to delineate changes in rainfall and oceanic circulation intensities. The fairly homogenous hemipelagic nannofossil clays and clayey nannofossil oozes collected in the upper portion of Ocean Drilling Program (ODP) Site 1242 provide a 1.4 million year sediment record from the Cocos Ridge, in relatively shallow waters of the eastern tropical Pacific Ocean, off the coast of present day Central and South America. Information about shifts in rainfall and oceanic circulation provided by this study may be helpful in understanding changes in the location and behavior of the Intertropical Convergence Zone (ITCZ), and/or other climatic factors, in this area during the Pleistocene and Holocene Epochs. Approximately 130 paired side-by-side samples were selected at approximately evenly spaced intervals throughout the uppermost 190 mcd of the core. To obtain terrigenous grain size and MARs, one set of sediment samples was subject to a five-step chemical extraction process to dissolve any oxy-hydroxy coatings, remove the biogenic carbonate and silicate components, and sieve out grains larger than 63 µm. The pre- and post-extraction weights were compared to calculate a terrigenous weight percent (%) from which the terrigenous MAR values were then calculated, with the use of linear sediment rates and dry bulk density measurements determined from shipboard ODP 1242 analyses. Magnetic fabric, or anisotropy of magnetic susceptibility (AMS), was analyzed on a KLY4S-Kappabridge using the second set of samples taken in pmag cubes. Terrigenous MAR values range between 3.1 and 10.9 g/cm2/kyr, while P' (AMS) values range between 1.004 and 1.04 SI. A distinctive trend is noted in both factors, with both exhibiting relatively high initial values that then decrease from the beginning of the

21 CFR 184.1945 - Vitamin B12.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Vitamin B12. 184.1945 Section 184.1945 Food and... Substances Affirmed as GRAS § 184.1945 Vitamin B12. (a) Vitamin B12, also known as cyanocobalamin (C63H88Co... is used in food at levels not to exceed current good manufacturing practice. Vitamin B12 also may be...

Decay of 184Hg to 184Au

International Nuclear Information System (INIS)

Nettles, W.G.; Beraud, R.; Cole, J.D.; Hamilton, J.H.; Ramayya, A.V.; Spejewski, E.H.; Sastry, K.S.R.

1977-01-01

Levels in 184 Au were investigated by e--γ--t and γ--γ--t coincidence techniques. A level scheme with eight definite and two tentative levels is presented; gamma branching ratios are shown. The state at 156 keV was found to have a lifetime of 36 +- 6 ns; for four of the next five levels, T 1 / 2 was less than 2 ns. 2 figures

Paleoceanographic Inferences from Carbon and Nitrogen Isotopic Compositions of Cenomanian Black Shales from DSDP/ODP Sites 367, 530, 603, 641, 1257-1261, and 1276 in the Atlantic Ocean

Science.gov (United States)

Yum, J.; Meyers, P. A.; Bernasconi, S. M.; Arnaboldi, M.

2005-12-01

The mid-Cretaceous (Cenomanian- Turonian) was characterized as a peak global greenhouse period with highest sea level, highest CO2 concentration in atmosphere and low thermal gradients from the poles to the equator. The depositional environment of the organic-carbon-rich black shales that typify this period remains an open question. A total of 180 Cenomanian- Turonian core samples were selected from multiple ODP and DSDP sites in the Atlantic Ocean: 530 (Cape Basin), 603 (Hatteras Rise), 641 (Galicia Bank), 1257-1261 (Demerara Rise), 1276 (Newfoundland Basin). Total organic carbon and nitrogen concentrations and isotopic compositions were measured to investigate variations in the proto-Atlantic Ocean paleoceanographic conditions that contributed to the origin of the black shales for this period. These new data were combined with existing data from Sites 367 (Senegal Rise), 530, and 603. Both the black shales and the organic-carbon-poor background sediments (less than 1 percent) have carbon isotope values between -29 to -22 permil. The C/N ratios of the background sediments are low (less than 20) compared to those of the black shales (20-40). Nitrogen isotope values range from 0 to 4 permil in the background samples. All black shales have similarly low nitrogen isotope values that range between -4 to 0 permil. These exceptionally low values are inferred to reflect the productivity of blue green algae and cyanobacteria under strongly surface stratified oceanic conditions. Although carbon isotope and C/N values of black shales show almost similar patterns at each location, there are site-specific shifts in these data that could be related to the amount of continental run off and/or the effect of latitude. Our multi-site comparison suggests that specially stratified depositional environments that could produce and accumulate the abnormally high carbon concentrations in sediments occurred throughout the proto-Atlantic ocean during the mid-Cretaceous. However, regional

42 CFR 415.184 - Psychiatric services.

Science.gov (United States)

2010-10-01

... 42 Public Health 3 2010-10-01 2010-10-01 false Psychiatric services. 415.184 Section 415.184 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Psychiatric services. To qualify for physician fee schedule payment for psychiatric services furnished under...

46 CFR 184.620 - Propulsion engine control systems.

Science.gov (United States)

2010-10-01

... 46 Shipping 7 2010-10-01 2010-10-01 false Propulsion engine control systems. 184.620 Section 184... Communications Systems § 184.620 Propulsion engine control systems. (a) A vessel must have two independent means of controlling each propulsion engine. Control must be provided for the engine speed, direction of...

21 CFR 184.1619 - Potassium carbonate.

Science.gov (United States)

2010-04-01

... solution of potassium hydroxide with excess carbon dioxide to produce potassium carbonate; (3) By treating a solution of potassium hydroxide with carbon dioxide to produce potassium bicarbonate, which is... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Potassium carbonate. 184.1619 Section 184.1619 Food...

21 CFR 184.1317 - Garlic and its derivatives.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Garlic and its derivatives. 184.1317 Section 184... Listing of Specific Substances Affirmed as GRAS § 184.1317 Garlic and its derivatives. (a) Garlic is the... derivatives include essential oils, oleo-resins, and natural extractives obtained from garlic. (b) Garlic oil...

21 CFR 184.1866 - High fructose corn syrup.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true High fructose corn syrup. 184.1866 Section 184.1866... Listing of Specific Substances Affirmed as GRAS § 184.1866 High fructose corn syrup. (a) High fructose... partial enzymatic conversion of glucose (dextrose) to fructose using an insoluble glucose isomerase enzyme...

21 CFR 184.1293 - Ethyl alcohol.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ethyl alcohol. 184.1293 Section 184.1293 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) DIRECT FOOD SUBSTANCES AFFIRMED AS GENERALLY RECOGNIZED AS SAFE Listing of Specific...

21 CFR 184.1265 - Cuprous iodide.

Science.gov (United States)

2010-04-01

... the following specific limitations: Category of food Maximum treatment level in food Functional use... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Cuprous iodide. 184.1265 Section 184.1265 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...

21 CFR 184.1979a - Reduced lactose whey.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Reduced lactose whey. 184.1979a Section 184.1979a... Listing of Specific Substances Affirmed as GRAS § 184.1979a Reduced lactose whey. (a) Reduced lactose whey is the substance obtained by the removal of lactose from whey. The lactose content of the finished...

21 CFR 184.1979b - Reduced minerals whey.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Reduced minerals whey. 184.1979b Section 184.1979b... Listing of Specific Substances Affirmed as GRAS § 184.1979b Reduced minerals whey. (a) Reduced minerals whey is the substance obtained by the removal of a portion of the minerals from whey. The dry product...

21 CFR 184.1187 - Calcium alginate.

Science.gov (United States)

2010-04-01

... ingredient is used in food only within the following specific limitations: Category of food Maximum level of... other food categories 0.3 Do. (d) Prior sanctions for calcium alginate different from the uses... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Calcium alginate. 184.1187 Section 184.1187 Food...

21 CFR 184.1120 - Brown algae.

Science.gov (United States)

2010-04-01

... used in food only within the following specific limitations: Category of food Maximum level of use in... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Brown algae. 184.1120 Section 184.1120 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...

21 CFR 184.1121 - Red algae.

Science.gov (United States)

2010-04-01

... within the following specific limitations: Category of food Maximum level of use in food (as served... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Red algae. 184.1121 Section 184.1121 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...

21 CFR 184.1011 - Alginic acid.

Science.gov (United States)

2010-04-01

... used in food only within the following specific limitations: Category of food Maximum level of use in... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Alginic acid. 184.1011 Section 184.1011 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...

21 CFR 184.1801 - Sodium tartrate.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Sodium tartrate. 184.1801 Section 184.1801 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... crystals. It is obtained as a byproduct of wine manufacture. (b) The ingredient meets the specifications of...

21 CFR 184.1613 - Potassium bicarbonate.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Potassium bicarbonate. 184.1613 Section 184.1613 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) DIRECT FOOD SUBSTANCES AFFIRMED AS GENERALLY RECOGNIZED AS SAFE Listing of Specific Substances Affirmed as GRAS §...

21 CFR 184.1610 - Potassium alginate.

Science.gov (United States)

2010-04-01

...: Category of food Maximum level of use in food (as served) (percent) Functional use Confections and...) of this chapter 0.25 Do. All other food categories 0.01 Do. (d) Prior sanctions for potassium... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Potassium alginate. 184.1610 Section 184.1610 Food...

21 CFR 184.1736 - Sodium bicarbonate.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Sodium bicarbonate. 184.1736 Section 184.1736 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) DIRECT FOOD SUBSTANCES AFFIRMED AS GENERALLY RECOGNIZED AS SAFE Listing of Specific Substances Affirmed as GRAS §...

21 CFR 184.1099 - Tartaric acid.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Tartaric acid. 184.1099 Section 184.1099 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN..., crystalline powder. It is odorless and has an acid taste. It is obtained as a byproduct of wine manufacture...

21 CFR 184.1135 - Ammonium bicarbonate.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ammonium bicarbonate. 184.1135 Section 184.1135 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) DIRECT FOOD SUBSTANCES AFFIRMED AS GENERALLY RECOGNIZED AS SAFE Listing of Specific Substances Affirmed as GRAS § 18...

21 CFR 184.1660 - Propyl gallate.

Science.gov (United States)

2010-04-01

... alcohol. (b) The ingredient meets the specifications of the “Food Chemicals Codex,” 3d Ed. (1981), pp. 257... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Propyl gallate. 184.1660 Section 184.1660 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...

21 CFR 184.1133 - Ammonium alginate.

Science.gov (United States)

2010-04-01

...: Category of food Maximum level of use in food (as served) (percent) Functional use Confections, frostings... chapter 0.4 Do. Sweet sauces, § 170.3(n)(43) of this chapter 0.5 Do. All other food categories 0.1... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ammonium alginate. 184.1133 Section 184.1133 Food...

21 CFR 184.1724 - Sodium alginate.

Science.gov (United States)

2010-04-01

....1(b)(2), the ingredient is used in food only within the following specific limitations: Category of...; texturizer, § 170.3(o)(32) of this chapter. All other food categories 1.0 Emulsifier, § 170.3(o)(8) of this... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Sodium alginate. 184.1724 Section 184.1724 Food and...

Cleanup Verification Package for the 126-F-1, 184-F Powerhouse Ash Pit

International Nuclear Information System (INIS)

Clark, S.W.; Sulloway, H.M.

2007-01-01

This cleanup verification package documents completion of remedial action for the 126-F-1, 184-F Powerhouse Ash Pit. This waste site received coal ash from the 100-F Area coal-fired steam plant. Leakage of process effluent from the 116-F-14 , 107-F Retention Basins flowed south into the ash pit, contaminating the northern portion

21 CFR 184.1804 - Sodium potassium tartrate.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Sodium potassium tartrate. 184.1804 Section 184.1804 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... has a cooling saline taste. It is obtained as a byproduct of wine manufacture. (b) The ingredient...

21 CFR 184.1077 - Potassium acid tartrate.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Potassium acid tartrate. 184.1077 Section 184.1077 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD... a white, crystalline powder. It has a pleasant, acid taste. It is obtained as a byproduct of wine...

27 CFR 25.184 - Losses in transit.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Losses in transit. 25.184... Ownership § 25.184 Losses in transit. (a) Liability for losses. The brewer is liable under the bond of the brewery to which beer is transferred for the tax on beer lost in transit. If the brewer reconsigns beer...

19 CFR 191.184 - Merchandise transferred from continuous Customs custody.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Merchandise transferred from continuous Customs custody. 191.184 Section 191.184 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... From Customs Territory § 191.184 Merchandise transferred from continuous Customs custody. (a) Procedure...

Astronomical calibration of upper Campanian–Maastrichtian carbon isotope events and calcareous plankton biostratigraphy in the Indian Ocean (ODP Hole 762C)

DEFF Research Database (Denmark)

Thibault, Nicolas Rudolph; Husson, Dorothée; Harlou, Rikke

2012-01-01

An integrated framework of magnetostratigraphy, calcareous microfossil bio-events, cyclostratigraphy and d13C stratigraphy is established for the upper Campanian–Maastrichtian of ODP Hole 762C (Exmouth Plateau, Northwestern Australian margin). Bulk-carbonate d13C events and nannofossil bio-events...

$\\alpha$-decay study of $^{182,184}$Tl

CERN Document Server

Van Beveren, C; Barzakh, A E; Cocolios, T E; de Groote, R P; Fedorov, D; Fedosseev, V N; Ferrer, R; Ghys, L; Huyse, M; Köster, U; Lane, J; Liberati, V; Lynch, K M; Marsh, B A; Molkanov, P L; Procter, T J; Rapisarda, E; Sandhu, K; Seliverstov, M D; Van Duppen, P; Venhart, M; Veselský, M

2016-01-01

α -decay spectroscopy of 182,184 Tl has been performed at the CERN isotope separator on-line ( ISOLDE ) facility. New fi ne-structure α decays have been observed for both isotopes. α -decay branching ratios of 0.089 ( 19 ) %, 0.047 ( 6 ) % and 1.22 ( 30 ) % have been deduced for the ( 10 − ) , ( 7 + ) and ( 2 − ) states respectively in 184 Tl and a lower limit of 0.49% for the α -decay branching ratio of 182 Tl. A new half-life of 9.5 ( 2 ) s for the ( 2 − ) state in 184 Tl and 1.9 ( 1 ) s for the low-spin state in 182 Tl has been deduced. Using α – γ coincidence analysis, multiple γ rays were observed de-exciting levels in 178,18 0 Au fed by 182,184 Tl α decays. The γ transitions connecting these low-lying states in 178,18 0 Au are essential to sort the data and possibly identify bands from in- beam studies in these isotopes. Owing to the complex fi ne-structure α decays and limited knowledge about the structure of the daughter nuclei, only partial level schemes could be constructed for bot...

In-situ petrophysical properties of hotspot volcanoes. Results from ODP Leg 197, Detroit Seamount and HSDP II borehole, Hawaii

Science.gov (United States)

Kock, I.; Pechnig, R.; Buysch, A.; Clauser, C.

2003-04-01

During ODP Leg 197 an extensive logging program was run on Site 1203, Detroit Seamount. This seamount is part of the Emperor seamount chain, a continuation of the Hawaiian volcanic chain. Standard ODP/LDEO logging tool strings were used to measure porosity, density, resistivity, p- and s-wave velocities and gamma ray activity. The FMS-tool yielded detailed high resolution resistivity images of the borehole wall. By interpretation and statistical analysis of the logging parameters a petrophysical classification of the drilled rock content could be derived. The pillow lava recovered in the cores exhibits low porosity, low resistivity and high density. This indicates no or very little vesicles in the non-fractured rock unit. Compared to the pillow basalts, subaerial basalts show increasing porosity, gamma ray and potassium content and decreasing density, resistivity and velocity. A basalt with no or little vesicles and a basalt with average or many vesicles can clearly be distinguished. The volcaniclastics show lower resistivity, lower sonic velocities, higher porosities and lower densities than the basalts. Three different rock types can be distinguished within the volcaniclastics: Tuffs, resedimented tephra and breccia. The tuff shows medium porosity and density, low gamma ray and potassium content. The log responses from the resedimented tephra suggest that the tephra is more easily altered than the tuff. The log responses from the breccia lie between the tuff and tephra log responses, but the breccia can clearly be identified in the FMS borehole images. A similar rock content was found in the Hawaiian Scientific Drilling Project borehole. Gamma ray activity, electrical resistivity and sonic velocity were measured down to 2700 mbsl.. Compared to the 72-76 Ma old Detroit seamount basalts, the HSDP subaerial and submarine lava flows show a significant lower gamma ray activity, while sonic velocity and electrical resistivity are comparable. Deviations between the

21 CFR 184.1973 - Beeswax (yellow and white).

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Beeswax (yellow and white). 184.1973 Section 184.1973 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) DIRECT FOOD SUBSTANCES AFFIRMED AS GENERALLY RECOGNIZED AS SAFE...

Peculiar Velocity Constraints from Five-band SZ Effect Measurements toward RX J1347.5-1145 with MUSIC and Bolocam from the CSO

Science.gov (United States)

Sayers, Jack; Zemcov, Michael; Glenn, Jason; Golwala, Sunil R.; Maloney, Philip R.; Siegel, Seth R.; Wheeler, Jordan; Bockstiegel, Clint; Brugger, Spencer; Czakon, Nicole G.; Day, Peter K.; Downes, Thomas P.; Duan, Ran P.; Gao, Jiansong; Hollister, Matthew I.; Lam, Albert; LeDuc, Henry G.; Mazin, Benjamin A.; McHugh, Sean G.; Miller, David A.; Mroczkowski, Tony K.; Noroozian, Omid; Nguyen, Hien T.; Radford, Simon J. E.; Schlaerth, James A.; Vayonakis, Anastasios; Wilson, Philip R.; Zmuidzinas, Jonas

2016-04-01

We present Sunyaev-Zel’dovich (SZ) effect measurements from wide-field images toward the galaxy cluster RX J1347.5-1145 obtained from the Caltech Submillimeter Observatory with the Multiwavelength Submillimeter Inductance Camera at 147, 213, 281, and 337 GHz and with Bolocam at 140 GHz. As part of our analysis, we have used higher frequency data from Herschel-SPIRE and previously published lower frequency radio data to subtract the signal from the brightest dusty star-forming galaxies behind RX J1347.5-1145 and from the AGN in RX J1347.5-1145’s BCG. Using these five-band SZ effect images, combined with X-ray spectroscopic measurements of the temperature of the intra-cluster medium (ICM) from Chandra, we constrain the ICM optical depth to be {τ }{{e}}={7.33}-0.97+0.96× {10}-3 and the ICM line of sight peculiar velocity to be {v}{pec}=-{1040}-840+870 km s-1. The errors for both quantities are limited by measurement noise rather than calibration uncertainties or astrophysical contamination, and significant improvements are possible with deeper observations. Our best-fit velocity is in good agreement with one previously published SZ effect analysis and in mild tension with the other, although some or all of that tension may be because that measurement samples a much smaller cluster volume. Furthermore, our best-fit optical depth implies a gas mass slightly larger than the Chandra-derived value, implying the cluster is elongated along the line of sight.

Ocean Drilling Program: Janus Web Database

Science.gov (United States)

JANUS Database Send questions/comments about the online database Request data not available online Janus database Search the ODP/TAMU web site ODP's main web site Janus Data Model Data Migration Overview in Janus Data Types and Examples Leg 199, sunrise. Janus Web Database ODP and IODP data are stored in

Atmospheric chemistry of short-chain haloolefins: photochemical ozone creation potentials (POCPs), global warming potentials (GWPs), and ozone depletion potentials (ODPs).

Science.gov (United States)

Wallington, T J; Sulbaek Andersen, M P; Nielsen, O J

2015-06-01

Short-chain haloolefins are being introduced as replacements for saturated halocarbons. The unifying chemical feature of haloolefins is the presence of a CC double bond which causes the atmospheric lifetimes to be significantly shorter than for the analogous saturated compounds. We discuss the atmospheric lifetimes, photochemical ozone creation potentials (POCPs), global warming potentials (GWPs), and ozone depletion potentials (ODPs) of haloolefins. The commercially relevant short-chain haloolefins CF3CFCH2 (1234yf), trans-CF3CHCHF (1234ze(Z)), CF3CFCF2 (1216), cis-CF3CHCHCl (1233zd(Z)), and trans-CF3CHCHCl (1233zd(E)) have short atmospheric lifetimes (days to weeks), negligible POCPs, negligible GWPs, and ODPs which do not differ materially from zero. In the concentrations expected in the environment their atmospheric degradation products will have a negligible impact on ecosystems. CF3CFCH2 (1234yf), trans-CF3CHCHF (1234ze(Z)), CF3CFCF2 (1216), cis-CF3CHCHCl (1233zd(Z)), and trans-CF3CHCHCl (1233zd(E)) are environmentally acceptable. Copyright © 2015 Elsevier Ltd. All rights reserved.

46 CFR 184.702 - Pollution prevention equipment and procedures.

Science.gov (United States)

2010-10-01

... 46 Shipping 7 2010-10-01 2010-10-01 false Pollution prevention equipment and procedures. 184.702 Section 184.702 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS... Pollution prevention equipment and procedures. A vessel must comply with the applicable design, equipment...

Level structures in odd-odd deformed nucleus {sup 184}Ta

Energy Technology Data Exchange (ETDEWEB)

Gowrishankar, R.; Sood, P.C. [Sri Sathya Sai Institute of Higher Learning, Department of Physics, Prasanthinilayam (India)

2016-02-15

A detailed low-energy level scheme of the odd-odd n-rich nucleus {sub 73}{sup 184}Ta{sub 111} is constructed using the well tested Two-Quasiparticle Rotor Model (TQRM) for calculating the bandhead energies of physically admissible 2qp configurations with the inclusion of residual n-p interaction contribution. The presently available data on this level scheme from {sup 184}Hf decay are shown to be in agreement with these calculations. Our analysis concludes that {sup 184}Hf (Q{sub β} = 1340(30) keV) decay admits of 7 additional (to the 3 presently reported) β -branches to {sup 184}Ta with J = 0 or 1 and 8 more physically admissible weak (1f{sup u}) β -branches populating J{sup π} = 2{sup -} levels in {sup 184}Ta. Further, a close examination of our level scheme clearly indicates the existence of a low-lying (E{sub x} = 260(40) keV) high-spin (J{sup π} = 10{sup -}) long-lived isomer in this nucleus. (orig.)

Synthesis and Preliminary Cytotoxicity Studies of 1-[1-(4,5-Dihydrooxazol- 2-yl)-1H-indazol-3-yl]-3-phenylurea and 3-phenylthiourea Derivatives.

Science.gov (United States)

Kornicka, Anita; Saczewski, Franciszek; Bednarski, Patrick J; Korcz, Martyna; Szumlas, Piotr; Romejko, Ewa; Sakowicz, Aneta; Sitek, Lukasz; Wojciechowska, Monika

2017-01-01

N-substituted 3-amino-1H-indazoles represent an interesting class of biologically active compounds. Among them, derivatives containing phenylurea moiety are of particular interest. Such compounds have been found to possess inhibitory activity against cancer cell growth. Additionally, various oxazoline-containing compounds have also been designed as potential anticancer agents. The aim of this work was to obtain a new class of N-substituted 3-amino-1H-indazole derivatives with cytotoxic activity towards cancer cells. Two series of 1-[1-(4,5-dihydrooxazol-2-yl)-1H-indazol-3-yl]-3-phenylurea and 3- phenylthiourea derivatives 7-17 and 18-22, respectively, were prepared and screened for their potential in vitro cytotoxic activities against lung carcinoma LCLC-103H cell line using a crystal violet microtiter plate assay. All the urea derivatives, except the compound 8, were inactive at a concentration of 20 μM attainable in cancer cells, while the thiourea derivatives showed a pronounced cancer cell growth inhibitory effects. The most potent 1-[1-(4,5-dihydrooxazol-2-yl)-1H-indazol-3-yl]-3-ptolylthiourea (19) exhibited cytotoxicity on the lung cancer LCLC-103H and cervical cancer SISO cell lines at a concentration of 10 µM. Moreover, compound 19 displayed cytostatic activity against pancreas cancer DAN-G cell line. The 1-[1-(4,5-dihydrooxazol-2-yl)-1H-indazol-3-yl]-3-phenylthiourea derivatives described herein may serve as a useful scaffold for the search for novel anticancer agents. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

The origin of an oceanic plateau: Isotope geochemistry (Sr, Nd, Pb and Hf) of volcanic rocks from IODP Site U1347 and ODP Site 1213 (Hf data) on the Shatsky Rise (Northwest Pacific)

Science.gov (United States)

Heydolph, K.; Geldmacher, J.; Hoernle, K.

2011-12-01

K.HEYDOLPH1*, J.GELDMACHER2, 1 ,K.HOERNLE1 1IFM-GEOMAR, Wischhofstr. 1-3. D-24148 Kiel, Germany, (*correspondence: kheydolph@ifm-geomar.de) 2 Integrated Ocean Drilling Program, Texas A&M University, 1000 Discovery Drive, College Station, Texas 77845-9547 (geldmacher@iodp.tamu.edu) The submarine Shatsky Rise plateau, a unique large igneous province (LIP) in the northwest Pacific Ocean ca. 1500 km east of Japan, is the only large intraoceanic plateau, which formed during the Late Jurassic to Early Cretaceous at a time period with numerous reversals of the Earth's magnetic field. These magnetic reversals combined with bathymetric data allow a detailed reconstruction of the tectonic history. Accordingly the three main volcanic edifices Tamu, Ori and Shirshov massifs formed by massive volcanism during a short time span along a southwest - northeast trending, rapidly spreading triple junction. Therefore, the magnetic and bathymetric data suggest that the Shatsky Rise formed through the interaction of a mantle plume head with a ridge [1, 2]. We present new Sr, Nd and Pb (double spike) and for the first time Hf isotope data from volcanic rocks of relatively fresh basaltic lava flows from recent IODP Exp. 324 Site U1347 and ODP Leg 198 Site 1213 (Hf data) both located on Tamu massif the southernmost (oldest) volcanic edifice of Shtasky Rise. Initial 176Hf/177Hf and 143Nd/144Nd isotopic compositions are fairly uniform throughout the entire holes ranging between 0.283076 to 0.283100 and 0.512903 to 0.512981 respectively, showing neither distinct MORB nor intraplate (plume) affinity. Relatively unradiogenic 87Sr/86Sr data ranging from 0.70276 to 0.70296 mostly overlaps with Pacific MORB like values. In a Nd vs Hf isotope plot they form a tight cluster at the edge of the Pacific MORB field below the present-day Hf-Nd mantle array. Although initial Pb double spike 206Pb/204Pb and 208Pb/204Pb isotopic compositions for Site U1347 range from 18.13 to 18.46 and 37.71 to 37

Constraints On Fluid Evolution During Mid-Ocean Ridge Hydrothermal Circulation From Anhydrite Sampled by ODP Hole 1256D

Science.gov (United States)

Smith-Duque, C.; Teagle, D. A.; Alt, J. C.; Cooper, M. J.

2008-12-01

Anhydrite is potentially a useful mineral for recording the evolution of seawater-derived fluids during mid- ocean ridge hydrothermal circulation because it exhibits retrograde solubility, and hence may precipitate due to the heating of seawater or the sub-surface mixing of seawater with black smoker-like fluids. Here we provide new insights into the chemical and thermal evolution of seawater during hydrothermal circulation through analyses of anhydrite recovered from ODP Hole 1256D, the first complete penetration of intact upper oceanic crust down to gabbros. Previously, crustal anhydrite has been recovered only from Hole 504B. Measurements of 87Sr/86Sr, major element ratios, Rare Earth Elements and δ18O in anhydrite constrain the changing composition of fluids as they chemically interact with basalt. Anhydrite fills veins and pore-space in the lower lava sequences from ~530 to ~1000 meters sub- basement (msb), but is concentrated in the lava-dike transition (754 to 811 msb) and uppermost sheeted dikes. Although present in greater quantities than in Hole 504B, the amount of anhydrite recovered from the Site 1256 crust is low compared to that predicted by models of hydrothermal circulation (e.g., Sleep, 1991). Two distinct populations of anhydrite are indicated by measurements of 87Sr/86Sr suggesting different fluid evolution paths within Site 1256. One group of anhydrites have 87Sr/86Sr of 0.7070 to 0.7085, close to that of 15 Ma seawater (0.70878), suggesting that some fluids penetrate through the lavas and into the sheeted dikes with only minimal Sr-exchange with the host basalts. A second group, with low 87Sr/86Sr between 0.7048 and 0.7052, indicates precipitation from a fluid that has undergone far greater interaction with basalt. This range is close to that estimated from Sr-isotopic analyses of epidote for the Hole 1256D hydrothermal fluids (87Sr/86Sr ~0.705). Sr/Ca and 87Sr/86Sr indicate a similar relationship to that seen at ODP Hole 504B suggesting that

Hydrothermal alteration of deep sea sediments from the Izu-Bonin fore arc basin, leg 126, ODp. Izuter dot Ogasawara ko no shinkaitei taisekibutsu ni okeru netsusui henshitsu sayo

Energy Technology Data Exchange (ETDEWEB)

Tazaki, K. (Shimane Univ., Shimane (Japan). Faculty of Science)

1991-08-25

The deep sea drilling according to ODP has been performed in the Izu-Bonin arc during a period of April 22 to June 19 in 1989, and the drilling across the forearc, island arc and backarc was successful in the Leg 126 of it. The drill length of 1682 m at Site 793 was achieved and it is the deepest world record including the drilling of basement. In this report, the various measurements and observations were performed focussing the hydrothermal effects accompanied with the volcanic activities, on the Site 793 achieved the longest drilling in the forearc basin and the Site 792 in the same forearc. As a result, there are many dehydration veins, clastic dikes and small faults in the volcanic sediments, and the gypsum, smectite, zeolite and prehnite etc. are filled in these parts as a zonal distribution, suggesting the thermal gradient and thermal history at that time. The volcanic glass and feldspar etc. are changed partly to the smectite and zeolite etc. by the hydrothermal alteration. The effective keys as mentioned above were obtained about the temperature condition of hydrothermal alteration and the paleo-environment. 31 refs., 15figs.

21 CFR 184.1387 - Lactase enzyme preparation from Candida pseudotropicalis.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Lactase enzyme preparation from Candida pseudotropicalis. 184.1387 Section 184.1387 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND... preparation from Candida pseudotropicalis. (a) This enzyme preparation is derived from the nonpathogenic...

21 CFR 184.1027 - Mixed carbohydrase and protease enzyme product.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Mixed carbohydrase and protease enzyme product. 184... RECOGNIZED AS SAFE Listing of Specific Substances Affirmed as GRAS § 184.1027 Mixed carbohydrase and protease enzyme product. (a) Mixed carbohydrase and protease enzyme product is an enzyme preparation that includes...

21 CFR 184.1697 - Riboflavin-5′-phosphate (sodium).

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Riboflavin-5â²-phosphate (sodium). 184.1697 Section... SAFE Listing of Specific Substances Affirmed as GRAS § 184.1697 Riboflavin-5′-phosphate (sodium). (a) Riboflavin-5′-phosphate (sodium) (C17H20N4O9PNa·2H2O, CAS Reg. No 130-40-5) occurs as the dihydrate in yellow...

20 CFR 220.184 - If the annuitant becomes disabled by another impairment(s).

Science.gov (United States)

2010-04-01

... impairment(s). 220.184 Section 220.184 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE... Activity or Medical Improvement § 220.184 If the annuitant becomes disabled by another impairment(s). If a new severe impairment(s) begins in or before the month in which the last impairment(s) ends, the Board...

21 CFR 184.1250 - Cellulase enzyme preparation derived from Trichoderma longibrachiatum.

Science.gov (United States)

2010-04-01

... Trichoderma longibrachiatum. 184.1250 Section 184.1250 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT....1250 Cellulase enzyme preparation derived from Trichoderma longibrachiatum. (a) Cellulase enzyme preparation is derived from a nonpathogenic, nontoxicogenic strain of Trichoderma longibrachiatum (formerly T...

Identification of aspartate-184 as an essential residue in the catalytic subunit of cAMP-dependent protein kinase

International Nuclear Information System (INIS)

Buechler, J.A.; Taylor, S.S.

1988-01-01

The hydrophobic carbodiimide dicyclohexylcarbodiimide (DCCD) was previously shown to be an irreversible inhibitor of the catalytic subunit of cAMP-dependent protein kinase, and MgATP protected against inactivation. This inhibition by DCCD indicated that an essential carboxyl group was present at the active site of the enzyme even though identification of that carboxyl group was not possible. This presumably was because a nucleophile on the protein cross-linked to the electrophilic intermediate formed when the carbodiimide reacted with the carboxyl group. To circumvent this problem, the catalytic subunit first was treated with acetic anhydride to block accessible lysine residues, thus preventing intramolecular cross-linking. The DCCD reaction then was carried out in the presence of [ 14 C]glycine ethyl ester in order to trap any electrophilic intermediates that were generated by DCCD. The modified protein was treated with trypsin, and the resulting peptides were separated by HPLC. Two major radioactive peptides were isolated as well as one minor peptide. MgATP protected all three peptides from covalent modification. The two major peaks contained the same modified carboxyl group, which corresponded to Asp-184. The minor peak contained a modified glutamic acid, Glu-91. Both of these acidic residues are conserved in all protein kinases, which is consistent with their playing essential roles. The positions of Asp-184 and Glu-91 have been correlated with the overall domain structure of the molecule. Asp-184 may participate as a general base catalyst at the active site. A third carboxyl group, Glu-230, also was identified

46 CFR 184.200 - General.

Science.gov (United States)

2010-10-01

... MISCELLANEOUS SYSTEMS AND EQUIPMENT Cooking and Heating § 184.200 General. Cooking and heating equipment must be suitable for marine use. Equipment designed and installed in accordance with American Boat and Yacht Council (ABYC) A-3, “Galley Stoves,” and A-7, “Boat Heating Systems,” or with National Fire Protection...

21 CFR 184.1655 - Propane.

Science.gov (United States)

2010-04-01

... CONSUMPTION (CONTINUED) DIRECT FOOD SUBSTANCES AFFIRMED AS GENERALLY RECOGNIZED AS SAFE Listing of Specific Substances Affirmed as GRAS § 184.1655 Propane. (a) Propane (empirical formula C3H8, CAS Reg. No. 74-98-6) is also known as dimethylmethane or propyl hydrid. It is a colorless, odorless, flammable gas at normal...

21 CFR 184.1585 - Papain.

Science.gov (United States)

2010-04-01

... Substances Affirmed as GRAS § 184.1585 Papain. (a) Papain (CAS Reg. No. 9001-73-4) is a proteolytic enzyme derived from Carica papaya L. Crude latex containing the enzyme is collected from slashed unripe papaya... latex or by precipitation from an aqueous solution of latex. The resulting enzyme preparation may be...

Nuclear high-spin data for A = 174, 176 and 184

Energy Technology Data Exchange (ETDEWEB)

Junde, Huo [Jilin Univ. (China). Dept. of Physics

1996-06-01

Nuclear high-spin data are important in the frontier areas of nuclear structure physics. The information on A = 174, 176 and 184 mass chains from various reaction experiments together with their adopted high-spin levels and gamma transition properties are presented and discussed. High-spin data for A = 174, 176 and 184 mass chains were evaluated in 1995.

Spectroscopic Evolution of Disintegrating Planetesimals: Minute to Month Variability in the Circumstellar Gas Associated with WD 1145+017

Energy Technology Data Exchange (ETDEWEB)

Redfield, Seth; Cauley, P. Wilson; Duvvuri, Girish M. [Astronomy Department and Van Vleck Observatory, Wesleyan University, Middletown, CT 06459 (United States); Farihi, Jay [Department of Physics and Astronomy, University College London, London WC1E 6BT (United Kingdom); Parsons, Steven G. [Department of Physics and Astronomy, University of Sheffield, Sheffield, S3 7RH (United Kingdom); Gänsicke, Boris T., E-mail: sredfield@wesleyan.edu [Department of Physics, University of Warwick, Coventry CV4 7AL (United Kingdom)

2017-04-10

With the recent discovery of transiting planetary material around WD 1145+017, a critical target has been identified that links the evolution of planetary systems with debris disks and their accretion onto the star. We present a series of observations, five epochs over a year, taken with Keck and the VLT, which for the first time show variability of circumstellar absorption in the gas disk surrounding WD 1145+017 on timescales of minutes to months. Circumstellar absorption is measured in more than 250 lines of 14 ions among 10 different elements associated with planetary composition, e.g., O, Mg, Ca, Ti, Cr, Mn, Fe, and Ni. Broad circumstellar gas absorption with a velocity spread of 225 km s{sup −1} is detected, but over the course of a year blueshifted absorption disappears, while redshifted absorption systematically increases. A correlation of equivalent width and oscillator strength indicates that the gas is not highly optically thick (median τ ≈ 2). We discuss simple models of an eccentric disk coupled with magnetospheric accretion to explain the basic observed characteristics of these high-resolution and high signal-to-noise observations. Variability is detected on timescales of minutes in the two most recent observations, showing a loss of redshifted absorption for tens of minutes, coincident with major transit events and consistent with gas hidden behind opaque transiting material. This system currently presents a unique opportunity to learn how the gas causing the spectroscopic, circumstellar absorption is associated with the ongoing accretion evidenced by photospheric contamination, as well as the transiting planetary material detected in photometric observations.

21 CFR 184.1635 - Potassium iodate.

Science.gov (United States)

2010-04-01

... ingredient is used as a dough strengthener as defined in § 170.3(o)(6) of this chapter. (d) The ingredient is used in the manufacture of bread in accordance with § 184.1(b)(2) of this chapter in an amount not to...

The Mediterranean sediments (ODP Hole 967): memory of the last interglacial stage.

Science.gov (United States)

Briqueu, L.; Lauer-Leredde, C.

2003-04-01

Many studies have shown that the alternation between carbonated levels (nanofossil ooze) and rich organic matter levels (sapropels) in the oriental Mediterranean Sea is driven for the Plio-quaternary by the climatic variations resulting from the astronomical forcings (e.g. Emeis and Sakamoto, 1998). The high resolution digitalisation of the colour photos of the ODP Leg 160 sedimentary cores, and the extraction (using image processing software) of the 3 fundamental colour components RGB allow to obtain high resolution continuous signals. This leads to a resolution more resolving (˜500 times) than the one resulting from the arctic and antarctic ice core sampling. The strong correlations between the obtained signals and the variations of the δO18 isotopic composition of sea water allow to establish a precise age model. After the time-tuning of the sedimentary column, the succession of climatic events, with periods lower than the precession one (˜23 ka), can be explored. About twenty climatic events, which induced significant variations of the sediment composition, can then be observed during the last interglacial period (100 to 128 kyr). For example, the temperature high, responsible of the Heinrich 11 event during the isotopic stage 5e (Eemien) in the atlantic ocean, is clearly registered in the oriental Mediterranean sea by a 4-cm-thick marl layer. The sapropel stage S5 is found during the following cooling stage. The sapropel development is stopped by a cold event, quite short (˜500 years), well-known in the occidental Mediterranean sea (Sanchez-Goñi et al., 2000) and also visible on the Greenland δO18 data. On the contrary, this event does not appear on the Vostok data, which seems to have been filtered for the high frequencies and to be slightly out of phase (˜5 kyr). The strong correlation between the Mediterranean and the Greenland signals should also be pointed out. References: Emeis K.C, and Sakamoto T. (Eds), 1998. The sapropel theme of Leg 160. Proc

21 CFR 184.1685 - Rennet (animal-derived) and chymosin preparation (fermentation-derived).

Science.gov (United States)

2010-04-01

... (fermentation-derived). 184.1685 Section 184.1685 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF... (animal-derived) and chymosin preparation (fermentation-derived). (a)(1) Rennet and bovine rennet are... clear solution containing the active enzyme chymosin (E.C. 3.4.23.4). It is derived, via fermentation...

Revised tuning of Ocean Drilling Program Site 964 and KC01B (Mediterranean) and implications for the delta 0-18, tephra, calcareous nannofossil, and geomagnetic reversal chronologies of the past 1.1 Myr

NARCIS (Netherlands)

Lourens, L.J.

2004-01-01

High-resolution color reflectance records of KC01 and KC01B (Calabrian Ridge, Ionian Sea) are presented and compared with a modified spliced high-resolution color reflectance record of Ocean Drilling Program (ODP) Site 964. This comparison revealed that KC01B is characterized by intensive

Basaltic magmatism at the Juan de Fuca Ridge, NE Pacific ocean (ODP Leg 168): geological control on chemical zonation

Science.gov (United States)

Cortesogno, L.; Gaggero, L.; Marescotti, P.

2003-04-01

symmetric increase of incompatible elements in more evolved compositions is consistent with crystal fractionation processes. On the whole, a relative compositional homogeneity arises in most of the Sites but for a wide range at Site 1026 (Mg# = 66 - 57; Zr = 101 - 128 ppm). At Site 1025, the massive Fe-basalt flow (Mg# = 46-52; Zr = 151-163 ppm) begins with more evolved terms. At Site 1027 the lower pillow lavas (Mg#: 58-59, Zr: 28-35) are overlain by more primitive flows (Mg# 64-65, Zr = 65-66 ppm). The top of the sequence is represented by a diabase sill, interpreted as an off-axis diabase (Davis, Fisher, Firth et al., 1997) showing very high Mg# (69-79) and relatively higher Ti, Zr, P contents. References Davis, E.E., Fisher, A.T., Firth, J.V., et al., 1997. Proc. ODP, Init. Repts, 168: College Station, TX (Ocean Drilling Program). Pearce J.A. &Parkinson I.J. 1993 Trace element models for mantle melting: application to volcanic arc petrogenesis. In: Prochard, Alabaster, Harris, Neary eds. 1993 magmatic processes and plate tectonics, GSSP 76, 373-403

Early Palaeogene planktic foraminiferal and carbon isotope stratigraphy, ODP hole 762C, Exmouth plateau, Northwest Australian margin

International Nuclear Information System (INIS)

Hancock, H.J.L.; Dickens, G.R.; Henderson, R.R.; Chaproniere, G.C.

1999-01-01

Full text: Although the North West Shelf of Australia is an important region for petroleum exploration and palaeoceanographic investigations the stratigraphy for the Palaeogene is poorly documented, especially for foraminifera. Ocean Drilling Program (ODP) Site 762 on the Exmouth Plateau contains an expanded Palaeogene sequence with abundant, calcareous microfossils. Early Palaeogene cores from this location were examined in this study for their planktic foraminiferal assemblages and carbon isotope compositions (Subbotina spp.). The sequence from 502.96 to 307.8 mbsf was deposited between the early Paleocene and Middle Eocene, and contains all planktic foraminiferal Zones Plc through P10 of the current global scheme, except Subzone P4b. Planktic foraminifera are generally very well preserved and 75 species belonging to 17 genera were identified. Despite a relatively high latitude Palaeogene location for Site 762, planktic foraminiferal biozones are generally in phase with those of the currently used global scheme for subtropical locations (Berggren et al., 1995). However, rare, patchy or non-occurrences of the zonal marker species Globanomalina pseudomenardii, Morozovella velascoensis, M formosa, Planorotalites palmerae and Hanfkenina nuttalli, make some correlations difficult. Planktic foraminiferal assemblages show three increasing diversity trends: at the P3a P3b boundary with the first appearance of muricate Acarinina species; in the middle of P4a b with the first appearances of many warm water Morozovella and Acarinina species and at the P8/P9 zonal boundary with the arrival of late early Eocene Acarinina species. Overall, trends in 13 C of planktic foraminifera are similar in shape to global isotope curves spanning the early Palaeogene, although the prominent short term negative excursion across the latest Paleocene thermal maximum (LPTM) is partly missing, probably because of a gap in core recovery. Combined with nannofossil biostratigraphy and a

Remaining Sites Verification Package for the 100-D-9 Boiler Fuel Oil Tank Site. Attachment to Waste Site Reclassification Form 2006-030

International Nuclear Information System (INIS)

Dittmer, L.M.

2006-01-01

The 100-D-9 site is the former location of an underground storage tank used for holding fuel for the 184-DA Boiler House. Results of soil-gas samples taken from six soil-gas probes in a rectangle around the site the tank had been removed from concluded that there were no volatile organic compounds at detectable levels in the area. The 100-D-9 Boiler Fuel Oil Tank Site meets the remedial action objectives specified in the Remaining Sites ROD. The results demonstrated that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River

AN OPEN-LABEL EXTENSION STUDY OF PARATHYROID HORMONE RHPTH(1-84) IN ADULTS WITH HYPOPARATHYROIDISM.

Science.gov (United States)

Lakatos, Peter; Bajnok, Laszlo; Lagast, Hjalmar; Valkusz, Zsuzsanna

2016-05-01

Hypoparathyroidism is characterized by inadequate parathyroid hormone (PTH), resulting in hypocalcemia, hyperphosphatemia, and bone abnormalities. Adults with hypoparathyroidism treated with recombinant human PTH, rhPTH(1-84), in the 24-week, phase III REPLACE study maintained serum calcium despite reductions in oral calcium and active vitamin D. This study assessed the long-term efficacy and safety of rhPTH(1-84) for hypoparathyroidism. This was a 24-week, open-label, flexible-dose extension study of REPLACE (REPEAT) conducted in 3 outpatient centers in Hungary. Patients who previously completed or enrolled in REPLACE received 50 μg/day rhPTH(1-84), escalated to 75 and then to 100 μg/day, if needed, to reduce active vitamin D and oral calcium. The primary endpoint was ≥50% reduction in oral calcium (or ≤500 mg/day) and active vitamin D (or calcitriol ≤0.25 μg/day or alfacalcidol ≤0.50 μg/day) with normocalcemia. Twenty-four patients (n = 16 previously treated with rhPTH[1-84]; n = 8 rhPTH[1-84]-naïve) were enrolled and completed the study. At Week 24, 75% of patients (95% confidence interval [CI], 53.3-90.2%) achieved the study endpoint; 58% eliminated oral calcium and active vitamin D. Urinary calcium, serum phosphate, and calcium × phosphate (Ca × P) product decreased by Week 24. Mean serum bone turnover markers increased with rhPTH(1-84). Treatment-emergent adverse events (TEAEs) were reported by 92% of patients. No serious adverse events (AEs) occurred. This study used a simplified treatment algorithm intended to better mimic typical clinical practice and demonstrated the extended efficacy and safety of rhPTH(1-84) in patients with hypoparathyroidism and confirmed the REPLACE findings. Sustained rhPTH(1-84) efficacy up to 48 weeks was observed despite treatment interruption between studies.

Novel degenerate PCR method for whole genome amplification applied to Peru Margin (ODP Leg 201 subsurface samples

Directory of Open Access Journals (Sweden)

Amanda eMartino

2012-01-01

Full Text Available A degenerate PCR-based method of whole-genome amplification, designed to work fluidly with 454 sequencing technology, was developed and tested for use on deep marine subsurface DNA samples. The method, which we have called Random Amplification Metagenomic PCR (RAMP, involves the use of specific primers from Roche 454 amplicon sequencing, modified by the addition of a degenerate region at the 3’ end. It utilizes a PCR reaction, which resulted in no amplification from blanks, even after 50 cycles of PCR. After efforts to optimize experimental conditions, the method was tested with DNA extracted from cultured E. coli cells, and genome coverage was estimated after sequencing on three different occasions. Coverage did not vary greatly with the different experimental conditions tested, and was around 62% with a sequencing effort equivalent to a theoretical genome coverage of 14.10X. The GC content of the sequenced amplification product was within 2% of the predicted values for this strain of E. coli. The method was also applied to DNA extracted from marine subsurface samples from ODP Leg 201 site 1229 (Peru Margin, and results of a taxonomic analysis revealed microbial communities dominated by Proteobacteria, Chloroflexi, Firmicutes, Euryarchaeota, and Crenarchaeota, among others. These results were similar to those obtained previously for those samples; however, variations in the proportions of taxa show that community analysis can be sensitive to both the amplification technique used and the method of assigning sequences to taxonomic groups. Overall, we find that RAMP represents a valid methodology for amplifying metagenomes from low biomass samples.

Comment: 184 [Taxonomy Icon

Lifescience Database Archive (English)

Full Text Available keru Nakazato (Database Center for Life Science) アゲハ 標本版（夏型） かなりボロっちいですが、参考のために。。。 nakazato 2009/06/16 18:52:42 2010/01/14 19:53:50 ... ...Asian Swallowtail Papilio xuthus Papilio_xuthus_L.png 184.png Takeru Nakazato (Database Center for Life Scie...nce) licensed under CC Attribution2.1 Japan 撮影:仲里猛留（ライフサイエンス統合データベースセンター） Photo: Ta

Gly184 of the Escherichia coli cAMP receptor protein provides optimal context for both DNA binding and RNA polymerase interaction.

Science.gov (United States)

Hicks, Matt N; Gunasekara, Sanjiva; Serate, Jose; Park, Jin; Mosharaf, Pegah; Zhou, Yue; Lee, Jin-Won; Youn, Hwan

2017-10-01

The Escherichia coli cAMP receptor protein (CRP) utilizes the helix-turn-helix motif for DNA binding. The CRP's recognition helix, termed F-helix, includes a stretch of six amino acids (Arg180, Glu181, Thr182, Val183, Gly184, and Arg185) for direct DNA contacts. Arg180, Glu181 and Arg185 are known as important residues for DNA binding and specificity, but little has been studied for the other residues. Here we show that Gly184 is another F-helix residue critical for the transcriptional activation function of CRP. First, glycine was repeatedly selected at CRP position 184 for its unique ability to provide wild type-level transcriptional activation activity. To dissect the glycine requirement, wild type CRP and mutants G184A, G184F, G184S, and G184Y were purified and their in vitro DNA-binding activity was measured. G184A and G184F displayed reduced DNA binding, which may explain their low transcriptional activation activity. However, G184S and G184Y displayed apparently normal DNA affinity. Therefore, an additional factor is needed to account for the diminished transcriptional activation function in G184S and G184Y, and the best explanation is perturbations in their interaction with RNA polymerase. The fact that glycine is the smallest amino acid could not fully warrant its suitability, as shown in this study. We hypothesize that Gly184 fulfills the dual functions of DNA binding and RNA polymerase interaction by conferring conformational flexibility to the F-helix.

Recombinant human parathyroid hormone related protein 1-34 and 1-84 and their roles in osteoporosis treatment.

Directory of Open Access Journals (Sweden)

Hua Wang

Full Text Available Osteoporosis is a common disorder characterized by compromised bone strength that predisposes patients to increased fracture risk. Parathyroid hormone related protein (PTHrP is one of the candidates for clinical osteoporosis treatment. In this study, GST Gene Fusion System was used to express recombinant human PTHrP (hPTHrP 1-34 and 1-84. To determine whether the recombinant hPTHrP1-34 and 1-84 can enhance renal calcium reabsorption and promote bone formation, we examined effects of recombinant hPTHrP1-34 and 1-84 on osteogenic lineage commitment in a primary bone marrow cell culture system and on osteoporosis treatment. Results revealed that both of recombinant hPTHrP1-34 and 1-84 increased colony formation and osteogenic cell differentiation and mineralization in vitro; however, the effect of recombinant hPTHrP1-84 is a little stronger than that of hPTHrP1-34. Next, ovariectomy was used to construct osteoporosis animal model (OVX to test activities of these two recombinants in vivo. HPTHrP1-84 administration elevated serum calcium by up-regulating the expression of renal calcium transporters, which resulted in stimulation of osteoblastic bone formation. These factors contributed to augmented bone mass in hPTHrP1-84 treated OVX mice but did not affect bone resorption. There was no obvious bone mass alteration in hPTHrP1-34 treated OVX mice, which may be, at least partly, associated with shorter half-life of hPTHrP1-34 compared to hPTHrP1-84 in vivo. This study implies that recombinant hPTHrP1-84 is more effective than hPTHrP1-34 to enhance renal calcium reabsorption and to stimulate bone formation in vivo.

On the 1285,0 keV; 55-184WW state structure

International Nuclear Information System (INIS)

Kupryashkin, V.T.; Muzalev, P.N.; Feoktistov, A.I.

1977-01-01

The structure of the 184 W (1285.0 keV; 5 - ) states is discussed. Decay of this level is shown schematically. The data on multiplicities and probabilities of the γ-transitions for the levels 1285.0 keV; 5 - of 184 W and 1621.4 keV; 5 - of 182 W are presented. The transition amplitude parameters are plotted for different probabilities B(E3;5 - → I + ). The relation between the collective transition amplitudes is established. Transition amplitude parameters and their collective and two-particle components, as well as impurity amplitudes of collective excitation wave functions and matrix elements are given

NP-184[2-(5-methyl-2-furyl) benzimidazole], a novel orally active antithrombotic agent with dual antiplatelet and anticoagulant activities.

Science.gov (United States)

Kuo, Heng-Lan; Lien, Jin-Cherng; Chung, Ching-Hu; Chang, Chien-Hsin; Lo, Shyh-Chyi; Tsai, I-Chun; Peng, Hui-Chin; Kuo, Sheng-Chu; Huang, Tur-Fu

2010-06-01

The established antiplatelet and anticoagulant agents show beneficial effects in the treatment of thromboembolic diseases; however, these drugs still have considerable limitations. The effects of NP-184, a synthetic compound, on platelet functions, plasma coagulant activity, and mesenteric venule thrombosis in mice were investigated. NP-184 concentration-dependently inhibited the human platelet aggregation induced by collagen, arachidonic acid (AA), and U46619, a thromboxane (TX)A(2) mimic, with IC(50) values of 4.5 +/- 0.2, 3.9 +/- 0.1, and 9.3 +/- 0.5 microM, respectively. Moreover, NP-184 concentration-dependently suppressed TXA(2) formations caused by collagen and AA. In exploring effects of NP-184 on enzymes involved in TXA(2) synthesis, we found that NP-184 selectively inhibited TXA(2) synthase activity with an IC(50) value of 4.3 +/- 0.2 microM. Furthermore, NP-184 produced a right shift of the concentration-response curve of U46619, indicating a competitive antagonism on TXA(2)/prostaglandin H(2) receptor. Intriguingly, NP-184 also caused a concentration-dependent prolongation of the activated partial thromboplastin time (aPTT) with no changes in the prothrombin and thrombin time, indicating that it selectively impairs the intrinsic coagulation pathway. Oral administration of NP-184 significantly inhibited thrombus formation of the irradiated mesenteric venules in fluorescein sodium-treated mice without affecting the bleeding time induced by tail transection. However, after oral administration, NP-184 inhibited the ex vivo mouse platelet aggregation triggered by collagen and U46619 and also prolonged aPTT. Taken together, the dual antiplatelet and anticoagulant activities of NP-184 may have therapeutic potential as an oral antithrombotic agent in the treatment of thromboembolic disorders.

Combined in-depth, 3D, en face imaging of the optic disc, optic disc pits and optic disc pit maculopathy using swept-source megahertz OCT at 1050 nm.

Science.gov (United States)

Maertz, Josef; Kolb, Jan Philip; Klein, Thomas; Mohler, Kathrin J; Eibl, Matthias; Wieser, Wolfgang; Huber, Robert; Priglinger, Siegfried; Wolf, Armin

2018-02-01

To demonstrate papillary imaging of eyes with optic disc pits (ODP) or optic disc pit associated maculopathy (ODP-M) with ultrahigh-speed swept-source optical coherence tomography (SS-OCT) at 1.68 million A-scans/s. To generate 3D-renderings of the papillary area with 3D volume-reconstructions of the ODP and highly resolved en face images from a single densely-sampled megahertz-OCT (MHz-OCT) dataset for investigation of ODP-characteristics. A 1.68 MHz-prototype SS-MHz-OCT system at 1050 nm based on a Fourier-domain mode-locked laser was employed to acquire high-definition, 3D datasets with a dense sampling of 1600 × 1600 A-scans over a 45° field of view. Six eyes with ODPs, and two further eyes with glaucomatous alteration or without ocular pathology are presented. 3D-rendering of the deep papillary structures, virtual 3D-reconstructions of the ODPs and depth resolved isotropic en face images were generated using semiautomatic segmentation. 3D-rendering and en face imaging of the optic disc, ODPs and ODP associated pathologies showed a broad spectrum regarding ODP characteristics. Between individuals the shape of the ODP and the appending pathologies varied considerably. MHz-OCT en face imaging generates distinct top-view images of ODPs and ODP-M. MHz-OCT generates high resolution images of retinal pathologies associated with ODP-M and allows visualizing ODPs with depths of up to 2.7 mm. Different patterns of ODPs can be visualized in patients for the first time using 3D-reconstructions and co-registered high-definition en face images extracted from a single densely sampled 1050 nm megahertz-OCT (MHz-OCT) dataset. As the immediate vicinity to the SAS and the site of intrapapillary proliferation is located at the bottom of the ODP it is crucial to image the complete structure and the whole depth of ODPs. Especially in very deep pits, where non-swept-source OCT fails to reach the bottom, conventional swept-source devices and the MHz-OCT alike are feasible

[The replacement therapy of rPTH(1-84) in established rat model of hypothyroidism].

Science.gov (United States)

Ding, Zhiwei; Li, Tiancheng; Liu, Yuhe; Xiao, Shuifang

2015-12-01

To investigate the replacement therapy of rPTH(1-84) (recombinant human parathyroid hormone (1-84)) to hypothyroidism in established rat model. Rat model of hypothyroidism was established by resecting parathyroids. A total of 30 rats with removal of parathyroids were divided into 6 groups randomly, 5 in each group, and applied respectively with saline injection (negative control group), calcitriol treatment (positive control group) and quadripartite PTH administration with dose of 20, 40, 80 and 160 µg/kg (experimental groups). Saline and rPTH(1-84) were injected subcutaneously daily. Calcitriol was gavaged once a day. Sham-operation was conducted in 5 rats of negative control group. To verify the authenticity of the rat model with hypothyroidism, the serum was insolated centrifugally from rat blood that was obtained from angular vein at specific time to measure calcium and phosphorus concentration. Urine in 12 hours was collected by metabolic cages and the calcium concentration was measured. After 10-week drug treatment, the experiment was terminated and bilateral femoral bone and L2-5 lumbar vertebra were removed from rats. Bone mineral density (BMD)of bilateral femoral bone and lumbar vertebra was analyzed by dual X-ray absorptiometry (DXA). The concentration of bone alkaline phosphatase (BALP) in serum was determined by radioimmunoassay. The rat model with hypothyroidism was obtained by excising parathyroid gland and was verified by monitoring calcium and phosphorus concentration subsequently. Administration of rPTH(1-84) in the dose of 80 or 160 µg/kg made serum calcium and phosphorus back to normal levels, with no significant difference between the doses (P>0.05). The BMD in each group of rats with rPTH(1-84) administration was increased significantly (P0.05). Calcium and phosphorus return to normal level by administration of rPTH(1-84) in the dose of 80 µg/kg or 160 µg/kg, with increase in BMD. Calcitriol can return the level of calcium to normal and

Novel Degenerate PCR Method for Whole-Genome Amplification Applied to Peru Margin (ODP Leg 201) Subsurface Samples

Science.gov (United States)

Martino, Amanda J.; Rhodes, Matthew E.; Biddle, Jennifer F.; Brandt, Leah D.; Tomsho, Lynn P.; House, Christopher H.

2011-01-01

A degenerate polymerase chain reaction (PCR)-based method of whole-genome amplification, designed to work fluidly with 454 sequencing technology, was developed and tested for use on deep marine subsurface DNA samples. While optimized here for use with Roche 454 technology, the general framework presented may be applicable to other next generation sequencing systems as well (e.g., Illumina, Ion Torrent). The method, which we have called random amplification metagenomic PCR (RAMP), involves the use of specific primers from Roche 454 amplicon sequencing, modified by the addition of a degenerate region at the 3′ end. It utilizes a PCR reaction, which resulted in no amplification from blanks, even after 50 cycles of PCR. After efforts to optimize experimental conditions, the method was tested with DNA extracted from cultured E. coli cells, and genome coverage was estimated after sequencing on three different occasions. Coverage did not vary greatly with the different experimental conditions tested, and was around 62% with a sequencing effort equivalent to a theoretical genome coverage of 14.10×. The GC content of the sequenced amplification product was within 2% of the predicted values for this strain of E. coli. The method was also applied to DNA extracted from marine subsurface samples from ODP Leg 201 site 1229 (Peru Margin), and results of a taxonomic analysis revealed microbial communities dominated by Proteobacteria, Chloroflexi, Firmicutes, Euryarchaeota, and Crenarchaeota, among others. These results were similar to those obtained previously for those samples; however, variations in the proportions of taxa identified illustrates well the generally accepted view that community analysis is sensitive to both the amplification technique used and the method of assigning sequences to taxonomic groups. Overall, we find that RAMP represents a valid methodology for amplifying metagenomes from low-biomass samples. PMID:22319519

Selective LXRα inhibitory effects observed in plant extracts of MEH184 (Parthenocissua tricuspidata) and MEH185 (Euscaphis japonica)

International Nuclear Information System (INIS)

Kim, Kang Ho; Choi, Seung Hyun; Lee, Thomas S.; Oh, Won Keun; Kim, Dong Sun; Kim, Jae Bum

2006-01-01

Liver X receptors (LXRs) are nuclear hormone receptors that behave as lipid sensors of cellular cholesterol and fatty acid. Although LXR activation can alleviate hypercholesterolemia by inducing cholesterol efflux, it also results in undesirable effects of fatty acid synthesis, resulting in hepatic steatosis and hyperlipidemia. Therefore, it is critical to identify LXRα inhibitory agents that would repress fatty acid synthesis and hepatic lipid accumulation. In current study, screening of plant extracts used for traditional oriental medicine resulted in the identification of two candidates demonstrating selective LXRα inhibitory activity. These were whole leaf methanol extracts of Parthenocissua tricuspidata (MEH184) and Euscaphis japonica (MEH185). Both MEH184 and MEH185 decreased transcriptional activity of LXRα and the expression of LXRα target genes, such as FAS and ADD1/SREBP1c. Additionally, MEH184 and MEH184 significantly reduced lipogenesis and adipocyte differentiation. Together, the data imply that MEH184 and MEH185 possess selective antagonistic properties on LXRα to downregulate lipogenesis

Diatom and silicoflagellate biostratigraphy for the late Eocene: ODP 1090 (sub-Antarctic Atlantic)

Science.gov (United States)

Barron, John A.; Bukry, David B.; Gersonde, Rainer

2014-01-01

Abundant and well-preserved diatoms and silicofl agellate assemblages are documented through a complete late Eocene sequence, ODP Hole 1090B, recovered from the southern Agulhas Ridge in the sub-Antarctic South Atlantic. A sequence of Cestodiscus (diatom) species occurrence events involving C. pulchellus var. novazealandica, C. fennerae, C. antarcticus, C. convexus, C. trochus, and C. robustus is tied with paleomagnetic stratigraphy and provides the basis of proposing a new diatom zonation for the latest middle Eocene to early Oligocene (~37.6–33.4 Ma) of the sub-Antarctic South Atlantic. Comparison with previously published diatom occurrence charts suggested this zonation should be applicable throughout the low latitude regions of the world’s oceans. Silicofl agellates belong to the Dictyocha hexacantha and the overlying Corbisema apiculata Zones. The late Eocene succession of silicofl agellate species is dominated by Naviculopsis (20–60%). Naviculopsis constricta and N. foliacea dominate the D. hexacantha Zone, followed by the N. constricta, then N. biapiculata in the C. apiculata Zone. Cold-water Distephanus is most abundant in the latest Eocene along with N. biapiculata. The tops of zonal guide fossils Dictyocha hexacantha and Hannaites quadria (both 36.6 Ma) and Dictyocha spinosa (37.1 Ma) are tied with paleomagnetic stratigraphy.

Identification and verification of a pathogenic MLH1 mutation c.1145dupA in a Lynch syndrome family

Directory of Open Access Journals (Sweden)

Huang Feifei

2017-06-01

Full Text Available Lynch syndrome (LS, an autosomal-dominant disorder with an increased risk of predominantly colorectal and endometrial cancers, is caused by germ-line mutations in mismatch repair genes. The identification of germ-line mutations that predispose to cancer is important to further our understanding of tumorigenesis, guide patient management and inform the best practice for healthcare. A 45-year-old woman with atypical endometrial hyperplasia who suffered colon cancer at the age of 30 years underwent hysterectomy and genetic counseling. Pedigree analysis revealed her family fulfilling the Amsterdam I criteria. Next-generation sequencing was offered to the patient. A mutation in the MLH1 gene, c.1145dupA, was identified and verified by Sanger sequencing. In addition, her nine family members were tested for the mutation. Two were affected (colon cancer at the age of 43 years and 45 years and one healthy relative carried the same mutation in the MLH1 gene. The mutation resulted in a frame-shift (p.Met383Aspfs*12 located in exon12, as well as a polypeptide truncation of 393 amino acids by the formation of a premature stop codon. An immunohistochemistry analysis of endometrial hyperplasia tissues revealed defects in MLH1 and PMS2 protein expression in the patient. Based on the 2015 American College of Medical Genetics and Genomics (ACMG guideline, we report this MLH1 c.1145dupA variation to be a pathogenic mutation that contributes to a strongly increased cancer risk in this LS family. Proper screening suggestions were offered to the three affected patients and the healthy carrier. To the best of our knowledge, this germ-line mutation of MLH1 was previously submitted to the Leiden Open Variation Database (LOVD database, but no comprehensive evidence or supporting observations were reported previously in the literature. The present report found a single nucleotide insertion in exon12 of the MLH1 gene, which can be considered causative of Lynch phenotype

Combined in-beam electron and γ-ray spectroscopy of 184,186Hg

International Nuclear Information System (INIS)

Scheck, M.; Butler, P. A.; Gaffney, L. P.; Carrol, R. J.; Cox, D.; Joss, D. T.; Herzberg, R.-D.; Page, R. D.; Papadakis, P.; Watkins, H. V.; Bree, N.; Huyse, M.; Van Duppen, P.; Grahn, T.; Greenlees, P. T.; Herzan, A.; Jakobsson, U.; Jones, P.; Julin, R.; Juutinen, S.

2011-01-01

By exploiting the SAGE spectrometer a simultaneous measurement of conversion electrons and γ rays emitted in the de-excitation of excited levels in the neutron-deficient nuclei 184,186 Hg was performed. The light Hg isotopes under investigation were produced using the 4n channels of the fusion-evaporation reactions of 40 Ar and 148,150 Sm. The measured K- and L-conversion electron ratios confirmed the stretched E2 nature of several transitions of the yrast bands in 184,186 Hg. Additional information on the E0 component of the 2 2 + →2 1 + transition in 186 Hg was obtained.

Combined in-beam electron and gamma-ray spectroscopy of (184,186)Hg

CERN Document Server

Scheck, M; Rahkila, P; Butler, P A; Larsen, A C; Sandzelius, M; Scholey, C; Carrol, R J; Papadakis, P; Jakobsson, U; Grahn, T; Joss, D T; Watkins, H V; Juutinen, S; Bree, N; Cox, D; Huyse, M; Uusitalo, J; Leino, M; Ruotsalainen, P; Nieminen, P; Srebrny, J; Van Duppen, P; Herzan, A; Greenlees, P T; Julin, R; Herzberg, R D; Hauschild, K; Pakarinen, J; Page, R D; Peura, P; Gaffney, L P; Kowalczyk, M; Rinta-Antila, S; Saren, J; Lopez-Martens, A; Sorri, J; Ketelhut, S

2011-01-01

By exploiting the SAGE spectrometer a simultaneous measurement of conversion electrons and gamma rays emitted in the de-excitation of excited levels in the neutron-deficient nuclei (184,186)Hg was performed. The light Hg isotopes under investigation were produced using the 4n channels of the fusion-evaporation reactions of (40)Ar and (148,150)Sm. The measured K- and L-conversion electron ratios confirmed the stretched E2 nature of several transitions of the yrast bands in (184,186)Hg. Additional information on the E0 component of the 2(2)(+) -> 2(1)(+) transition in (186)Hg was obtained.

21 CFR 184.1165 - n-Butane and iso-butane.

Science.gov (United States)

2010-04-01

... FOR HUMAN CONSUMPTION (CONTINUED) DIRECT FOOD SUBSTANCES AFFIRMED AS GENERALLY RECOGNIZED AS SAFE Listing of Specific Substances Affirmed as GRAS § 184.1165 n-Butane and iso-butane. (a) n-Butane and iso..., odorless, flammable gases at normal temperatures and pressures. They are easily liquefied under pressure at...

Bacillus subtilis HJ18-4 from traditional fermented soybean food inhibits Bacillus cereus growth and toxin-related genes.

Science.gov (United States)

Eom, Jeong Seon; Lee, Sun Young; Choi, Hye Sun

2014-11-01

Bacillus subtilis HJ18-4 isolated from buckwheat sokseongjang, a traditional Korean fermented soybean food, exhibits broad-spectrum antimicrobial activity against foodborne pathogens, including Bacillus cereus. In this study, we investigated the antibacterial efficacy and regulation of toxin gene expression in B. cereus by B. subtilis HJ18-4. Expression of B. cereus toxin-related genes (groEL, nheA, nheC, and entFM) was downregulated by B. subtilis HJ18-4, which also exhibited strong antibacterial activity against B. cereus. We also found that water extracts of soy product fermented with B. subtilis HJ18-4 significantly inhibited the growth of B. cereus and toxin expression. These results indicate that B. subtilis HJ18-4 could be used as an antimicrobial agent to control B. cereus in the fermented soybean food industry. Our findings also provide an opportunity to develop an efficient biological control agent against B. cereus. © 2014 The Authors. Journal of Food Science published by Wiley Periodicals, Inc. on behalf of Institute of Food Technologists®

12 CFR 18.4 - Contents of annual disclosure statement.

Science.gov (United States)

2010-01-01

...) Schedule RI (Income Statement); (iv) Schedule RI-A (Changes in Equity Capital); and (v) Schedule RI-B... balance sheet and income statement items; and future plans. (d) Disclaimer. The following legend shall be... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Contents of annual disclosure statement. 18.4...

Behavior of the excited deformed band and search for shape isomerism in 184Hg

International Nuclear Information System (INIS)

Cole, J.D.; Hamilton, J.H.; Ramayya, A.V.; Nettles, W.G.; Kawakami, H.; Spejewski, E.H.; Ijaz, M.A.; Toth, K.S.; Robinson, E.L.; Sastry, K.S.R.; Lin, J.; Avignone, F.T.; Brantley, W.H.; Rao, P.V.G.

1976-01-01

The new isotope 184 Tl has been identified with T 1 / 2 =11 +- 1 sec and the levels in 184 Hg investigated from its decay. The 0 + band head of a deformed band was found to drop to 375 keV in agreement with theoretical predictions. The mean life of the 375-keV 0 + level was measured to be 0.9 +- 0.3 nsec which is a factor of 10 faster than theoretically predicted for a shape-isomeric E2 transition

21 CFR 184.1372 - Insoluble glucose isomerase enzyme preparations.

Science.gov (United States)

2010-04-01

... high fructose corn syrup described in § 184.1866. They are derived from recognized species of precisely... ingredient is used as an enzyme, as defined in § 170.3(o)(9) of this chapter, to convert glucose to fructose. (2) The ingredient is used in high fructose corn syrup, at levels not to exceed current good...

21 CFR 184.1388 - Lactase enzyme preparation from Kluyveromyces lactis.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Lactase enzyme preparation from Kluyveromyces... GENERALLY RECOGNIZED AS SAFE Listing of Specific Substances Affirmed as GRAS § 184.1388 Lactase enzyme preparation from Kluyveromyces lactis. (a) This enzyme preparation is derived from the nonpathogenic...

21 CFR 184.1924 - Urease enzyme preparation from Lactobacillus fermentum.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Urease enzyme preparation from Lactobacillus... GENERALLY RECOGNIZED AS SAFE Listing of Specific Substances Affirmed as GRAS § 184.1924 Urease enzyme..., nontoxicogenic bacterium Lactobacillus fermentum. It contains the enzyme urease (CAS Reg. No. 9002-13-5), which...

Effects of 1.84 GHz radio-frequency electromagnetic field on sperm ...

African Journals Online (AJOL)

sunny t

Key words: 1.84 GHz, radio-frequency electromagnetic field (RF-EMF), epididymis, ... Author(s) agree that this article remains permanently open access under the terms of the ..... mouse testis after the long-term administration of nickel in feed.

Preliminary study on DPA cross-section of 184W in JEFF-3.2

International Nuclear Information System (INIS)

Konno, C.

2016-01-01

I investigated reasons why the DPA cross-section data of JEFF-3.2 184 W was too large above 30 MeV. As a result, I found out that the production yield of 182Ta in mf6 mt5 in JEFF-3.2 184W was too large and demonstrated that the problem was solved if the production yield of 182 Ta was modified. I picked out that the same issue also occurred in 182W, 183W and 186W. The production yield data of all the tungsten isotopes in JEFF-3.2 should be reconfirmed and revised if they have mistakes. (author)

miR-184 and miR-150 promote renal glomerular mesangial cell aging by targeting Rab1a and Rab31.

Science.gov (United States)

Liu, Xiujuan; Fu, Bo; Chen, Dapeng; Hong, Quan; Cui, Jing; Li, Jin; Bai, Xueyuan; Chen, Xiangmei

2015-08-15

The molecular mechanism of kidney aging is not well understood, but the abnormal expression of miRNAs with aging is considered to be an important contributor. miR-184 and miR-150 were screened using a miRNA microarray and qRT-PCR and found to be significantly upregulated in 24-month-old rats. Rat renal primary glomerular mesangial cells (GMCs) were isolated from 3-month and 24-month-old rats for the in vitro analysis of the roles of miR-184 and miR-150 in kidney aging. Bioinformatics analyses suggested that Rab1a and Rab31, which are associated with cell autophagy, were targeted by both miR-184 and miR-150. miR-184 and miR-150 were increased significantly in aging GMCs versus young cells, while Rab1a and Rab31 were significantly lower in aging cells. Furthermore, dual luciferase reporter assays revealed that miR-184 and miR-150 bound to the 3'-UTR of Rab1a and Rab31 mRNAs. Transfection of miR-184 and miR-150 mimics into young GMCs suppressed the expression of Rab1a and Rab31. Transfected cells showed lower autophagy activities and higher levels of cellular oxidative products, leading to the aging of young GMCs. However, miR-184 and miR-150 inhibitors promoted autophagy and reduced oxidative damage by upregulating Rab1a and Rab31 in old GMCs. In conclusion, miR-184 and miR-150 inhibited autophagy, promoting GMC aging. Copyright © 2015 Elsevier Inc. All rights reserved.

16 CFR 1.84 - Draft environmental impact statements: Availability and comment.

Science.gov (United States)

2010-01-01

... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Draft environmental impact statements... Environmental Policy Act of 1969 § 1.84 Draft environmental impact statements: Availability and comment. Except for proposals for legislation, environmental impact statements shall be prepared in two stages: Draft...

Pharmacokinetics of IDX184, a liver-targeted oral prodrug of 2'-methylguanosine-5'-monophosphate, in the monkey and formulation optimization for human exposure.

Science.gov (United States)

Pan-Zhou, Xin-Ru; Mayes, Benjamin A; Rashidzadeh, Hassan; Gasparac, Rahela; Smith, Steven; Bhadresa, Sanjeev; Gupta, Kusum; Cohen, Marita Larsson; Bu, Charlie; Good, Steven S; Moussa, Adel; Rush, Roger

2016-10-01

IDX184 is a phosphoramidate prodrug of 2'-methylguanosine-5'-monophosphate, developed to treat patients infected with hepatitis C virus. A mass balance study of radiolabeled IDX184 and pharmacokinetic studies of IDX184 in portal vein-cannulated monkeys revealed relatively low IDX184 absorption but higher exposure of IDX184 in the portal vein than in the systemic circulation, indicating >90 % of the absorbed dose was subject to hepatic extraction. Systemic exposures to the main metabolite, 2'-methylguanosine (2'-MeG), were used as a surrogate for liver levels of the pharmacologically active entity 2'-MeG triphosphate, and accordingly, systemic levels of 2'-MeG in the monkey were used to optimize formulations for further clinical development of IDX184. Capsule formulations of IDX184 delivered acceptable levels of 2'-MeG in humans; however, the encapsulation process introduced low levels of the genotoxic impurity ethylene sulfide (ES), which necessitated formulation optimization. Animal pharmacokinetic data guided the development of a tablet with trace levels of ES and pharmacokinetic performance equal to that of the clinical capsule in the monkey. Under fed conditions in humans, the new tablet formulation showed similar exposure to the capsule used in prior clinical trials.

Structure of non-(1-84) PTH fragments secreted by parathyroid glands in primary and secondary hyperparathyroidism.

Science.gov (United States)

D'Amour, Pierre; Brossard, Jean-Hugues; Rousseau, Louise; Nguyen-Yamamoto, Loan; Nassif, Edgard; Lazure, Claude; Gauthier, Dany; Lavigne, Jeffrey R; Zahradnik, Richard J

2005-09-01

Non-(1-84) parathyroid hormone (PTH) fragments are large circulating carboxyl-terminal (C) fragments with a partially preserved amino-terminal (N) structure. hPTH (7-84), a synthetic surrogate, has been demonstrated to exert biologic effects in vivo and in vitro which are opposite to those of hPTH (1-34) on the PTH/PTHrP type I receptor through a C-PTH receptor. We wanted to determine the N structure of non-(1-84) PTH fragments. Parathyroid cells isolated from glands obtained at surgery from three patients with primary hyperparathyroidism and three patients with secondary hyperparathyroidism were incubated with 35S-methionine to internally label their secretion products. Incubations were performed for 8 hours at the patient-ionized calcium concentration and in the presence of various protease inhibitors. The supernatant was fractionated by high-performance liquid chromatography (HPLC) and fractions were analyzed with PTH assays having (1 to 4) and (12 to 23) epitopes, respectively. The serum of each patient was similarly analyzed. Peaks of immunoreactivity identified were submitted to sequence analysis to recover the 35S-methionine residues in positions 8 and 18. Three regions of interest were identified with PTH assays. They corresponded to non-(1-84) PTH fragments (further divided in regions 3 and 4), a peak of N-PTH migrating in front of hPTH (1-84) (region 2) and a peak of immunoreactivity corresponding to the elution position of hPTH (1-84) (region 1). The last corresponded to a single sequence starting at position 1. Region 2 gave similar results in all cases (a major signal starting at position 1) but also sometimes minor sequences starting at position 4 or 7. Regions 3 and 4 always identified a major sequence starting at positions 7 and minor sequences starting at positions 8, 10, and 15. Surprisingly, a major signal starting at position 1 was also present in region 3. The HPLC profile obtained from a given patient's parathyroid cells was qualitatively

Evaluation of [11C]CB184 for imaging and quantification of TSPO overexpression in a rat model of herpes encephalitis

International Nuclear Information System (INIS)

Vallez Garcia, David; Vries, Erik F.J. de; Dierckx, Rudi A.J.O.; Doorduin, Janine; Toyohara, Jun; Ishiwata, Kiichi; Hatano, Kentaro

2015-01-01

Evaluation of translocator protein (TSPO) overexpression is considered an attractive research tool for monitoring neuroinflammation in several neurological and psychiatric disorders. [ 11 C]PK11195 PET imaging has been widely used for this purpose. However, it has a low sensitivity and a poor signal-to-noise ratio. For these reasons, [ 11 C]CB184 was evaluated as a potentially more sensitive PET tracer. A model of herpes simplex encephalitis (HSE) was induced in male Wistar rats. On day 6 or 7 after virus inoculation, [ 11 C]CB184 PET scans were acquired followed by ex vivo evaluation of biodistribution. In addition, [ 11 C]CB184 and [ 11 C]PK11195 PET scans with arterial blood sampling were acquired to generate input for pharmacokinetic modelling. Differences between the saline-treated control group and the virus-treated HSE group were explored using volumes of interest and voxel-based analysis. The biodistribution study showed significantly higher [ 11 C]CB184 uptake in the amygdala, olfactory bulb, medulla, pons and striatum (p < 0.05) in HSE rats than in control rats, and the voxel-based analysis showed higher bilateral uptake in the pons and medulla (p < 0.05, corrected at the cluster level). A high correlation was found between tracer uptake in the biodistribution study and on the PET scans (p < 0.001, r 2 = 0.71). Pretreatment with 5 mg/kg of unlabelled PK11195 effectively reduced (p < 0.001) [ 11 C]CB184 uptake in the whole brain. Both, [ 11 C]CB184 and [ 11 C]PK11195, showed similar amounts of metabolites in plasma, and the binding potential (BP ND ) was not significantly different between the HSE rats and the control rats. In HSE rats BP ND for [ 11 C]CB184 was significantly higher (p < 0.05) in the amygdala, hypothalamus, medulla, pons and septum than in control rats, whereas higher uptake of [ 11 C]PK11195 was only detected in the medulla. [ 11 C]CB184 showed nonspecific binding to healthy tissue comparable to that observed for [ 11 C]PK11195, but it

Expression of kenaf mitochondrial chimeric genes HM184 causes male sterility in transgenic tobacco plants.

Science.gov (United States)

Zhao, Yanhong; Liao, Xiaofang; Huang, Zhipeng; Chen, Peng; Zhou, Bujin; Liu, Dongmei; Kong, Xiangjun; Zhou, Ruiyang

2015-08-01

Chimeric genes resulting from the rearrangement of a mitochondrial genome were generally thought to be a causal factor in the occurrence of cytoplasmic male sterility (CMS). In the study, earlier we reported that identifying a 47 bp deletion at 3'- flanking of atp9 that was linked to male sterile cytoplasm in kenaf. The truncated fragment was fused with atp9, a mitochondrial transit signal (MTS) and/or GFP, comprised two chimeric genes MTS-HM184-GFP and MTS-HM184. The plant expression vector pBI121 containing chimeric genes were then introduced to tobacco plants by Agrobacterium-mediated T-DNA transformation. The result showed that certain transgenic plants were male sterility or semi-sterility, while some were not. The expression analysis further demonstrated that higher level of expression were showed in the sterility plants, while no expression or less expression in fertility plants, the levels of expression of semi-sterility were in between. And the sterile plant (containing MTS-HM184-GFP) had abnormal anther produced malformed/shriveled pollen grains stained negative that failed to germinate (0%), the corresponding fruits was shrunken, the semi-sterile plants having normal anther shape produced about 10-50% normal pollen grains, the corresponding fruits were not full, and the germination rate was 58%. Meanwhile these transgenic plants which altered on fertility were further analyzed in phenotype. As a result, the metamorphosis leaves were observed in the seedling stage, the plant height of transgenic plants was shorter than wild type. The growth duration of transgenic tobacco was delayed 30-45 days compared to the wild type. The copy numbers of target genes of transgenic tobacco were analyzed using the real-time quantitative method. The results showed that these transgenic plants targeting-expression in mitochondrial containing MTS-HM184-GFP had 1 copy and 2 copies, the other two plants containing MTS-HM184 both had 3 copies, but 0 copy in wild type. In

21 CFR 184.1420 - Lipase enzyme preparation derived from Rhizopus niveus.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Lipase enzyme preparation derived from Rhizopus... GENERALLY RECOGNIZED AS SAFE Listing of Specific Substances Affirmed as GRAS § 184.1420 Lipase enzyme preparation derived from Rhizopus niveus. (a) Lipase enzyme preparation contains lipase enzyme (CAS Reg. No...

21 CFR 184.1262 - Corn silk and corn silk extract.

Science.gov (United States)

2010-04-01

... specific limitations: Category of food Maximum level of use in food (as served) 1 Functional use Baked... chapter 10 Do. Soft candy, § 170.3(n)(38) of this chapter 20 Do. All other food categories 4 Do. 1 Parts... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Corn silk and corn silk extract. 184.1262 Section...

Quantitative analysis without standards using local peak-to-background ratios with the energy dispersive X-ray microanalyzer EDR-184

International Nuclear Information System (INIS)

Eggert, F.; Heckel, J.

1986-01-01

The method realized in program QMA-184 of the energy dispersive X-Ray-Microanalyzer EDR-184 for quantitative spectra analyzing of bulk materials by using local peak-to-background ratios is described in detail. The authors demonstrate efficiency and limitations of the used method by discussion of experimental results. (author)

21 CFR 184.1012 - α-Amylase enzyme preparation from Bacillus stearothermophilus.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true α-Amylase enzyme preparation from Bacillus... GENERALLY RECOGNIZED AS SAFE Listing of Specific Substances Affirmed as GRAS § 184.1012 α-Amylase enzyme preparation from Bacillus stearothermophilus. (a) α-Amylase enzyme preparation is obtained from the culture...

Evaluation of [{sup 11}C]CB184 for imaging and quantification of TSPO overexpression in a rat model of herpes encephalitis

Energy Technology Data Exchange (ETDEWEB)

Vallez Garcia, David; Vries, Erik F.J. de; Dierckx, Rudi A.J.O.; Doorduin, Janine [University of Groningen, Department of Nuclear Medicine and Molecular Imaging, University Medical Center Groningen, PO Box 30.001, Groningen (Netherlands); Toyohara, Jun; Ishiwata, Kiichi [Tokyo Metropolitan Institute of Gerontology, Research Team for Neuroimaging, Tokyo (Japan); Hatano, Kentaro [National Center for Geriatrics and Gerontology, Department of Clinical and Experimental Neuroimaging, Center for Development of Advanced Medicine for Dementia, Obu, Aichi (Japan)

2015-03-13

Evaluation of translocator protein (TSPO) overexpression is considered an attractive research tool for monitoring neuroinflammation in several neurological and psychiatric disorders. [{sup 11}C]PK11195 PET imaging has been widely used for this purpose. However, it has a low sensitivity and a poor signal-to-noise ratio. For these reasons, [{sup 11}C]CB184 was evaluated as a potentially more sensitive PET tracer. A model of herpes simplex encephalitis (HSE) was induced in male Wistar rats. On day 6 or 7 after virus inoculation, [{sup 11}C]CB184 PET scans were acquired followed by ex vivo evaluation of biodistribution. In addition, [{sup 11}C]CB184 and [{sup 11}C]PK11195 PET scans with arterial blood sampling were acquired to generate input for pharmacokinetic modelling. Differences between the saline-treated control group and the virus-treated HSE group were explored using volumes of interest and voxel-based analysis. The biodistribution study showed significantly higher [{sup 11}C]CB184 uptake in the amygdala, olfactory bulb, medulla, pons and striatum (p < 0.05) in HSE rats than in control rats, and the voxel-based analysis showed higher bilateral uptake in the pons and medulla (p < 0.05, corrected at the cluster level). A high correlation was found between tracer uptake in the biodistribution study and on the PET scans (p < 0.001, r {sup 2} = 0.71). Pretreatment with 5 mg/kg of unlabelled PK11195 effectively reduced (p < 0.001) [{sup 11}C]CB184 uptake in the whole brain. Both, [{sup 11}C]CB184 and [{sup 11}C]PK11195, showed similar amounts of metabolites in plasma, and the binding potential (BP{sub ND}) was not significantly different between the HSE rats and the control rats. In HSE rats BP{sub ND} for [{sup 11}C]CB184 was significantly higher (p < 0.05) in the amygdala, hypothalamus, medulla, pons and septum than in control rats, whereas higher uptake of [{sup 11}C]PK11195 was only detected in the medulla. [{sup 11}C]CB184 showed nonspecific binding to healthy

Evidence of Himalayan uplift as seen in Neogene records of Indian monsoon variability from ODP Hole 722B, NW Arabian Sea

Science.gov (United States)

Muthusamy, Prakasam; Gupta, Anil K.; Saini, Naresh K.

2013-04-01

The Indian monsoon is one of the most interesting climatic features on Earth impacting most populous countries of South and East Asia. It is marked by seasonal reversals of wind direction with southwesterly winds in summer (June-September) and northeasterly winds in winter (December-February). The monsoon not only impacts socioeconomic conditions of Asia but also brings important changes in fauna and flora, ocean upwelling and primary productivity in the Arabian Sea. The Himalaya has undergone several phases of rapid uplift and exhumation since the early Miocene which led to major intensification of the Indian monsoon. The monsoon is driven by the thermal contrast between land and sea, and is intimately linked with the latitudinal movement of the Inter-Tropical Convergence Zone (ITCZ). The effect of Indian monsoon variability and the Himalayan uplift can be seen in numerous proxy records across the region. In this study we discussed about the Indian monsoon intensification and the Himalayan uplift since the early Miocene based on multi proxy records such as planktic foraminiferal relative abundances (Globigerina bulloides, Globigerinita glutinata and mixed layer species), total organic carbon (TOC), CaCO3 and elemental data from ODP Hole 722B (2028 mbsf), northwestern Arabian Sea. The TOC, CaCO3 and elemental variations of the ODP Hole 722B suggest multi phase of monsoonal intensification and Himalayan uplifts. Our results suggest that in the early Miocene (23.03 Ma) to ~15Ma, the wind strength and productivity were low. A major change is observed at ~15 Ma, during which time numerous proxies show abrupt changes. TOC, CaCO3 and Elemental analyses results reveal that a major change in the productivity, wind strength and chemical weathering starts around 15 Ma and extends up to 10 Ma. This suggests that a major Himalayan uplift occurred during ~15-10 Ma that drove Indian monsoon intensification. A similar change is also observed during 5 to 1 Ma. These long

Astronomical duration of polarity Chron C31r (lower Maastrichtian)

DEFF Research Database (Denmark)

Husson, Dorothee; Galbrun, Bruno; Thibault, Nicolas Rudolph

2012-01-01

The duration of polarity Chron C31r is estimated with a cyclostratigraphic approach. Two sites are investigated: ODP Site 762 (Indian Ocean) and the Contessa Highway section (Gubbio, Italy). Cyclostratigraphic analysis is performed on greyscale variations (Site 762) and magnetic susceptibility va...

Effect of planting dates on seed yield and seed quality of Stylosanthes guianensis CIAT 184

Directory of Open Access Journals (Sweden)

Chureerat Satjipanon

2005-11-01

Full Text Available The objective of this experiment was to investigate the effect of planting dates on seed yield and quality of Stylosanthes guianensis CIAT 184 at Khon Kaen Animal Nutrition Research and Development Center, during May 2003 to February 2004. A randomized complete block design with four replications was used. Experimental treatments consisted of four planting dates spaced at about 30-day intervals from 23 May to 23 August 2003.The results revealed that planting date had a significant effect on seed yields and pure germinable seed yields (PGSY of S. guianensis CIAT 184. Plots planted on 23 July produced the highest seed yield and PGSY of 630 and 601 kg/ha, respectively followed by plots planted on 23 June and 23 May (514 and 501; 443 and 421 kg/ha, respectively. Plots planted on 23 August produced the lowest seed yield and PGSY of 269 and 262 kg/ha, respectively. There were no significant differences in seed purity percentage, germination percentage and 1000-seed weight among planting dates. Based on this research, it was concluded that late- July was the optimum planting date for S. guianensis CIAT 184 cultivation for seed production in Northeast Thailand.

Shape coexistence in neutron-deficient Hg isotopes studied via lifetime measurements in $^{184,186}$Hg and two-state mixing calculations

CERN Document Server

Gaffney, L P; Page, R.D.; Grahn, T.; Scheck, M.; Butler, P.A.; Bertone, P.F.; Bree, N.; Carroll, R.J.; Carpenter, M.P.; Chiara, C.J.; Dewald, A.; Filmer, F.; Fransen, C.; Huyse, M.; Janssens, R.V.F.; Joss, D.T.; Julin, R.; Kondev, F.G.; Nieminen, P.; Pakarinen, J.; Rigby, S.V.; Rother, W.; Van Duppen, P.; Watkins, H.V.; Wrzosek-Lipska, K.; Zhu, S.

2014-01-01

The neutron-deficient mercury isotopes, $^{184,186}$Hg, were studied with the Recoil Distance Doppler Shift (RDDS) method using the Gammasphere array and the K\\"oln Plunger device. The Differential Decay Curve Method (DDCM) was employed to determine the lifetimes of the yrast states in $^{184,186}$Hg. An improvement on previously measured values of yrast states up to $8^{+}$ is presented as well as first values for the $9_{3}$ state in $^{184}$Hg and $10^{+}$ state in $^{186}$Hg. $B(E2)$ values are calculated and compared to a two-state mixing model which utilizes the variable moment of inertia (VMI) model, allowing for extraction of spin-dependent mixing strengths and amplitudes.

In Vivo Efficacy of a Cocktail of Human Monoclonal Antibodies (CL184 Against Diverse North American Bat Rabies Virus Variants

Directory of Open Access Journals (Sweden)

Richard Franka

2017-09-01

Full Text Available Following rabies virus (RABV exposure, a combination of thorough wound washing, multiple-dose vaccine administration and the local infiltration of rabies immune globulin (RIG are essential components of modern post-exposure prophylaxis (PEP. Although modern cell-culture-based rabies vaccines are increasingly used in many countries, RIG is much less available. The prohibitive cost of polyclonal serum RIG products has prompted a search for alternatives and design of anti-RABV monoclonal antibodies (MAbs that can be manufactured on a large scale with a consistent potency and lower production costs. Robust in vitro neutralization activity has been demonstrated for the CL184 MAb cocktail, a 1:1 protein mixture of two human anti-RABV MAbs (CR57/CR4098, against a large panel of RABV isolates. In this study, we used a hamster model to evaluate the efficacy of experimental PEP against a lethal challenge. Various doses of CL184 and commercial rabies vaccine were assessed for the ability to protect against lethal infection with representatives of four distinct bat RABV lineages of public health relevance: silver-haired bat (Ln RABV; western canyon bat (Ph RABV; big brown bat (Ef-w1 RABV and Mexican free-tailed bat RABV (Tb RABV. 42–100% of animals survived bat RABV infection when CL184 (in combination with the vaccine was administered. A dose-response relationship was observed with decreasing doses of CL184 resulting in increasing mortality. Importantly, CL184 was highly effective in neutralizing and clearing Ph RABV in vivo, even though CR4098 does not neutralize this virus in vitro. By comparison, 19–95% survivorship was observed if human RIG (20 IU/kg and vaccine were used following challenge with different bat viruses. Based on our results, CL184 represents an efficacious alternative for RIG. Both large-scale and lower cost production could ensure better availability and affordability of this critical life-saving biologic in rabies enzootic

Remaining Sites Verification Package for the 100-F-26:9, 1607-F2 Sanitary Sewer Pipelines. Attachment to Waste Site Reclassification Form 2008-029

International Nuclear Information System (INIS)

Capron, J.M.

2008-01-01

The 100-F-26:9 underground pipeline subsite consists of the sanitary sewers servicing the 105-F, 108-F, 184-F, 185-F, and 190-F buildings, and the 1700-F administration and service buildings (1704-F, 1707-F, 1707-FA, 1713-F, 1717-F, 1719-F, and 1722-F). In accordance with this evaluation, the confirmatory and verification sampling results support a reclassification of this site to Interim Closed Out. The current site conditions achieve the remedial action objectives and the corresponding remedial action goals established in the Remaining Sites ROD. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River

Characterization of two novel gammapapillomaviruses, HPV179 and HPV184, isolated from common warts of a renal-transplant recipient.

Directory of Open Access Journals (Sweden)

Lea Hošnjak

Full Text Available Gammapapillomavirus (Gamma-PV is a diverse and rapidly expanding PV-genus, currently consisting of 76 fully characterized human papillomavirus (HPV types. In this study, DNA genomes of two novel HPV types, HPV179 and HPV184, obtained from two distinct facial verrucae vulgares specimens of a 64 year-old renal-transplant recipient, were fully cloned, sequenced and characterized. HPV179 and HPV184 genomes comprise 7,228-bp and 7,324-bp, respectively, and contain four early (E1, E2, E6 and E7 and two late genes (L1 and L2; the non-coding region is typically positioned between L1 and E6 genes. Phylogenetic analysis of the L1 nucleotide sequence placed both novel types within the Gamma-PV genus: HPV179 was classified as a novel member of species Gamma-15, additionally containing HPV135 and HPV146, while HPV184 was classified as a single member of a novel species Gamma-25. HPV179 and HPV184 type-specific quantitative real-time PCRs were further developed and used in combination with human beta-globin gene quantitative real-time PCR to determine the prevalence and viral load of the novel types in the patient's facial warts and several follow-up skin specimens, and in a representative collection, a total of 569 samples, of HPV-associated benign and malignant neoplasms, hair follicles and anal and oral mucosa specimens obtained from immunocompetent individuals. HPV179 and HPV184 viral loads in patients' facial warts were estimated to be 2,463 and 3,200 genome copies per single cell, respectively, suggesting their active role in the development of common warts in organ-transplant recipients. In addition, in this particular patient, both novel types had established a persistent infection of the skin for more than four years. Among immunocompetent individuals, HPV179 was further detected in low-copy numbers in a few skin specimens, indicating its cutaneous tissue tropism, while HPV184 was further detected in low-copy numbers in one mucosal and a few skin

Extraction of Opuntia dillenii Haw. Polysaccharides and Their Antioxidant Activities

Directory of Open Access Journals (Sweden)

Heng Li

2016-11-01

Full Text Available Use of natural polysaccharides in medicine and food has wide interest in research. In this study, we extracted and purified some polysaccharides from cactus Opuntia dillenii Haw. (ODP. Some preliminary functions of these products were characterized. Under the optimal purification conditions, the yield of ODP extracted from the 2–4 month-old Opuntia dillenii Haw. (T-ODP was 30.60% ± 0.40%, higher than that of ODP from the 5–10 month-old materials (O-ODP (18.97% ± 0.58%. The extracted ODP was purified by DEAE sepharose fast flow anion exchange and Sephacryl S-400 chromatography with four fractions obtained (ODP-Ia, ODP-Ib, ODP-IIa and ODP-IIb. Analysis with UV-vis chromatography indicated that ODP-Ia and ODP-IIa were relatively homogeneous molecules with a molecular weight of 339 kD and 943 kD, respectively. Results of infrared spectroscopy indicated that ODP, ODP-Ia, and ODP-IIa were acidic polysaccharides. Further, the antioxidant activity against DPPH (1,1-diphenyl-2-picrylhydrazyl radical, hydroxyl radicals, and superoxide radical in vitro demonstrated that the T-ODP exhibited higher antioxidant activity than the O-ODP, and the purified fraction (ODP-Ia was superior to the ODP. These results will offer a theoretical basis for further research on the structure-function relationship of ODP and the rational utilization of Opuntia dillenii Haw.

Shape mixing in sup(184,186)Hg

International Nuclear Information System (INIS)

Baba, C.V.K.

1976-01-01

Recent potential energy calculations on even Hg isotopes have shown that sup(184,186)Hg are possibly deformed with two energy minima one each for oblate (β 2 =-0.14) and prolate (β 2 =0.28) shapes. The quasi-rotational levels in these nuclei have been studied by heavy ion reactions at Berley and Chalk River. The salient features of these studies are: a deviation of the energy levels from a rotational sequence for I + →2 + and 2 + →0 + , E2 transition rates from the rotational value with β 2 =0.28. These features of the spectra are explained on the basis of mixing of bands based on the oblate and prolate shapes. The results of a simple band mixing calculation are presented and they reproduce the observed level spacings and B(E2) values. (author)

Ozone-depleting Substances (ODS)

Data.gov (United States)

U.S. Environmental Protection Agency — This site includes all of the ozone-depleting substances (ODS) recognized by the Montreal Protocol. The data include ozone depletion potentials (ODP), global warming...

Complete Genome Sequence of Dietzia sp. Strain WMMA184, a Marine Coral-Associated Bacterium

OpenAIRE

Braun, Doug R.; Chevrette, Marc G.; Acharya, Deepa; Currie, Cameron R.; Rajski, Scott R.; Ritchie, Kim B.; Bugni, Tim S.

2018-01-01

ABSTRACT Dietzia sp. strain WMMA184 was isolated from the marine coral Montastraea faveolata as part of ongoing drug discovery efforts. Analysis of the 4.16-Mb genome provides information regarding interspecies interactions as it pertains to the regulation of secondary metabolism and natural product biosynthesis potential.

LncRNA UCA1 promotes proliferation and cisplatin resistance of oral squamous cell carcinoma by sunppressing miR-184 expression.

Science.gov (United States)

Fang, Zheng; Zhao, Junfang; Xie, Weihong; Sun, Qiang; Wang, Haibin; Qiao, Bin

2017-12-01

Chemotherapy resistance has become the main obstacle for the effective treatment of human cancers. Long non-coding RNA urothelial cancer associated 1 (UCA1) is generally regarded as an oncogene in some cancers. However, the function and molecular mechanism of UCA1 implicated in cisplatin (CDDP) chemoresistance of oral squamous cell carcinoma (OSCC) is still not fully established. UCA1 expression in tumor tissues and cells was tested by qRT-PCR. MTT, flow cytometry and caspase-3 activity analysis were explored to evaluate the CDDP sensitivity in OSCC cells. Western blot analysis was used to measure BCL2, Bax and SF1 protein expression. Luciferase reporter assay was conducted to investigate the molecular relationship between UCA1, miR-184, and SF1. Nude mice model was used to confirm the functional role of UCA1 in CDDP resistance in vivo. UCA1 expression was upregulated in OSCC tissues, cell lines, and CDDP resistant OSCC cells. Function analysis revealed that UCA1 facilitated proliferation, enhanced CDDP chemoresistance, and suppressed apoptosis in OSCC cells. Mechanisms investigation indicated that UCA1 could interact with miR-184 to repress its expression. Rescue experiments suggested that downregulation of miR-184 partly reversed the tumor suppression effect and CDDP chemosensitivity of UCA1 knockdown in CDDP-resistant OSCC cells. Moreover, UCA1 could perform as a miR-184 sponge to modulate SF1 expression. The OSCC nude mice model experiments demonstrated that depletion of UCA1 further boosted CDDP-mediated repression effect on tumor growth. UCA1 accelerated proliferation, increased CDDP chemoresistance and restrained apoptosis partly through modulating SF1 via sponging miR-184 in OSCC cells, suggesting that targeting UCA1 may be a potential therapeutic strategy for OSCC patients. © 2017 The Authors. Cancer Medicine published by John Wiley & Sons Ltd.

Iron and Sulfur Species and Sulfur Isotopic Compositions of Authigenic Pyrite in Gas Hydrate-Bearing Sediments from Hydrate Ridge, Cascadia Margin (ODP Leg 204): A Proposal of Conceptual Models to Indicate the Non-Steady State Depositional and Diagenetic Processes

Science.gov (United States)

Liu, C.; Jiang, S. Y.; Su, X.

2017-12-01

Two accretionary sediment sequences from Sites 1245 and 1252 recovered during Ocean Drilling Program (ODP) Leg 204 at Hydrate Ridge, Cascadia Margin were investigated to explore the non-steady state depositional and diagenetic history. Five iron species and three sulfur species were chemically extracted, and their concentrations and the sulfur isotopic compositions of pyrite were determined. After the mineral recognitions of these species and detailed comparative analyses, the aerobic history of bottom seawater has been determined. The formation of pyrite is thought to be controlled by the limited production of hydrogen sulfide relative to the supply of reactive iron. Also, the intrusion of oxygen by bioturbation would oxidize the reduced sulfur species and further suppress pyritization. To explain the geochemical relationship between pyrite and siderite and the sulfur isotope characteristics of pyrite, we propose seven conceptual models based on the variations in depositional rate and methane flux, and the models succeed in explaining the geochemical results and are validated by the observed non-steady state events. These models may contribute to the reconstruction of the non-steady state processes in other research areas in the future.

Oceanographic and climatic evolution of the southeastern subtropical Atlantic over the last 3.5 Ma

Science.gov (United States)

Petrick, Benjamin; McClymont, Erin L.; Littler, Kate; Rosell-Melé, Antoni; Clarkson, Matthew O.; Maslin, Mark; Röhl, Ursula; Shevenell, Amelia E.; Pancost, Richard D.

2018-06-01

The southeast Atlantic Ocean is dominated by two major oceanic systems: the Benguela Upwelling System, one of the world's most productive coastal upwelling cells and the Agulhas Leakage, which is important for transferring warm salty water from the Indian Ocean to the Atlantic Ocean. Here, we present a multi-proxy record of marine sediments from ODP Site 1087. We reconstruct sea surface temperatures (U37K‧ and TEX86 indices), marine primary productivity (total chlorin and alkenone mass accumulation rates), and terrestrial inputs derived from southern Africa (Ti/Al and Ca/Ti via XRF scanning) to understand the evolution of the Southeast Atlantic Ocean since the late Pliocene. In the late Pliocene and early Pleistocene, ODP Site 1087 was situated within the Benguela Upwelling System, which was displaced southwards relative to present. We recognize a series of events in the proxy records at 3.3, 3.0, 2.2, 1.5, 0.9 and 0.6 Ma, which are interpreted to reflect a combination of changes in the location of major global wind and oceanic systems and local variations in the strength and/or position of the winds, which influence nutrient availability. Although there is a temporary SST cooling observed around the initiation of Northern Hemisphere glaciation (iNHG), proxy records from ODP Site 1087 show no clear climatic transition around 2.7 Ma but instead most of the changes occur before this time. This observation is significant because it has been previously suggested that there should be a change in the location and/or strength of upwelling associated with this climate transition. Rather, the main shifts at ODP Site 1087 occur at ca. 0.9 Ma and 0.6 Ma, associated with the early mid-Pleistocene transition (EMPT), with a clear loss of the previous upwelling-dominated regime. This observation raises the possibility that reorganisation of southeast Atlantic Ocean circulation towards modern conditions was tightly linked to the EMPT, but not to earlier climate transitions.

The lower Maastrichtian Hivdskud succession, Møns Klint, Denmark

DEFF Research Database (Denmark)

Jelby, M.E.; Thibault, Nicolas Rudolph; Surlyk, Finn

2014-01-01

with the cored boreholes Stevns-1 (Denmark) and ODP Site 762C (Indian Ocean). Hvidskud encompasses the 405 kyr eccentricity cycles Ma40513 – Ma40511 within magnetochron C31r. A sedimentation rate of 5.0 cm kyr-1 can be inferred from correlation to geochronological tie-points in ODP 762C, suggesting an age of ~70...... Maastrichtian in north-western Europe. Information on palaeo-seawater temperatures can be drawn from oxygen isotope records obtained from bulk rock samples and 24 micromorphic brachiopod specimens (Terebratulina faujasii). The brachiopod data show a clear diagenetic trend but point to an upper range...

Treatment of postmenopausal women with osteoporosis with PTH(1-84) for 36 months: treatment extension study

NARCIS (Netherlands)

Zanchetta, J.R.; Bogado, C.E.; Cisari, C.; Aslanidis, S.; Greisen, H.; Fox, J.; Lems, W.F.

2010-01-01

Objective: To determine the safety and efficacy of full-length parathyroid hormone, PTH(184), treatment for up to 36 months by evaluating bone mineral density (BMD) changes, bone histomorphometric indices, and clinical fracture incidence in postmenopausal women with osteoporosis. Background: The TOP

Tectonic erosion and consequent collapse of the Pacific margin of Costa Rica: Combined implications from ODP leg 170, seismic offshore data, and regional geology of the Nicoya Peninsula

Science.gov (United States)

Vannucchi, P.; Scholl, D. W.; Meschede, M.; McDougall-Reid, K.

2001-01-01

The convergent margin off the Pacific coast of the Nicoya Peninsula of Costa Rica exhibits evidence for subduction erosion caused by the underthrusting Cocos plate. Critical evidence for efficacy of this process was recovered at the Ocean Drilling Program (ODP) drilling Site 1042 (Leg 170), positioned ???7 km landward of the Middle America trench axis off the Nicoya Peninsula. The primary drilling objective at this site was to identify the age and origin of a regionally extensive and prominent seismic discontinuity, the so-called base-of-slope sediment (BOSS) horizon or surface. The BOSS horizon, which can be traced landward from near the trench to the Nicoya coastal area and parallel to it for hundreds of kilometers, separates a low-velocity (??? 2.0-2.5 km s-1) sequence of slope sediment, from an underlying sequence of much higher-velocity (> 4-4.5 km s-1) rock. Site 1042 reached the acoustically defined BOSS horizon at a below sea level depth of ??? 3900 m and yielded a carbonate-cemented calcarenitic breccia of early-middle Miocene age. Sedimentological, geochemical, paleontological, and cement paragenesis data document that the breccia accumulated in a shallow water depositional environment. On the basis of coastal exposures, the BOSS horizon, as a margin-wide geologic interface, can be temporally and lithostratigraphically correlated to a regional angular unconformity. This unconformity, known as the Mal Pais unconformity, separates Neogene and younger shelf-to-littoral beds from the underlying mafic units of the Mesozoic Nicoya Complex and Cretaceous and early Tertiary sedimentary sequences. At Site 1042 it is inferred that tectonism caused the vertical subsidence of the early Neogene breccia from a shallow to a deep water setting. The Mal Pais unconformity of the BOSS horizon thus connects the rock fabric of the outermost part of margin to that of coastal Nicoya and implies that in the early Neogene the Nicoya shelf extended seaward to near the present

Measurement of the Ec.m.=184 keV Resonance Strength in the 26gAl(p,γ)27Si Reaction

International Nuclear Information System (INIS)

Ruiz, C.; Buchmann, L.; Caggiano, J. A.; Davids, B.; Davis, C.; Hutcheon, D.A.; Olin, A.; Ottewell, D.F.; Ruprecht, G.; Trinczek, M.; Vockenhuber, C.; Parikh, A.; Clark, J.A.; Deibel, C.; Lewis, R.; Parker, P.; Wrede, C.; Jose, J.; Chen, A.A.; Ouellet, C.V.

2006-01-01

The strength of the E c.m. =184 keV resonance in the 26g Al(p,γ) 27 Si reaction has been measured in inverse kinematics using the DRAGON recoil separator at TRIUMF's ISAC facility. We measure a value of ωγ=35±7 μeV and a resonance energy of E c.m. =184±1 keV, consistent with p-wave proton capture into the 7652(3) keV state in 27 Si, and discuss the implications of these values for 26g Al nucleosynthesis in typical oxygen-neon white-dwarf novae

Down-regulation of endothelin binding sites in rat vascular smooth muscle cells

International Nuclear Information System (INIS)

Roubert, P.; Gillard, V.; Plas, P.; Chabrier, P.E.; Braquet, P.

1990-01-01

In cultured rat aortic smooth muscle cells, [ 125 I]endothelin (ET-1) bound to an apparent single class of high affinity recognition sites with a dissociation constant of 1.84 +/- 0.29 nmol/L and a maximum binding of 62 +/- 10.5 fmol/10(6) cells. The binding was not affected by calcium antagonists or vasoactive substances, including angiotensin II, arginine vasopressin, atrial natriuretic factor and bradykinin. Exposure of the cells to ET-1 (0.01 nmol/L to 10 nmol/L) resulted in an apparent dose-dependent reduction of the number of endothelin binding sites with no significant modification of its binding affinity. The time course of the down-regulation of ET-1 binding sites showed that this effect was present after 30 min incubation and persisted after 18 h. This indicates that down-regulation of ET-1 binding sites can modulate the activity of ET-1 and suggests a rapid internalization of ET-1 in vascular cells

Effect of dates of closing cut on seed yield and seed quality of Stylosanthes guianensis CIAT 184

Directory of Open Access Journals (Sweden)

Ramphrai Namsilee

2005-09-01

Full Text Available The aim of this field research was to investigate the effect of dates of closing cut on seed yield and seed quality of Stylosanthes guianensis CIAT 184 at Khon Kaen Animal Nutrition Research and Development Center, during May 2003 to February 2004. A randomized complete block design with four replications was used. Experimental treatments consisted of five dates of closing cut spaced at about 14-day intervals (27 August, 10 September, 24 September, 8 October 2003 and uncut.The results showed that date of closing cut had a significant effect on seed yields and pure germinable seed yields (PGSY of S. guianensis CIAT 184. Plots closed on 10 September produced the highest seed yield and PGSY (P<0.05 of 564 and 553 kg/ha, followed by plots closed on 24 September and 27 August (422 and 406; 405 and 391 kg/ha. Uncut plots produced low yield and plots closed on 8 October produced the lowest seed yield and PGSY (401 and 388; 365 and 356 kg/ha. There were no significant differences in seed purity percentage, germination percentage and 1000-seed weight among treatments. Among the dates of closing cut studied, forage DM yield and CP yield were subsequently increased as date of closing cut was delayed. Based on this research, it was concluded that early-September was the optimum date of closing cut for S. guianensis CIAT 184 cultivation for seed production in Northeast Thailand.

Overview of MELCOR 1.8.4: Modeling advances and assessment

International Nuclear Information System (INIS)

Gauntt, R.O.; Cole, R.K.; Rodriguez, S.B.; Young, M.F.; Gasser, R.D.

1998-01-01

The newly released MELCOR 1.8.4 reactor accident analysis code contains many new modeling features as well as improvements to existing models. New model additions to the MELCOR code include a model for predicting enhanced depletion rates for hygroscopic aerosols and a model for predicting the chemisorption of Cesium to the surfaces of piping. Improvements to existing models include: upgrading the core module (COR) to handle flow redistribution resulting from the formation of core blockages, improving the thermal hydraulics (CVH) coupling with COR to handle flow reversal situations, and upgrading the fission product scrubbing model to incorporate the SPARC90 code. Significant upgrading of the COR package core degradation modeling was also included in the new code release version. New and improved models are described in the following paper. In addition, a number of assessment analyses were recently performed, focusing on demonstrating the new and improved capabilities in the code. Results of assessment calculations demonstrating code performance for aerosol (pool) scrubbing, hygroscopic aerosol behavior, and core degradation and hydrogen production are presented. Finally, ongoing code developments activities beyond MELCOR 1.8.4 are described. These include models for treating iodine behavior in containment sumps, pools, and atmosphere, and plans for implementing reflood models and the attendant effects on accident progression. Further improvements and additions to the core degradation modeling in MELCOR are described, including the implementation of enhanced clad failure models to treat clad ballooning and eutectic interaction with grid spacers, and expansion of the COR package to allow for improved representation of UO 2 -Zr eutectic behavior, improved melt relocation treatment, greater detail in describing aspects of BWR core degradation (fuel channel, bypass, and lower plenum), and more flexibility in modeling other structures in the core such as core plate

Evaporation residue corss sections for {sup 32}S + {sup 184}W

Energy Technology Data Exchange (ETDEWEB)

Back, B.B.; Blumenthal, D.J.; Davids, C.N. [and others

1995-08-01

We recently measured evaporation residue cross sections for the {sup 32}S + {sup 184}W system over a range of beam energies using the Argonne Fragment Mass Analyzer (FMA). Absolute cross sections were obtained on the basis of the recent determination of the transmission probability through the FMA of heavy, slow-moving reaction products. The measurements were carried out using {sup 32}S-beams from the ATLAS superconducting linac at Argonne. Beam energies of 165, 174, 185, 195, 205, 215, 225, 236, 246, and 257 MeV were used. The sliding-seal target chamber is used to allow for measurements at finite angles.

Dynamics of 103K/N and 184M/V HIV-1 drug resistant populations: relative comparison in plasma virus RNA versus CD45RO+T cell proviral DNA

DEFF Research Database (Denmark)

Jakobsen, Martin Roelsgaard; Tolstrup, M; Bertelsen, L

2007-01-01

on real-time PCR and amplification refractory mutation system (ARMS). RESULTS: The 103N and 184V mutations were not detected in patients with stable low viremia. Patients previously exposed to mono or dual therapy often carried minor viral populations of either one or both mutations in plasma. The viral......BACKGROUND: Viral populations defined by 103K/N and 184M/V as linked or single mutations in the HIV-1 reverse transcriptase gene were investigated in plasma samples and compared with previous findings in the CD45RO(+)T cell compartment. OBJECTIVE: To develop an ARMS assay for plasma virions...... an unequal distribution of linked-mutation populations in plasma and CD45RO(+)T cells. Furthermore, the linked 103N-184V mutation may be more fit than the single 184V mutation and this linked population emerges rapidly under inadequate drug pressure. Udgivelsesdato: 2007-Jul...

What Factors are Associated With a Surgical Site Infection After Operative Treatment of an Elbow Fracture?

Science.gov (United States)

Claessen, Femke M A P; Braun, Yvonne; van Leeuwen, Wouter F; Dyer, George S; van den Bekerom, Michel P J; Ring, David

2016-02-01

Surgical site infections are one of the more common major complications of elbow fracture surgery and can contribute to other adverse outcomes, prolonged hospital stays, and increased healthcare costs. We asked: (1) What are the factors associated with a surgical site infection after elbow fracture surgery? (2) When taking the subset of closed elbow fractures only, what are the factors associated with a surgical site infection? (3) What are the common organisms isolated from an elbow infection after open treatment? One thousand three hundred twenty adult patients underwent surgery for an elbow fracture between January 2002 and July 2014 and were included in our study. Forty-eight of 1320 patients (4%) had a surgical site infection develop. Thirty-four of 1113 patients with a closed fracture (3%) had a surgical site infection develop. For all elbow fractures, use of plate and screw fixation (adjusted odds ratio [OR]= 2.2; 95% CI, 1.0-4.5; p = 0.041) and use of external fixation before surgery (adjusted OR = 4.7; 95% CI, 1.1-21; p = 0.035) were associated with higher infection rates. When subset analysis was performed for closed fractures, only smoking (adjusted OR = 2.2; 95% CI, 1.1-4.5; p = 0.023) was associated with higher infection rates. Staphylococcus aureus was the most common bacteria cultured (59%). The only modifiable risk factor for a surgical site infection after open reduction and internal fixation was cigarette smoking. Plate fixation and temporary external fixation are likely surrogates for more complex injuries, therefore no recommendations should be inferred from this association. Surgeons should counsel patients who smoke. Level IV, prognostic study.

Sea surface temperatures from the southern Benguela region from the Pliocene and Pleistocene: tracking Agulhas Current input into the SE Atlantic

Science.gov (United States)

Petrick, B. F.; McClymont, E.; Felder, S.; Lloyd, J. M.; Leng, M. J.

2011-12-01

The Pliocene and-Pleistocene epochs provide a way to understand the effect of past climate changes on key ocean currents. Here, we show results from ODP Site1087 (31.28'S, 15.19'E, 1374m water depth) to investigate changes in ocean circulation over the period of the mid-Pliocene warm period 3.0-3.5 Ma and compare these to the time of the 100 kyr Pleistocene glacial cycles. ODP 1087 is located in the South-eastern Atlantic Ocean, outside of the Benguela upwelling region; reconstructing the temperature history of the site will therefore provide an important data set from a part of the ocean that has few orbital-scale and continuous Pliocene temperature reconstructions. ODP 1087 can be used to investigate the history of the heat and salt transfer to the Atlantic Ocean from the Indian Ocean via the Agulhas Retroflection, which plays an important part in the global thermohaline circulation (Lutjeharms, 2007). Climate models and reconstructions for the most recent glacial-interglacial cycles have shown that changes to the strength of the heat transfer may cause major climatic changes and may play a role in transitions from glacial to interglacial events (Knorr & Lohmann, 2003). It is unknown how this transfer reacted to generally warmer global temperatures during the mid-Pliocene. Because the mid-Pliocene is seen as a model for future climate change it might provide a model for ocean circulations in a warmer world. Our approach is to apply several organic geochemistry proxies and foraminiferal analyses to reconstruct the history of ODP 1087. The UK37' index records differences in the unsaturated bonds in the C37 alkenones to reconstruct sea surface temperatures (Brassell et al., 1986). We present SSTs generated for the mid-Pliocene Warm period with a resolution of 4000 years. We compare this data to the time of the 100 kyr glacial cycles during the late Pleistocene. Even though ODP 1087 is located outside the Benguela upwelling system, it has lower Pliocene temperatures

Study on the ocean drilling program

Energy Technology Data Exchange (ETDEWEB)

Oh, Jae Ho; Han, Hyun Chul; Chin, Jae Wha; Lee, Sung Rok; Park, Kwan Soon; Lee, Young Joo; Park, Young Soo [Korea Institute of Geology Mining and Materials, Taejon (Korea, Republic of)

1996-12-01

Geoscience research trend of the world nations is focusing on the study of climate changes and preventing people from the natural hazards such as earthquakes and volcanic activities. For this study, it is necessary for scientists to interpret ancient climate changes preserved in ocean sediments, and to observe plate motions. Thus, geological and geophysical studies should be proceeded for the core samples recovered from the deep sea sediments and basement. It is essential to join the ODP(Ocean Drilling Program) that drills ocean basins and crusts using the drilling vessel with the ability of deploying almost 9 km of drilling string. The first year (1995) was focused on the analyzing the appropriateness Korea to join the ODP. The second year (1996) has been stressed on being an ODP member country based on results of the first year study, and planning the future activities as a member. The scope of study is joining the ODP as a Canada-Australia Consortium member and to set up the Korean ODP organization and future activities. The results and suggestions are as follows. 1) Necessities of Korea joining the ODP: If Korea becomes a member of the ODP, the benefits could be obtained based on the activities of other ODP members through academic, social and economic sectors. 2) Korean membership of ODP: Korea becomes a member of the Australia-Canada Consortium for ODP. AGSO (Austrian Geological Survey Organization), GSC (Geological Survey of Canada), and KIGAM (Korea Institute of Geology, Mining and Materials) on behalf of their own countries will each pay a share of the full member financial contribution to the ODP. AGSO and GSC will pay one third of the full member financial contribution, and KIGAM will pay one twelfth. 3) Korean ODP structure and future activities: To enhance the efficiency of initial activities after joining the ODP, it has been decided to have a relatively simple organization. The primary governing arm of the Korean ODP organizations is the Korean ODP

Cultural stereotyping of the lady in 4Q184 and 4Q185

Directory of Open Access Journals (Sweden)

Ananda Geyser-Fouché

2016-10-01

Full Text Available Wisdom and wickedness as a ‘Woman’ have always attracted much discussion, especially in the ways images of the female are employed in wisdom literature. This article focuses on two Qumran texts that fall into the category of wisdom literature, namely 4Q184 and 4Q185, and the metaphorical appropriation of the woman as a figure of wisdom or a figure of wickedness. By combining a number of traditions in certain forms, sages tried to establish an education for their learners on how to obtain wisdom with the ultimate purpose of creating harmony. The ultimate purpose of the wisdom teachings of the sages was to confirm the harmony in the universe, and these teachings were also conveyed to their learners. In their instructions, they often employed binary opposites such as ‘wise’ and ‘fool’ according to which someone was characterised, or rather stereotyped. The result of such binary stereotyping was that the ‘whore’ and the ‘holy one’ represented opposite poles, and became fixed images in Judaism. According to feminist exegetes, these images typify the concept of cultural stereotyping. This article aims to illustrate that two Qumran texts, 4Q184 and 4Q185, regarded as wisdom texts, employ the female stereotypes that were known in the wisdom literature of Judaism.

Cultural stereotyping of the lady in 4Q184 and 4Q185

Directory of Open Access Journals (Sweden)

Ananda Geyser-Fouché

2016-05-01

Full Text Available Wisdom and wickedness as a ‘Woman’ have always attracted much discussion, especially in the ways images of the female are employed in wisdom literature. This article focuses on two Qumran texts that fall into the category of wisdom literature, namely 4Q184 and 4Q185, and the metaphorical appropriation of the woman as a figure of wisdom or a figure of wickedness. By combining a number of traditions in certain forms, sages tried to establish an education for their learners on how to obtain wisdom with the ultimate purpose of creating harmony. The ultimate purpose of the wisdom teachings of the sages was to confirm the harmony in the universe, and these teachings were also conveyed to their learners. In their instructions, they often employed binary opposites such as ‘wise’ and ‘fool’ according to which someone was characterised, or rather stereotyped. The result of such binary stereotyping was that the ‘whore’ and the ‘holy one’ represented opposite poles, and became fixed images in Judaism. According to feminist exegetes, these images typify the concept of cultural stereotyping. This article aims to illustrate that two Qumran texts, 4Q184 and 4Q185, regarded as wisdom texts, employ the female stereotypes that were known in the wisdom literature of Judaism.

A low plasma 1,25(OH)2 vitamin D/PTH (1-84) ratio predicts worsening of renal function in patients with chronic heart failure.

Science.gov (United States)

Masson, Serge; Barlera, Simona; Colotta, Francesco; Magnoli, Michela; Bonelli, Fabrizio; Moro, Milena; Marchioli, Roberto; Tavazzi, Luigi; Tognoni, Gianni; Latini, Roberto

2016-12-01

Dysregulation of the vitamin D system promotes renal dysfunction and has direct detrimental effects on the heart. Progressive deterioration of renal function is common in patients with chronic heart failure (HF) and is invariably associated with unfavorable outcomes which can be improved by early identification and timely interventions. We examined the relation between two plasma markers of vitamin D metabolism and worsening of renal function (WRF) in a large cohort of patients with chronic HF. Plasma levels of 1,25-dihydroxyvitamin D (1,25(OH) 2 D) and parathyroid hormone PTH (1-84) were measured in 1237 patients with clinical evidence of chronic and stable HF enrolled in the multicentre GISSI-HF trial and followed for 3.9years. We examined the relation of 1,25(OH) 2 D, PTH(1-84), and their ratio with WRF, defined as first increase in serum creatinine concentration ≥0.3mg/dL and ≥25% at two consecutive measurements at any time during the study. Lower 1,25(OH) 2 D/PTH(1-84) ratio was associated with a higher baseline serum concentration of creatinine, winter season, female sex and older age; 335 patients (29.6%) experienced an episode of WRF. After adjustment, a lower 1,25(OH) 2 D/PTH(1-84) ratio remained significantly associated with a higher risk of WRF (HR=0.75 [0.62-0.90], p=0.002) and correctly reclassified events. This ratio also independently predicted mortality and admission to hospital for cardiovascular reasons. The plasma 1,25(OH) 2 D/PTH(1-84) ratio is a promising indicator of future risk of deterioration of renal function in patients with chronic HF and mild renal impairment, that may serve to optimize therapies and improve outcomes. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

Deriving a blood-mimicking fluid for particle image velocimetry in Sylgard-184 vascular models.

Science.gov (United States)

Yousif, Majid Y; Holdsworth, David W; Poepping, Tamie L

2009-01-01

A new blood-mimicking fluid (BMF) has been developed for particle image velocimetry (PIV), which enables flow studies in vascular models (phantoms). A major difficulty in PIV that affects measurement accuracy is the refraction and distortion of light passing through the interface between the model and the fluid, due to the difference in refractive index (n) between the two materials. The problem can be eliminated by using a fluid with a refractive index matching that of the model. Such fluids are not commonly available, especially for vascular research where the fluid should also have a viscosity similar to human blood. In this work, a blood-mimicking fluid, composed of water (47.38% by weight), glycerol (36.94% by weight) and sodium iodide salt (15.68% by weight), was developed for compatibility with our silicone (Sylgard 184; n = 1.414) phantoms. The fluid exhibits a dynamic viscosity of 4.31+/-0.03 cP which lies within the range of human blood viscosity (4.4+/-0.6 cP). Both refractive index and viscosity were attained at 22.2+/-0.2 degrees C, which is a feasible room temperature, thus eliminating the need for a temperature-control system. The fluid will be used to study hemodynamics in vascular flow models fabricated from Sylgard 184.

Acute regulation of circulating parathyroid hormone (PTH) molecular forms by calcium: utility of PTH fragments/PTH(1-84) ratios derived from three generations of PTH assays.

Science.gov (United States)

D'Amour, Pierre; Räkel, Agnès; Brossard, Jean-Hugues; Rousseau, Louise; Albert, Caroline; Cantor, Tom

2006-01-01

The quantitative evaluation of circulating PTH peaks revealed by PTH assays after HPLC separation constitutes the best way to study the behavior of PTH molecular forms, but it is also impractical. The objective of the study was to investigate the regulation of circulating PTH molecular forms by calcium through the use of PTH fragments/PTH (1-84) ratios derived from PTH assays with different specificities before and after HPLC separation of circulating PTH. CaCl2 and Na citrate were infused in eight volunteers. PTH was measured in serum and HPLC fractions at different calcium concentrations in PTH assays reacting with regions 1-2 (CA), 12-18 (T), and 65-69 (C) of the PTH structure. From hypo- to hypercalcemia, the C/CA ratio had the highest range (1.92 to 9.75; P < 0.001), and the C/T ratio had a higher range (1.69 to 6.11; P < 0.01) than the T/CA ratio (1.15 to 1.86). Human (h) PTH (1-84) represented 32.7 and 4.3% of circulating PTH in hypo- and hypercalcemic HPLC profiles, respectively. These numbers were 5 and 0.9% for amino-terminal (N)-PTH, an amino-terminal form of PTH distinct from hPTH (1-84), 7.3 and 6.8% for non-(1-84) PTH or large C-PTH fragments with a partially preserved N structure, and 54.9 and 88.1% for C-PTH fragments missing a N structure. The HPLC C-PTH fragments to hPTH (1-84) ratio had the most extensive range (1.67 to 20.58). Despite their quantitative differences, all ratios identified identical behavior of PTH fragments relative to PTH (1-84). PTH assay ratios are an adequate tool to investigate the modulation of PTH molecular forms, even if all PTH assays show some undesirable cross-reactivity with certain circulating forms of PTH.

Gyromagnetic ratios of the 4+ and 6+ rotational states of 184W

International Nuclear Information System (INIS)

Alzner, A.; Bodenstedt, E.; Herrmann, C.; Herzog, P.; Muenning, H.; Reif, H.; Vianden, R.; Wrede, U.

1982-01-01

The nuclear Larmor precession has been observed for the 2 + , 4 + and 6 + rotational states of 184 W in the hyperfine field of WFe by application of the TDPAC and the IPAC techniques. A carrier free radioactive source of 184 sup(m)Re alloyed with high purity iron was used for all three measurements. From the Larmor precession observed in the 2 + state by TDPAC ωsub(L) = 944(15) MHz and the known g-factor the hyperfine field Bsup(hf)sub(300K) = f(WFe) = 69.6(27)T was derived. The deviation from the result of a spin echo experiment with 183 WFe extrapolated to room temperature may be caused by the Bohr-Weisskopf effect (hyperfine anomaly). IPAC measurements with the same sample polarized in an external magnetic field of 1.6 T gave for the 4 + and 6 + rotational states: ωsub(L)tau(4 + ) = 0.0609(22) and ωsub(L)tau(6 + ) = 0.00707(98). By use of experimental B(E2)-values the gsub(R)-factors were derived as gsub(R)(4 + ) = +0.276(26) and gsub(R)(6 + ) = +0.270(43). The directional correlation of the 537-384 keV γ-γ cascade has been analysed in terms of an E1/M2/E3 mixture for the K-forbidden 573 keV transition. We obtained the mixing ratios delta(M2/E1) = +0.086(16), delta(E3/E1) = -0.028(5) with the sign convention of Krane and Steffen. (orig.)

Effects of add on PTH(1-84) substitution therapy in hypoparathyroidism: results from a double-blind randomised controlled study

DEFF Research Database (Denmark)

Sikjær, Tanja Tvistholm; Rejnmark, Lars; Mosekilde, Leif

-phosphate levels within the physiological range. Compared with placebo, participants randomised to PTH (1-84) reduced their daily dose of calcium supplements by 68 % (pvitamin D dose by 53% (pneed of calcium supplements...... and 7 were not in need of active vitamin D. With the actual add on therapy there were no change in renal calcium excretion in response to treatment. Compared with placebo, bone mineral density (BMD) decreased significantly at the hip (-1.59 ± 0.57%), lumbar spine (-1.76 ± 1.03%) and whole body (-1...... bone packets. In conclusion, PTH substitution therapy is capable of maintaining normal p-calcium levels with a significantly reduced need for calcium supplements and active vitamin D. In contrast to the effect of PTH(1-84) treatment in patients with osteoporosis, causing an increase in BMD...

Measurements of shape co-existence in $^{182,184}$Hg using Coulomb excitation

CERN Multimedia

Voulot, D; Paul, E S; Siem, S; Czosnyka, T; Napiorkowski, P J; Iwanicki, J S

2007-01-01

We propose to exploit the unique capability of ISOLDE to provide post-accelerated $^{182,184}$Hg ions from the REX facility to enable the lowest states of these nuclei to be Coulomb excited. By measuring the $\\gamma$-ray yields using the MINIBALL array we can measure the transition and diagonal E2 matrix elements for these states. This will give quantitative information about the nature of the shape coexistence in these nuclei and allow the sign of the quadrupole deformation be determined for the first time. We require 24 shifts to fulfill the aims of the experiment.

Ocean circulation in the southern Benguela region from the Pliocene to the Pleistocene: tracking Agulhas leakage into the SE Atlantic

Science.gov (United States)

Petrick, Benjamin; McClymont, Erin; Felder, Sojna; Leng, Melanie

2013-04-01

The transition from the warmth of the middle Pliocene to the large amplitude, 100 kyr glacial-interglacial cycles of the late Pleistocene provides a way to understand the forcings and impacts of regional and global climate change. Here, we investigate changes in ocean circulation over the period from 3.5 Ma to present using a marine sediment core, ODP Site 1087 (31o28'S, 15o19'E, 1374m water depth). ODP 1087 is located in the South-east Atlantic Ocean, outside the Benguela upwelling region. Its location allows investigation of the history of the heat and salt transfer to the Atlantic Ocean from the Indian Ocean ("Agulhas leakage"), which plays an important part in the global thermohaline circulation. It is not known how this transfer reacted to generally warmer global temperatures during the mid-Pliocene, nor to the transition to a globally cooler climate in the early Pleistocene. Our approach is to apply several organic geochemistry proxies and foraminiferal analyses to reconstruct the history of ODP 1087. These include the U37K' index to reconstruct sea surface temperatures, pigment analysis for understanding productivity changes, and foraminifera assemblage analysis to detect the presence of different water masses at the site. We have identified changes in SSTs and biological productivity that we argue to reflect shifts in the position of the Benguela upwelling cells, and a changing influence of Agulhas leakage. Our new data reveal a different organization in the Southeast Atlantic. It shows that during the Pliocene ODP 1087 was dominated by Benguela upwelling which had shifted south. We find no evidence for Agulhas leakage during the mid Pliocene, which could mean that Agulhas Leakage was severely reduced during the mid Pliocene. The implications of these results for understanding Plio-Pleistocene climate changes will be explored here.

In-Beam Studies of High Spin States in Mercury -182 and MERCURY-184

Science.gov (United States)

Bindra, Kanwarjit Singh

The high spin states in ^{182 }Hg were studied by using the reaction ^{154}Gd(^{32}S, 4n) at the Holifield Heavy Ion Research Facility. In addition, the in-beam gamma-rays in ^{183}Hg were identified for the first time using the reaction ^{155}Gd(^{32}S, 4n) at the Argonne BGO-FMA facility. Five new bands were observed for the first time in ^{182}Hg by studying the gamma-gamma coincidence relationships. The spins and parities of the nuclear levels were assigned on the basis of the measured ratios of directional correlations for oriented nuclei (DCO ratios). Shape co-existence similar to that observed in ^{184{-}186}Hg was established. The well deformed prolate band was extended to a state with tentative spin (20^+). The 2^+ state of the prolate band was identified at an energy of 548.6 keV which is higher in energy than in ^{184}Hg. A two parameter band mixing calculation yielded an interaction strength of 87 keV between the prolate 2^+ and the oblate 2^+ states. Four of the five new bands were found to be similar in behavior to ones seen in ^{184}Hg. An attempt was made to study the behavior of some of these bands at high spins by analyzing their kinematic and dynamic moments of inertia. The gamma-ray transitions in ^{183}Hg were identified from fragment-gamma and gamma-gamma coincidence measurements. A total of five bands of levels were identified and the spins and parities of the levels were assigned by comparing the level scheme of ^{138 }Hg obtained with that of ^ {185}Hg established previously. The interpretation of these bands in terms of associated quasi-particle configurations also relies on noted similarities with the structure of ^{185}Hg. Shape co-existence was established in ^{183}Hg as a result of this study. Two of the bands associated with the (624) 9/2^+ orbital were found to exhibit signature splitting, as expected for i _{13/2} excitations built on the prolate shape with moderate deformation. Two other bands which do not show signature splitting

Using precursor ion scan of 184 with liquid chromatography-electrospray ionization-tandem mass spectrometry for concentration normalization in cellular lipidomic studies.

Science.gov (United States)

Chao, Hsi-Chun; Chen, Guan-Yuan; Hsu, Lih-Ching; Liao, Hsiao-Wei; Yang, Sin-Yu; Wang, San-Yuan; Li, Yu-Liang; Tang, Sung-Chun; Tseng, Yufeng Jane; Kuo, Ching-Hua

2017-06-08

Cellular lipidomic studies have been favored approaches in many biomedical research areas. To provide fair comparisons of the studied cells, it is essential to perform normalization of the determined concentration before lipidomic analysis. This study proposed a cellular lipidomic normalization method by measuring the phosphatidylcholine (PC) and sphingomyelin (SM) contents in cell extracts. To provide efficient analysis of PC and SM in cell extracts, flow injection analysis-electrospray ionization-tandem mass spectrometry (FIA-ESI-MS/MS) with a precursor ion scan (PIS) of m/z 184 was used, and the parameters affecting the performance of the method were optimized. Good linearity could be observed between the cell extract dilution factor and the reciprocal of the total ion chromatogram (TIC) area in the PIS of m/z 184 within the dilution range of 1- to 16-fold (R 2  = 0.998). The calibration curve could be used for concentration adjustment of the unknown concentration of a cell extract. The intraday and intermediate precisions were below 10%. The accuracy ranged from 93.0% to 105.6%. The performance of the new normalization method was evaluated using different numbers of HCT-116 cells. Sphingosine, ceramide (d18:1/18:0), SM (d18:1/18:0) and PC (16:1/18:0) were selected as the representative test lipid species, and the results showed that the peak areas of each lipid species obtained from different cell numbers were within a 20% variation after normalization. Finally, the PIS of 184 normalization method was applied to study ischemia-induced neuron injury using oxygen and glucose deprivation (OGD) on primary neuronal cultured cells. Our results showed that the PIS of 184 normalization method is an efficient and effective approach for concentration normalization in cellular lipidomic studies. Copyright © 2017 Elsevier B.V. All rights reserved.

Chemical-Petrographic Types and Shock Metamorphism of 184 Grove Mountains Equilibrated Ordinary Chondrites

Directory of Open Access Journals (Sweden)

Deqiu Dai

2018-06-01

Full Text Available We reported the petrography and mineral chemistry of 184 equilibrated ordinary chondrites collected from Grove Mountains, Antarctica. The chemical-petrographic types and shock metamorphism degrees of these chondrites were assigned. They were classified into 46 H groups (22 H4, 20 H5, and four H6, 133 L groups (eight L4, 75 L5, and 50 L6, and five LL groups (four LL4 and one LL5. Some of these chondrites could be paired; however, both H and L group meteorites were affected. Further studies such as terrestrial ages and thermal luminescence are required in order to confirm the pairings. The relative abundances of H, L, and LL are different in Grove Mountain meteorites, when compared to those in Transcontinental Ridge meteorites. Based on the shock effects, the shock metamorphism degrees of these chondrites were assigned. Compared to previous studies, the heavily shocked samples of S4 and S5 have a higher fraction (59 out of 184 in Grove Mountain ordinary chondrites. The L group (54 out of 59 is the dominant chemical group in the heavily shocked chondrites, except for five meteorites which belong to the H group. The shock metamorphism degrees of the H and L groups are distinct, which may indicate different surface properties in their parent bodies. In addition, the petrologic types and shock degrees are probably closely related, with the most heavily shocked chondrites observed in types 5 and 6.

Moleculaire diagnostiek bij aanwijzingen voor 'maturity onset diabetes of the young'; resultaten bij 184 patiënten

NARCIS (Netherlands)

Losekoot, M.; Broekman, A. J.; Breuning, M. H.; de Koning, E. J. P.; Romijn, J. A.; Maassen, J. A.

2005-01-01

To describe the results of mutation analysis of the genes involved in maturity onset diabetes of the young (MODY) types 1-3. Descriptive. In the period July 2000-October 2003 the DNA from 184 possible MODY patients was analysed for the presence of mutations of the genes involved in MODY types 1, 2

Whiting–related sediment export along the Middle Miocene carbonate ramp of Great Bahama Bank.

NARCIS (Netherlands)

Turpin, M.; Emmanuel, L.; Reijmer, J.J.G.; Renard, M.

2011-01-01

Modern aragonite needles are present all along the modern leeward margin of Great Bahama Bank (ODP Leg 166), while Middle Miocene sediments contain needles only in more distal areas (Sites 1006 and 1007). In contrast to the rimmed, flat-topped platform topography during the Plio-Pleistocene, the

Archaeal remains dominate marine organic matter from the early Albian oceanic anoxic event 1b

DEFF Research Database (Denmark)

Kuypers, M.M.M.; Blokker, P.; Hopmans, E.C.

2002-01-01

The sources for both soluble and insoluble organic matter of the early Albian (∼112 Myr) oceanic anoxic event (OAE) 1b black shales of the Ocean Drilling Program (ODP) site 1049C (North Atlantic Ocean off the coast of Florida) and the Ravel section of the Southeast France Basin (SEFB) were...... in C/C ratios was used to estimate that up to ∼40% of the organic matter of the SEFB and up to ∼80% of the organic matter of ODP site 1049C preserved in the black shales is derived from archaea. Furthermore, it is shown that, even though there are apparent similarities (high organic carbon (OC) content......, distinct lamination, C-enrichment of OC) between the black shales of OAE1b and the Cenomanian/Turonian (∼94 Myr) OAE, the origin of the organic matter (archaeal versus phytoplanktonic) and causes for C-enrichment of OC are completely different....

A comparison of petrophysical data inputs for establishing time-depth relationships: a guide for future drilling expeditions

Science.gov (United States)

Boaga, J.; Sauermilch, I.; Mateo, Z. R. P.

2017-12-01

Time-depth relationships (TDR) are crucial in correlating drillhole and core information to seismic reflection profiles, for accurate resource estimation, scientific interpretation and to guide drilling operations. Conventional seismic time-depth domain conversion utilizes downhole sonic logs (DSI), calibrated using available checkshot data, which are local travel times from the surface to a particular depth. Scientific drilling programs (ODP and IODP) also measure P-wave velocity (PWL or C) on recovered core samples. Only three percent of all ODP and IODP sites record all three velocity measurements, however this information can be instructive as sometimes these data input show dissimilar TDR. These representative sites provide us with an opportunity to perform a comparative analysis highlighting the differences and similarities of TDRs derived from checkshot, downhole, and laboratory measurements. We then discuss the impact of lithology, stratigraphy, water column and other petrophysical properties in the predictive accuracy of TDR calculations, in an effort to provide guidance for future drilling and coring expeditions.

Declining Atmospheric pCO2 During the Late Miocene and Early Pliocene: New Insights from Paired Alkenone and Coccolith Stable Isotope Barometry

Science.gov (United States)

Phelps, S. R.; Polissar, P. J.; deMenocal, P. B.; Swann, J. P.; Guo, M. Y.; Stoll, H. M.

2015-12-01

The relationship between atmospheric CO2 concentrations and climate is broadly understood for the Cenozoic era: warmer periods are associated with higher atmospheric carbon dioxide. This understanding is supported by atmospheric samples of the past 800,000 years from ice cores, which suggest CO2 levels play a key role in regulating global climate on glacial interglacial timescales as well. In this context, the late Miocene poses a challenge: sea-surface temperatures indicate substantial global warmth, though existing data suggest atmospheric CO2 concentrations were lower than pre-industrial values. Recent work using the stable carbon and oxygen isotopic composition of coccolith calcite has demonstrated these organisms began actively diverting inorganic carbon away from calcification and to the site of photosynthesis during the late Miocene. This process occurs in culture experiments in response to low aqueous CO2 concentrations, and suggests decreasing atmospheric pCO2 values during the late Miocene. Here we present new data from ODP Site 806 in the western equatorial Pacific Ocean that supports declining atmospheric CO2 across the late Miocene. Carbon isotope values of coccolith calcite from Site 806 demonstrate carbon limitation and re-allocation of inorganic carbon to photosynthesis starting between ~8 and 6 Ma. The timing of this limitation at Site 806 precedes shifts at other ODP sites, reflecting the higher mixed layer temperature and resultant lower CO2 solubility at Site 806. New measurements of carbon isotope values from alkenones at Site 806 show an increase in photosynthetic carbon fractionation (ɛp) accompanied the carbon limitation evident from coccolith calcite stable isotope data. While higher ɛp is typically interpreted as higher CO2 concentrations, at Site 806, our data suggest it reflects enhancement of chloroplast CO2 from active carbon transport by the coccolithophore algae in response to lower CO2 concentrations. Our new data from ODP Site

Magma source evolution beneath the Caribbean oceanic plateau: New insights from elemental and Sr-Nd-Pb-Hf isotopic studies of ODP Leg 165, Site 1001 basalts

Science.gov (United States)

Kerr, A. C.; Pearson, G.; Nowell, G.

2008-12-01

Ocean Drilling Project Leg 165 sampled 38m of the basaltic basement of the Caribbean plate at Site 1001 on the Hess Escarpment. The recovered section consists of 12 basaltic flow units which yield a weighted mean Ar-Ar age of 80.9±0.9 Ma (Sinton et al., 2000). The basalts (6.4-8.5 wt.% MgO) are remarkably homogeneous in composition and are more depleted in incompatible trace elements than N-MORB. Markedly, depleted initial radiogenic isotope ratios reveal a long-term history of depletion. Although the Site 1001 basalts are superficially similar to N-MORB, radiogenic isotopes in conjunction with incompatible trace element ratios show that the basalts have more similarity to the depleted basalts and komatiites of Gorgona Island. This chemical composition strongly implies that the Site 1001 basalts are derived from a depleted mantle plume component and not from depleted ambient upper mantle. Therefore the Site 1001 basalts are, both compositionally and tectonically, a constituent part of the Caribbean oceanic plateau. Mantle melt modelling suggests that the Site 1001 lavas have a composition which is consistent with second-stage melting of compositionally heterogeneous mantle plume source material which had already been melted, most likely to form the 90Ma basalts of the plateau. The prolonged residence (>10m.y.) of residual mantle plume source material below the region, confirms computational model predictions and places significant constraints on tectonic models of Caribbean evolution in the late Cretaceous, and the consequent environmental impact of oceanic plateau volcanism. Reference Sinton, C.W., et al., 2000. Geochronology and petrology of the igneous basement at the lower Nicaraguan Rise, Site 1001. Proceedings of the Ocean Drilling Program, Scientific Results. Leg 165. pp. 233-236.

A Linear Viscoelastic Model Calibration of Sylgard 184.

Energy Technology Data Exchange (ETDEWEB)

Long, Kevin Nicholas; Brown, Judith Alice

2017-04-01

We calibrate a linear thermoviscoelastic model for solid Sylgard 184 (90-10 formulation), a lightly cross-linked, highly flexible isotropic elastomer for use both in Sierra / Solid Mechanics via the Universal Polymer Model as well as in Sierra / Structural Dynamics (Salinas) for use as an isotropic viscoelastic material. Material inputs for the calibration in both codes are provided. The frequency domain master curve of oscillatory shear was obtained from a report from Los Alamos National Laboratory (LANL). However, because the form of that data is different from the constitutive models in Sierra, we also present the mapping of the LANL data onto Sandia’s constitutive models. Finally, blind predictions of cyclic tension and compression out to moderate strains of 40 and 20% respectively are compared with Sandia’s legacy cure schedule material. Although the strain rate of the data is unknown, the linear thermoviscoelastic model accurately predicts the experiments out to moderate strains for the slower strain rates, which is consistent with the expectation that quasistatic test procedures were likely followed. This good agreement comes despite the different cure schedules between the Sandia and LANL data.

Saw-toothed pattern of sedimentary paleointensity records explained by cumulative viscous remanence

NARCIS (Netherlands)

Kok, Yvo S.; Tauxe, Lisa

1996-01-01

The relative paleointensity of the earth's magnetic field from ODP Site 851 has been characterized by progressive decay w x towards polarity reversals, followed by sharp recovery of pre-reversal values 1 . We resampled the Gilbert-Gaub reversal boundary of this deep-sea core, and show that during

iagnostic accuracy study comparing total alkaline phosphatase with intact parathyroid hormone 1-84 for the diagnosis of high turnover renal osteodystrophy in chronic renal failure on hemodialysis

Directory of Open Access Journals (Sweden)

Andrés Marcelo Rojas González

2014-09-01

Full Text Available INTRODUCTION High turnover renal osteodystrophy (HTRO is a highly prevalent complication in patients with chronic kidney disease and mineral bone disease (CKD-MBD, causing pain and significant fracture-associated morbidity and mortality. The diagnostic gold standard test is bone biopsy but there are other, more widely available screening tests such as 1-84 intact parathormone (1-84 iPTH and nonspecific markers such as total alkaline phosphatase (tALP. PURPOSE To determine the diagnostic value (ROC curve, predictive values and likelihood ratios of 1-84 iPTH and tALP for HTRO screening. METHODS A diagnostic accuracy study was performed on a sample of CKD-MDB patients, grouping them according to bone biopsy results and analyzing the results of the diagnostic tests as descriptive variables. RESULTS The study group comprised 188 patients with CKD-MDB, 36 of which had biopsy-confirmed HTRO (19.15%. The average age was 50.2 years in the biopsy group, and 53.4 years in the non-biopsy group (p=0.2385, most were male (63.8% and diabetic (80.5%. The mean time in dialysis was 5.02 years in the biopsy group, and 2.61 years for the non-biopsy group (p<0.001. The mean Kt/V was 1.44 in the biopsy group, and 1.40 in the non-biopsy group (p=0.5354. The mean tALP was 398.02 IU/L in the group with HTRO versus 141.76 IU/L in the group without HTRO (p<0.001. The best cut-off value for tALP was 300-350 IU/L with a near 80% post-test probability, but also with a 15-20% probability for HTRO if the test is negative. The mean 1-84 iPTH was 1248.01 pg/ml in the group with HTRO versus 350.76 pg/ml in the group without HTRO (p<0.001. The 1-84 iPTH cut-off reference value of 300 pg/ml was associated with a post-test probability of 30% for HTRO diagnosis and had a lower overall performance. The best cut-off value for iPTH 1-84 was 600 pg/ml with a post-test probability for HTRO of 70% if positive and less than 5% if the test results are negative. DISCUSSION Both markers show

Scatterometry measurement of nested lines, dual space, and rectangular contact CD on phase-shift masks

Science.gov (United States)

Lee, Kyung M.; Yedur, Sanjay; Henrichs, Sven; Tavassoli, Malahat; Baik, Kiho

2007-03-01

Evaluation of lithography process or stepper involves very large quantity of CD measurements and measurement time. In this paper, we report on a application of Scatterometry based metrology for evaluation of binary photomask lithography. Measurements were made on mask level with ODP scatterometer then on wafer with CD-SEM. 4 to 1 scaling from mask to wafer means 60nm line on wafer translates to 240nm on mask, easily measurable on ODP. Calculation of scatterometer profile information was performed by a in-situ library-based analysis (5sec/site). We characterized the CD uniformity, linearity, and metal film thickness uniformity. Results show that linearity measured from fixed-pitch, varying line/space ratio targets show good correlation to top-down CD-SEM with R2 of more than 0.99. ODP-SEM correlation results for variable pitch shows that careful examination of scatterometer profile results in order to obtain better correlation to CD SEM, since both tools react differently to the target profile variation. ODP results show that global CD distribution is clearly measurable with less outliers compared to CD SEM data. This is thought to be due to 'averaging' effect of scatterometer. The data show that Scatterometry provides a nondestructive and faster mean of characterizing lithography stepper performanceprofiles. APSM 1st level (before Cr removal) 'dual-space' CDs and EPSM rectangular contacts were also measured with and results demonstrates that Scatterometer is capable of measuring these targets with reasonable correlation to SEM.

Sea Surface Temperatures in the Indo-Pacific Warm Pool During the Early Pliocene Warm Period

Science.gov (United States)

Dekens, P. S.; Ravelo, A. C.; Griffith, E. M.

2010-12-01

The Indo-Pacific warm pool (IPWP) plays an important role in both regional and global climate, but the response of this region to anthropogenic climate change is not well understood. While the early Pliocene is not a perfect analogue for anthropogenic climate change, it is the most recent time in Earth history when global temperatures were warmer than they are today for a sustained period of time. SST in the eastern equatorial Pacific was 2-4○C warmer in the early Pliocene compared to today. A Mg/Ca SST at ODP site 806 in the western equatorial Pacific indicates that SST were stable through the last 5Ma (Wara et al., 2005). We generated a G. sacculifer Mg/Ca record in the Indian Ocean (ODP sit 758) for the last 5 Ma, which also shows that IPWP SST has remained relatively stable through the last 5 Ma and was not warmer in the early Pliocene compared today. A recent paper suggests that the Mg/Ca of seawater may have varied through the last 5 Ma and significantly affected Mg/Ca SST estimates (Medina-Elizalde et al., 2008). However, there is considerable uncertainty in the estimates of seawater Mg/Ca variations through time. We will present a detailed examination of these uncertainties to examine the possible range of seawater Mg/Ca through the last 5 Ma. Due to the lack of culturing work of foraminifera at different Mg/Ca ratios in the growth water there is also uncertainty in how changes in seawater Mg/Ca will affect the temperatures signal in the proxy. We will explore how uncertainties in the record of seawater Mg/Ca variations through time and its effect on the Mg/Ca SST proxy potentially influence the interpretation of the Mg/Ca SST records at ODP sites 806 and 758 in the IPWP, and ODP site 847 in the eastern equatorial Pacific. We will also explore how adjustment of the Mg/Ca SST estimates (due to reconstructed Mg/Ca seawater variations) affects the δ18O of water when adjusted Mg/Ca SST estimates are paired with δ18O measurements of the same samples.

Preoperative Anemia Is Associated With Failure of Open Debridement Polyethylene Exchange in Acute and Acute Hematogenous Prosthetic Joint Infection.

Science.gov (United States)

Swenson, Richard D; Butterfield, James A; Irwin, Timothy J; Zurlo, John J; Davis, Charles M

2018-06-01

Acute and acute hematogenous prosthetic joint infections (PJIs) are often treated with open debridement and polyethylene exchange (ODPE) in an effort to save the prosthesis, decrease morbidity, and reduce costs. However, failure of ODPE may compromise a subsequent 2-stage treatment. The purpose of this study is to identify patient factors that impact the success of ODPE for acute and acute hematogenous PJIs. A retrospective review examined comorbidities, preoperative laboratory values, and patient history for patients with successful and failed ODPE treatment for acute perioperative or acute hematogenous periprosthetic hip or knee joint infections. Successful treatment was defined as retaining a well-fixed implant without the need for additional surgery for a minimum of 6-month follow-up with or without lifelong oral maintenance antibiotics. Fifty-three of 72 patients (73.6%) underwent successful ODPE. Of the 19 failures, 14 completed 2-stage revision with one subsequent known failure for recurrent infection. Patients with a Staphylococcus aureus infection were more likely to fail ODPE (48.3% vs 11.6%, P = .0012, odds ratio 7.1, 95% confidence interval 2.3-25.3). Patients with a preoperative hematocrit ≤32.1 were also more likely to fail ODPE (55% vs 16%, P = .0013, odds ratio 6.7, 95% confidence interval 2.2-22.4). When neither risk factor was present, 97.1% of PJIs were successfully treated with ODPE. S aureus infection and preoperative hematocrit ≤32.1 are independent risk factors for ODPE failure. ODPE is a safe alternative to 2-stage revision in patients without preoperative anemia and without S aureus infection. Two-thirds of patients with a failed ODPE were successfully treated with a 2-stage reimplantation. Copyright © 2018 Elsevier Inc. All rights reserved.

Phase II, Title I engineering assessment of inactive uranium mill tailings, Falls City Site, Falls City, Texas

International Nuclear Information System (INIS)

1977-12-01

An engineering assessment was performed of the problems resulting from the existence of radioactive uranium mill tailings at Falls City, Texas. Services included taking soil samples, the performance of radiometric measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting radiation exposures of individuals and nearby populations, the investigation of site hydrology and meteorology and the evaluation and costing of alternative corrective actions. Radon gas release from the 2.5 million tons of tailings at the Falls City site constitutes the most significant environmental impact. Windblown tailings, external gamma radiation and localized contamination of surface waters are other environmental effects. The two alternative remedial action options presented include on-site and off-site cleanup, fencing, and hydrological monitoring, and in addition, stabilization of pile 2 with 2 ft of cover material. The costs are $1.84 million for Option I and $2.45 million for Option II

Late Quaternary changes in surface productivity and oxygen ...

Indian Academy of Sciences (India)

Changes in the abundance of selected planktic foraminiferal species and some sedimentological parameters at ODP site 728A were examined to understand the fluctuations in the surface productivity and deep sea oxygenation in the NW Arabian Sea during last ∼540 kyr. The increased relative abundances of high fertility ...

Boron/calcium ratios in Globigerinoides ruber from the Arabian Sea: Implications for controls on boron incorporation

Digital Repository Service at National Institute of Oceanography (India)

Naik, S.S.; Naidu, P.D.

of Globigerinoides ruber from the Ocean Drilling Program (ODP) Site 723A (western Arabian Sea) and Core AAS9/21 (eastern Arabian Sea) from the last 22 kyr were analysed for B/Ca, delta¹⁸O and Mg/Ca. B/Ca was compared to reconstructed salinity and sea...

Proposed actions are no actions: re-modeling an ontology design pattern with a realist top-level ontology.

Science.gov (United States)

Seddig-Raufie, Djamila; Jansen, Ludger; Schober, Daniel; Boeker, Martin; Grewe, Niels; Schulz, Stefan

2012-09-21

Ontology Design Patterns (ODPs) are representational artifacts devised to offer solutions for recurring ontology design problems. They promise to enhance the ontology building process in terms of flexibility, re-usability and expansion, and to make the result of ontology engineering more predictable. In this paper, we analyze ODP repositories and investigate their relation with upper-level ontologies. In particular, we compare the BioTop upper ontology to the Action ODP from the NeOn an ODP repository. In view of the differences in the respective approaches, we investigate whether the Action ODP can be embedded into BioTop. We demonstrate that this requires re-interpreting the meaning of classes of the NeOn Action ODP in the light of the precepts of realist ontologies. As a result, the re-design required clarifying the ontological commitment of the ODP classes by assigning them to top-level categories. Thus, ambiguous definitions are avoided. Classes of real entities are clearly distinguished from classes of information artifacts. The proposed approach avoids the commitment to the existence of unclear future entities which underlies the NeOn Action ODP. Our re-design is parsimonious in the sense that existing BioTop content proved to be largely sufficient to define the different types of actions and plans. The proposed model demonstrates that an expressive upper-level ontology provides enough resources and expressivity to represent even complex ODPs, here shown with the different flavors of Action as proposed in the NeOn ODP. The advantage of ODP inclusion into a top-level ontology is the given predetermined dependency of each class, an existing backbone structure and well-defined relations. Our comparison shows that the use of some ODPs is more likely to cause problems for ontology developers, rather than to guide them. Besides the structural properties, the explanation of classification results were particularly hard to grasp for 'self-sufficient' ODPs as

Determination and evaluation of toxic elements in Chinese foodstuffs

International Nuclear Information System (INIS)

Sun Laiyan; Lu Fengying; Zhou Wenping; Zhen Houxi; Su Rongwei; Liao Qingshang; Li Xuezeng; Wang Huaihui

1988-01-01

The concentrations of toxic elements As, Br, Cr, Cu, Pb, Se and Zn in various foodstuffs collected in Beijing, Shanghai, Xian and Wuhan were determined using neutron activation analysis (NAA) and atomic absorption spectrometry (AAS) methods were obtained with high or medium precision. According to the average daily intake of various foods, the daily intake of these toxic elements were estimated for each person in the four cities. They (in microgram) were 42.6, 166.3, 1738, 106.8, 7939, 1145 and 67.1 respectively for As, Cr, Cu, Se, Zn, Br and Pb in Beijing, 52.2, 167, 1213, 91.5, 6026, 519 and 89.9 in Shanghai, 46.2, 184, 1782, 119.2, 8729, 1132 and 133.4 in Xian, and 63.2, 142.1, 1556, 76.9, 7882, 528 and 73.7 in Wuhan. (author). 2 refs, 12 tabs

Four-jet final state production in $e^+ e^-$ collisions at centre-of-mass energies ranging from 130 to 184 GeV

CERN Document Server

Barate, R; Décamp, D; Ghez, P; Goy, C; Lees, J P; Lucotte, A; Minard, M N; Nief, J Y; Pietrzyk, B; Boix, G; Casado, M P; Chmeissani, M; Crespo, J M; Delfino, M C; Fernández, E; Fernández-Bosman, M; Garrido, L; Graugès-Pous, E; Juste, A; Martínez, M; Merino, G; Miquel, R; Mir, L M; Morawitz, P; Park, I C; Pascual, A; Perlas, J A; Riu, I; Sánchez, F; Colaleo, A; Creanza, D; De Palma, M; Gelao, G; Iaselli, Giuseppe; Maggi, G; Maggi, M; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Abbaneo, D; Alemany, R; Becker, U; Bright-Thomas, P G; Casper, David William; Cattaneo, M; Cerutti, F; Ciulli, V; Dissertori, G; Drevermann, H; Forty, Roger W; Frank, M; Gianotti, F; Hagelberg, R; Hansen, J B; Harvey, J; Janot, P; Jost, B; Lehraus, Ivan; Mato, P; Minten, Adolf G; Moneta, L; Pacheco, A; Pusztaszeri, J F; Ranjard, F; Rolandi, Luigi; Rousseau, D; Schlatter, W D; Schmitt, M; Schneider, O; Tejessy, W; Teubert, F; Tomalin, I R; Vreeswijk, M; Wachsmuth, H W; Wagner, A; Ajaltouni, Ziad J; Badaud, F; Chazelle, G; Deschamps, O; Falvard, A; Ferdi, C; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Perret, P; Podlyski, F; Proriol, J; Rosnet, P; Fearnley, Tom; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Rensch, B; Wäänänen, A; Daskalakis, G; Kyriakis, A; Markou, C; Simopoulou, Errietta; Vayaki, Anna; Blondel, A; Brient, J C; Machefert, F P; Rougé, A; Rumpf, M; Valassi, Andrea; Videau, H L; Boccali, T; Focardi, E; Parrini, G; Zachariadou, K; Cavanaugh, R J; Corden, M; Georgiopoulos, C H; Hühn, T; Jaffe, D E; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Chiarella, V; Felici, G; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Curtis, L; Dorris, S J; Halley, A W; Lynch, J G; Negus, P; O'Shea, V; Raine, C; Scarr, J M; Smith, K; Teixeira-Dias, P; Thompson, A S; Thomson, E; Thomson, F; Ward, J; Buchmüller, O L; Dhamotharan, S; Geweniger, C; Graefe, G; Hanke, P; Hansper, G; Hepp, V; Kluge, E E; Putzer, A; Sommer, J; Tittel, K; Werner, S; Wunsch, M; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Girone, M; Goodsir, S M; Martin, E B; Marinelli, N; Moutoussi, A; Nash, J; Sedgbeer, J K; Spagnolo, P; Williams, M D; Ghete, V M; Girtler, P; Kneringer, E; Kuhn, D; Rudolph, G; Betteridge, A P; Bowdery, C K; Buck, P G; Colrain, P; Crawford, G; Finch, A J; Foster, F; Hughes, G; Jones, R W L; Whelan, E P; Williams, M I; Giehl, I; Hoffmann, C; Jakobs, K; Kleinknecht, K; Quast, G; Renk, B; Rohne, E; Sander, H G; Van Gemmeren, P; Zeitnitz, C; Aubert, Jean-Jacques; Benchouk, C; Bonissent, A; Bujosa, G; Carr, J; Coyle, P; Ealet, A; Fouchez, D; Leroy, O; Motsch, F; Payre, P; Talby, M; Sadouki, A; Thulasidas, M; Tilquin, A; Trabelsi, K; Aleppo, M; Antonelli, M; Ragusa, F; Berlich, R; Blum, Walter; Büscher, V; Dietl, H; Ganis, G; Gotzhein, C; Kroha, H; Lütjens, G; Lutz, Gerhard; Mannert, C; Männer, W; Moser, H G; Richter, R H; Rosado-Schlosser, A; Schael, S; Settles, Ronald; Seywerd, H C J; Stenzel, H; Wiedenmann, W; Wolf, G; Boucrot, J; Callot, O; Chen, S; Davier, M; Duflot, L; Grivaz, J F; Höcker, A; Jacholkowska, A; Kado, M; Kim, D W; Le Diberder, F R; Lefrançois, J; Lutz, A M; Schune, M H; Serin, L; Tournefier, E; Veillet, J J; Videau, I; Zerwas, D; Azzurri, P; Bagliesi, G; Bettarini, S; Bozzi, C; Calderini, G; Dell'Orso, R; Fantechi, R; Ferrante, I; Giassi, A; Gregorio, A; Ligabue, F; Lusiani, A; Marrocchesi, P S; Messineo, A; Palla, Fabrizio; Rizzo, G; Sanguinetti, G; Sciabà, A; Sguazzoni, G; Steinberger, Jack; Tenchini, Roberto; Vannini, C; Venturi, A; Verdini, P G; Blair, G A; Bryant, L M; Chambers, J T; Coles, J; Green, M G; Medcalf, T; Perrodo, P; Strong, J A; Von Wimmersperg-Töller, J H; Botterill, David R; Clifft, R W; Edgecock, T R; Haywood, S; Maley, P; Norton, P R; Thompson, J C; Wright, A E; Bloch-Devaux, B; Colas, P; Fabbro, B; Faïf, G; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Przysiezniak, H; Rander, J; Renardy, J F; Rosowsky, A; Roussarie, A; Trabelsi, A; Vallage, B; Black, S N; Dann, J H; Kim, H Y; Konstantinidis, N P; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Brew, C A J; Cartwright, S L; Combley, F; Kelly, M S; Lehto, M H; Reeve, J; Thompson, L F; Affholderbach, K; Böhrer, A; Brandt, S; Cowan, G D; Foss, J; Grupen, Claus; Smolik, L; Stephan, F; Apollonio, M; Bosisio, L; Della Marina, R; Giannini, G; Gobbo, B; Musolino, G; Pütz, J; Rothberg, J E; Wasserbaech, S R; Williams, R W; Armstrong, S R; Charles, E; Elmer, P; Ferguson, D P S; Gao, Y; González, S; Greening, T C; Hayes, O J; Hu, H; Jin, S; McNamara, P A; Nachtman, J M; Nielsen, J; Orejudos, W; Pan, Y B; Saadi, Y; Scott, I J; Walsh, J; Wu Sau Lan; Wu, X; Yamartino, J M; Zobernig, G

1998-01-01

The four jet topology is analysed in the ALEPH data taken between November 1995 and November 1997, at centre-of-mass energies ranging from 130 to 184 GeV. While an unexpected accumulation of events with a dijet mas sum around 105 GeV/c**2 had been observed during the first run in 1995 at 130/136 GeV, corresponding to an integrated luminosity of 5.7 pb-1, no significant differences between data and standard model prediction is noticed, either in the high energy runs (81.1 pb-1 taken at centre-of-mass energies from 161 to 184 GeV) or in the 7.1 pb-1 recorded during a new short run at 130/136 GeV in 1997. We have found no other explanation for the earlier reported ``four jet anomaly'' than a statistical fluctuation.

Four-jet final state production in e+e- collisions at centre-of-mass energies ranging from 130 to 184 GeV

Science.gov (United States)

ALEPH Collaboration; Barate, R.; Buskulic, D.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J.-P.; Lucotte, A.; Minard, M.-N.; Nief, J.-Y.; Pietrzyk, B.; Boix, G.; Casado, M. P.; Chmeissani, M.; Crespo, J. M.; Delfino, M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, Ll.; Graugès, E.; Juste, A.; Martinez, M.; Merino, G.; Miquel, R.; Mir, Ll. M.; Morawitz, P.; Park, I. C.; Pascual, A.; Perlas, J. A.; Riu, I.; Sanchez, F.; Colaleo, A.; Creanza, D.; de Palma, M.; Gelao, G.; Iaselli, G.; Maggi, G.; Maggi, M.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Alemany, R.; Becker, U.; Bright-Thomas, P.; Casper, D.; Cattaneo, M.; Cerutti, F.; Ciulli, V.; Dissertori, G.; Drevermann, H.; Forty, R. W.; Frank, M.; Gianotti, F.; Hagelberg, R.; Hansen, J. B.; Harvey, J.; Janot, P.; Jost, B.; Lehraus, I.; Mato, P.; Minten, A.; Moneta, L.; Pacheco, A.; Pusztaszeri, J.-F.; Ranjard, F.; Rolandi, L.; Rousseau, D.; Schlatter, D.; Schmitt, M.; Schneider, O.; Tejessy, W.; Teubert, F.; Tomalin, I. R.; Vreeswijk, M.; Wachsmuth, H.; Wagner, A.; Ajaltouni, Z.; Badaud, F.; Chazelle, G.; Deschamps, O.; Falvard, A.; Ferdi, C.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Rosnet, P.; Fearnley, T.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Nilsson, B. S.; Rensch, B.; Wäänänen, A.; Daskalakis, G.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Blondel, A.; Brient, J.-C.; Machefert, F.; Rougé, A.; Rumpf, M.; Valassi, A.; Videau, H.; Boccali, T.; Focardi, E.; Parrini, G.; Zachariadou, K.; Cavanaugh, R.; Corden, M.; Georgiopoulos, C.; Huehn, T.; Jaffe, D. E.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Curtis, L.; Dorris, S. J.; Halley, A. W.; Lynch, J. G.; Negus, P.; O'Shea, V.; Raine, C.; Scarr, J. M.; Smith, K.; Teixeira-Dias, P.; Thompson, A. S.; Thomson, E.; Thomson, F.; Buchmüller, O.; Dhamotharan, S.; Geweniger, C.; Graefe, G.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E. E.; Putzer, A.; Sommer, J.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Dornan, P. J.; Girone, M.; Goodsir, S.; Martin, E. B.; Marinelli, N.; Moutoussi, A.; Nash, J.; Sedgbeer, J. K.; Spagnolo, P.; Williams, M. D.; Ghete, V. M.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Betteridge, A. P.; Bowdery, C. K.; Buck, P. G.; Colrain, P.; Crawford, G.; Finch, A. J.; Foster, F.; Hughes, G.; Jones, R. W. L.; Whelan, E. P.; Williams, M. I.; Giehl, I.; Hoffmann, C.; Jakobs, K.; Kleinknecht, K.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.-G.; van Gemmeren, P.; Zeitnitz, C.; Aubert, J. J.; Benchouk, C.; Bonissent, A.; Bujosa, G.; Carr, J.; Coyle, P.; Ealet, A.; Fouchez, D.; Leroy, O.; Motsch, F.; Payre, P.; Talby, M.; Sadouki, A.; Thulasidas, M.; Tilquin, A.; Trabelsi, K.; Aleppo, M.; Antonelli, M.; Ragusa, F.; Berlich, R.; Blum, W.; Büscher, V.; Dietl, H.; Ganis, G.; Gotzhein, C.; Kroha, H.; Lütjens, G.; Lutz, G.; Mannert, C.; Männer, W.; Moser, H.-G.; Richter, R.; Rosado-Schlosser, A.; Schael, S.; Settles, R.; Seywerd, H.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Boucrot, J.; Callot, O.; Chen, S.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Höcker, A.; Jacholkowska, A.; Kado, M. M.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Schune, M.-H.; Serin, L.; Tournefier, E.; Veillet, J.-J.; Videau, I.; Zerwas, D.; Azzurri, P.; Bagliesi, G.; Bettarini, S.; Bozzi, C.; Calderini, G.; dell'Orso, R.; Fantechi, R.; Ferrante, I.; Giassi, A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Sciabà, A.; Sguazzoni, G.; Steinberger, J.; Tenchini, R.; Vannini, C.; Venturi, A.; Verdini, P. G.; Blair, G. A.; Bryant, L. M.; Chambers, J. T.; Coles, J.; Green, M. G.; Medcalf, T.; Perrodo, P.; Strong, J. A.; von Wimmersperg-Toeller, J. H.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Maley, P.; Norton, P. R.; Thompson, J. C.; Wright, A. E.; Bloch-Devaux, B.; Colas, P.; Fabbro, B.; Faïf, G.; Lançon, E.; Lemaire, M.-C.; Locci, E.; Perez, P.; Przysiezniak, H.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Roussarie, A.; Trabelsi, A.; Vallage, B.; Black, S. N.; Dann, J. H.; Kim, H. Y.; Konstantinidis, N.; Litke, A. M.; McNeil, M. A.; Taylor, G.; Booth, C. N.; Brew, C. A. J.; Cartwright, S.; Combley, F.; Kelly, M. S.; Lehto, M.; Reeve, J.; Thompson, L. F.; Affholderbach, K.; Böhrer, A.; Brandt, S.; Cowan, G.; Foss, J.; Grupen, C.; Smolik, L.; Stephan, F.; Apollonio, M.; Bosisio, L.; della Marina, R.; Giannini, G.; Gobbo, B.; Musolino, G.; Putz, J.; Rothberg, J.; Wasserbaech, S.; Williams, R. W.; Armstrong, S. R.; Charles, E.; Elmer, P.; Ferguson, D. P. S.; Gao, Y.; González, S.; Greening, T. C.; Hayes, O. J.; Hu, H.; Jin, S.; McNamara, P. A., III; Nachtman, J. M.; Nielsen, J.; Orejudos, W.; Pan, Y. B.; Saadi, Y.; Scott, I. J.; Walsh, J.; Wu, Sau Lan; Wu, X.; Yamartino, J. M.; Zobernig, G.

1998-02-01

The four jet topology is analysed in the ALEPH data taken between November 1995 and October 1997, at centre-of-mass energies ranging from 130 to 184 GeV. While an unexpected accumulation of events with a dijet mass sum around 105 GeV/c2 had been observed during the first run in 1995 at 130/136 GeV, corresponding to an integrated luminosity of 5.7 pb-1, no significant differences between data and standard model prediction is seen, either in the high energy runs (81.1 pb-1 taken at centre-of-mass energies from 161 to 184 GeV) or in the 7.1 pb-1 recorded during a new short run at 130/136 GeV in 1997. We have found no other explanation for the earlier reported ``four jet anomaly'' than a statistical fluctuation.

Meta-analysis of summer roosting characteristics of two species of Myotis bats

Science.gov (United States)

Michael Lacki; Daniel R. Cox; Matthew B. Dickinson

2009-01-01

We compared roost site characteristics of the Indiana bat (Myotis sodalis) and northern bat (M. septentrionalis), which form maternity colonies in cavities and beneath bark of dead (snags) and living trees in eastern North American forests. We used published data (n = 28 sources; n = 1145 roost trees) from studies completed where...

An updated astronomical time scale for the Plio-Pleistocene deposits from South China Sea and new insights into Asian monsoon evolution

NARCIS (Netherlands)

Ao, H.; Dekkers, M.J.; Qin, L.; Xiao, G.

2011-01-01

Here we present an improved astronomical timescale since 5 Ma as recorded in the ODP Site 1143 in the southern South China Sea, using a recently published Asian summer monsoon record (hematite to goethite content ratio, Hm/Gt) and a parallel benthic δ18O record. Correlation of the benthic δ18O

Rock Magnetic Characterization Through an Intact Sequence of Oceanic Crust, IODP Hole 1256D

NARCIS (Netherlands)

Herrero-Bervera, E.; Acton, G.; Krasá, D.; Rodriguez, S.; Dekkers, M.J.

2011-01-01

Coring at Site 1256 (6.736◦N, 91.934◦W, 3635 m water depth) during Ocean Drilling Program (ODP) Leg 206 and Integrated Ocean Drilling Program (IODP) Expeditions 309 and 312 successfully sampled a complete section of in situ oceanic crust, including sediments of Seismic Layer 1, lavas and dikes of

Tribological behavior of 440C martensitic stainless steel from -184 C to 750 C

Science.gov (United States)

Slifka, A. J.; Compos, R.; Morgan, T. J.; Siegwarth, J. D.; Chaudhuri, Dilip K.

1992-01-01

Characterization of the coefficient of friction and wear rate of 440C stainless steel is needed to understand the effects of frictional heating in the bearings of the High Pressure Oxygen Turbopump of the Space Shuttle Main Engine. The coefficient of friction and wear rate have been measured over a range of temperature varying from liquid oxygen temperature (-184 C) to 750 C. The normal load has also been varied resulting in a variation of Hertzian stress from 0.915 to 3.660 GPa while the surface velocity has been varied from 0.5 to 2.0 m/s.

Summary of the Phase II, Title I engineering assessment of inactive uranium mill tailings, Falls City Site, Falls City, Texas

International Nuclear Information System (INIS)

1977-12-01

An engineering assessment was performed of the problems resulting from the existence of radioactive uranium mill tailings at Falls City, Texas. Services included taking soil samples, the performance of radiometric measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting radiation exposures of individuals and nearby populations, the investigation of site hydrology and meteorology and the evaluation and costing of alternative corrective actions. Radon gas release from the 2.5 million tons of tailings at the Falls City site constitutes the most significant environmental impact. Windblown tailings, external gamma radiation and localized contamination of surface waters are other environmental effects. The two alternative remedial action options presented include on-site and off-site cleanup, fencing, and hydrological monitoring and, in addition, stabilization of pile 2 with 2 ft of cover material. The costs are $1.84 million and $2.45 million

The Role of CREB, SRF, and MEF2 in Activity-Dependent Neuronal Plasticity in the Visual Cortex.

Science.gov (United States)

Pulimood, Nisha S; Rodrigues, Wandilson Dos Santos; Atkinson, Devon A; Mooney, Sandra M; Medina, Alexandre E

2017-07-12

The transcription factors CREB (cAMP response element binding factor), SRF (serum response factor), and MEF2 (myocyte enhancer factor 2) play critical roles in the mechanisms underlying neuronal plasticity. However, the role of the activation of these transcription factors in the different components of plasticity in vivo is not well known. In this study, we tested the role of CREB, SRF, and MEF2 in ocular dominance plasticity (ODP), a paradigm of activity-dependent neuronal plasticity in the visual cortex. These three proteins bind to the synaptic activity response element (SARE), an enhancer sequence found upstream of many plasticity-related genes (Kawashima et al., 2009; Rodríguez-Tornos et al., 2013), and can act cooperatively to express Arc , a gene required for ODP (McCurry et al., 2010). We used viral-mediated gene transfer to block the transcription function of CREB, SRF, and MEF2 in the visual cortex, and measured visually evoked potentials in awake male and female mice before and after a 7 d monocular deprivation, which allowed us to examine both the depression component (Dc-ODP) and potentiation component (Pc-ODP) of plasticity independently. We found that CREB, SRF, and MEF2 are all required for ODP, but have differential effects on Dc-ODP and Pc-ODP. CREB is necessary for both Dc-ODP and Pc-ODP, whereas SRF and MEF2 are only needed for Dc-ODP. This finding supports previous reports implicating SRF and MEF2 in long-term depression (required for Dc-ODP), and CREB in long-term potentiation (required for Pc-ODP). SIGNIFICANCE STATEMENT Activity-dependent neuronal plasticity is the cellular basis for learning and memory, and it is crucial for the refinement of neuronal circuits during development. Identifying the mechanisms of activity-dependent neuronal plasticity is crucial to finding therapeutic interventions in the myriad of disorders where it is disrupted, such as Fragile X syndrome, Rett syndrome, epilepsy, major depressive disorder, and autism

Alanine scanning of the rabies virus glycoprotein antigenic site III using recombinant rabies virus: implication for post-exposure treatment.

Science.gov (United States)

Papaneri, Amy B; Wirblich, Christoph; Marissen, Wilfred E; Schnell, Matthias J

2013-12-02

The safety and availability of the human polyclonal sera that is currently utilized for post-exposure treatment (PET) of rabies virus (RABV) infection remain a concern. Recombinant monoclonal antibodies have been postulated as suitable alternatives by WHO. To this extent, CL184, the RABV human antibody combination comprising monoclonal antibodies (mAbs) CR57 and CR4098, has been developed and has delivered promising clinical data to support its use for RABV PET. For this fully human IgG1 cocktail, mAbs CR57 and CR4098 are produced in the PER.C6 human cell line and combined in equal amounts in the final product. During preclinical evaluation, CR57 was shown to bind to antigenic site I whereas CR4098 neutralization was influenced by a mutation of position 336 (N336) located within antigenic site III. Here, alanine scanning was used to analyze the influence of mutations within the potential binding site for CR4098, antigenic site III, in order to evaluate the possibility of mutated rabies viruses escaping neutralization. For this approach, twenty flanking amino acids (10 upstream and 10 downstream) of the RABV glycoprotein (G) asparagine (N336) were exchanged to alanine (or serine, if already alanine) by site-directed mutagenesis. Analysis of G expression revealed four of the twenty mutant Gs to be non-functional, as shown by their lack of cell surface expression, which is a requirement for the production of infectious RABV. Therefore, these mutants were excluded from further study. The remaining sixteen mutants were introduced in an infectious clone of RABV, and recombinant RABVs (rRABVs) were recovered and utilized for in vitro neutralization assays. All of the viruses were effectively neutralized by CR4098 as well as by CR57, indicating that single amino acid exchanges in this region does not affect the broad neutralizing capability of the CL184 mAb combination. Copyright © 2013 Elsevier Ltd. All rights reserved.

Evaluated 182,183,184,186W Neutron Cross Sections and Covariances in the Resolved Resonance Region

International Nuclear Information System (INIS)

Pigni, Marco T; Leal, Luiz C

2015-01-01

Oak Ridge National Laboratory (ORNL) has recently completed the resonance parameter evaluation of four tungsten isotopes, i.e., 182,183,184,186 W, in the neutron energy range of thermal up to several keV. This nuclear data work was performed with support from the US Nuclear Criticality Safety Program (NCSP) in an effort to provide improved tungsten cross section and covariance data for criticality safety analyses. The evaluation methodology uses the Reich-Moore approximation of the R-matrix formalism of the code SAMMY to fit high-resolution measurements performed in 2010 and 2012 at the Geel linear accelerator facility (GELINA), as well as other experimental data sets on natural tungsten available in the EXFOR library. In the analyzed energy range, this work nearly doubles the resolved resonance region (RRR) present in the latest US nuclear data library ENDF/B-VII.1. In view of the interest in tungsten for distinct types of nuclear applications and the relatively homogeneous distribution of the isotopic tungsten - namely, 182 W(26.5%), 183 W(14.31%), 184 W(30.64%), and 186 W(28.43%) - the completion of these four evaluations represents a significant contribution to the improvement of the ENDF library. This paper presents an overview of the evaluated resonance parameters and related covariances for total and capture cross sections on the four tungsten isotopes.

Journal of Earth System Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

We have identified an ash layer in association with Australasian microtektites of ∼0.77Ma old in two sediment cores which are ∼450 km apart in the central Indian Ocean Basin (CIOB). Morphology and chemical composition of glass shards and associated microtektites have been used to trace their provenance. In ODP site ...

Surgical and Palliative Management and Outcome in 184 Patients With Hilar Cholangiocarcinoma

Science.gov (United States)

Witzigmann, Helmut; Berr, Frieder; Ringel, Ulrike; Caca, Karel; Uhlmann, Dirk; Schoppmeyer, Konrad; Tannapfel, Andrea; Wittekind, Christian; Mossner, Joachim; Hauss, Johann; Wiedmann, Marcus

2006-01-01

Objective: First, to analyze the strategy for 184 patients with hilar cholangiocarcinoma seen and treated at a single interdisciplinary hepatobiliary center during a 10-year period. Second, to compare long-term outcome in patients undergoing surgical or palliative treatment, and third to evaluate the role of photodynamic therapy in this concept. Summary Background Data: Tumor resection is attainable in a minority of patients (<30%). When resection is not possible, radiotherapy and/or chemotherapy have been found to be an ineffective palliative option. Recently, photodynamic therapy (PDT) has been evaluated as a palliative and neoadjuvant modality. Methods: Treatment and outcome data of 184 patients with hilar cholangiocarcinoma were analyzed prospectively between 1994 and 2004. Sixty patients underwent resection (8 after neoadjuvant PDT); 68 had PDT in addition to stenting and 56 had stenting alone. Results: The 30-day death rate after resection was 8.3%. Major complications occurred in 52%. The overall 1-, 3-, and 5-year survival rates were 69%, 30%, and 22%, respectively. R0, R1, and R2 resection resulted in 5-year survival rates of 27%, 10%, and 0%, respectively. Multivariate analysis identified R0 resection (P < 0.01), grading (P < 0.05), and on the limit to significance venous invasion (P = 0.06) as independent prognostic factors for survival. PDT and stenting resulted in longer median survival (12 vs. 6.4 months, P < 0.01), lower serum bilirubin levels (P < 0.05), and higher Karnofsky performance status (P < 0.01) as compared with stenting alone. Median survival after PDT and stenting, but not after stenting alone, did not differ from that after both R1 and R2 resection. Conclusion: Only complete tumor resection, including hepatic resection, enables long-term survival for patients with hilar cholangiocarcinoma. Palliative PDT and subsequent stenting resulted in longer survival than stenting alone and has a similar survival time compared with incomplete R1 and

Prevalência de esofagopatia chagásica no Município de Mambaí, Goiás - Brasil

Directory of Open Access Journals (Sweden)

Cleudson Castro

1987-03-01

Full Text Available Em Mambaí, área endêmica de doença de Chagas, foram realizadas abreugrafias do esôfago com filme de 70mm, em 1.145 indivíduos do sexo masculino e 1.184 dofeminino, de 4 a 87 anos, dos quais 1.006eram soropositivos. Os pacientes foram posicionados em oblíqua anterior direita e tomadas duas abreugrafias: uma imediatamente à ingestão de 75 ml de suspensão baritada e outra 60 segundos após. Setenta e seis (3,2% indivíduos apresentaram esofagopatia, sendo que 71(7% entre os 1.006 soropositivos e, 5(0,37% entre os 1.323 soronegativos. Dos 76 esofagopatas 47(61,8% eram do sexo masculino e 29(38,1% do sexo feminino. Segundo a classificação de Rezende e cols 48(63,1% pertenciam ao grupo I, 18(23,7% ao grupo II, 5(6,6% ao grupo III e 5(6,6% ao grupo IV. Entre os infectados a esofagopatia aumentou progressivamente com a idade, principalmente a partir dos 30 anos, alcançando a prevalência de 21,5% após os 59 anos.In Mambai, an endemic area for Chagas’ disease, contrast radiography of the oesophagus using 70 mm film was done in 1,145 male and I,184 female individuals. Ages ranged from 4 to 87 years. The patients were positioned in the right anterior oblique position and two films taken, one immediately after ingestion of 75 ml of barium contrast and another 60 seconds later. Seventy six (3.2% individuals had oesophageal abnormalities of whom 71(7% were among 1,006 seropositives and 5(0.37% were among 1,323 seronegatives. Of the 76 patients, 47 (61.8% were male and 29(38.1% female. Following the classification of Rezende and colleagues, 48(63.1%, belonged to group 1,18(23.7%, to group II, 5(6.6% and 5(6.6% to group IV. The prevalence of oesophageal disease increased with age especially after 30 years, reaching 21.5% in the group over 59 years of age.

High resolution cyclostratigraphy of the early Eocene – new insights into the origin of the Cenozoic cooling trend

Directory of Open Access Journals (Sweden)

T. Westerhold

2009-07-01

Full Text Available Here we present a high-resolution cyclostratigraphy based on X-ray fluorescence (XRF core scanning data from a new record retrieved from the tropical western Atlantic (Demerara Rise, ODP Leg 207, Site 1258. The Eocene sediments from ODP Site 1258 cover magnetochrons C20 to C24 and show well developed cycles. This record includes the missing interval for reevaluating the early Eocene part of the Geomagnetic Polarity Time Scale (GPTS, also providing key aspects for reconstructing high-resolution climate variability during the Early Eocene Climatic Optimum (EECO. Detailed spectral analysis demonstrates that early Eocene sedimentary cycles are characterized by precession frequencies modulated by short (100 kyr and long (405 kyr eccentricity with a generally minor obliquity component. Counting of both the precession and eccentricity cycles results in revised estimates for the duration of magnetochrons C21r through C24n. Our cyclostratigraphic framework also corroborates that the geochronology of the Eocene Green River Formation (Wyoming, USA is still questionable mainly due to the uncertain correlation of the "Sixth tuff" to the GPTS.

Right at the onset of the long-term Cenozoic cooling trend the dominant eccentricity-modulated precession cycles of ODP Site 1258 are interrupted by strong obliquity cycles for a period of ~800 kyr in the middle of magnetochron C22r. These distinct obliquity cycles at this low latitude site point to (1 a high-latitude driving mechanism on global climate variability from 50.1 to 49.4 Ma, and (2 seem to coincide with a significant drop in atmospheric CO₂ concentration below a critical threshold between 2- and 3-times the pre-industrial level (PAL. The here newly identified orbital configuration of low eccentricity in combination with high obliquity amplitudes during this ~800-kyr period and the crossing of a critical pCO₂ threshold may have led to the formation of the first ephemeral

Nucleus Z=126 with magic neutron number N=184 may be related to the measured Maruhn–Greiner maximum at A/2=155 from compound nuclei at low energy nuclear reactions

Energy Technology Data Exchange (ETDEWEB)

Prelas, M.A. [University of Missouri, Columbia, MO (United States); Hora, H. [University of New South Wales, Sydney (Australia); Miley, G.H. [University of Illinois, Urbana-Champaign (United States)

2014-07-04

Evaluation of nuclear binding energies from theory close to available measurements of a very high number of superheavy elements (SHE) based on α-decay energies Q{sub α}, arrived at a closing shell with a significant neutron number 184. Within the option of several discussed magic numbers for protons of around 120, Bagge's numbers 126 and 184 fit well and are supported by the element generation measurements by low energy nuclear reactions (LENR) discovered in deuterium loaded host metals. These measurements were showing a Maruhn–Greiner maximum from fission of compound nuclei in an excited state with double magic numbers for mutual confirmation. - Highlights: • Use of Bagge procedure confirmed that Z=126 and N=184 are proper magic numbers. • Elements are generated by low energy nuclear reactions in deuterium loaded metal. • Postulated from measured distribution that a compound nucleus {sup 310}X{sub 126} was formed. • Formation of 164 deuterons in Bose–Einstein state clusters with 2 pm spacing.

Nucleus Z=126 with magic neutron number N=184 may be related to the measured Maruhn–Greiner maximum at A/2=155 from compound nuclei at low energy nuclear reactions

International Nuclear Information System (INIS)

Prelas, M.A.; Hora, H.; Miley, G.H.

2014-01-01

Evaluation of nuclear binding energies from theory close to available measurements of a very high number of superheavy elements (SHE) based on α-decay energies Q α , arrived at a closing shell with a significant neutron number 184. Within the option of several discussed magic numbers for protons of around 120, Bagge's numbers 126 and 184 fit well and are supported by the element generation measurements by low energy nuclear reactions (LENR) discovered in deuterium loaded host metals. These measurements were showing a Maruhn–Greiner maximum from fission of compound nuclei in an excited state with double magic numbers for mutual confirmation. - Highlights: • Use of Bagge procedure confirmed that Z=126 and N=184 are proper magic numbers. • Elements are generated by low energy nuclear reactions in deuterium loaded metal. • Postulated from measured distribution that a compound nucleus 310 X 126 was formed. • Formation of 164 deuterons in Bose–Einstein state clusters with 2 pm spacing

All-clear for gourmets: truffles not radioactive

Czech Academy of Sciences Publication Activity Database

Büntgen, Ulf; Jäggi, M.; Stobbe, U.; Tegel, W.; Sproll, L.; Eikenberg, J.; Egli, S.

2016-01-01

Roč. 13, č. 4 (2016), s. 1145-1147 ISSN 1726-4170 Institutional support: RVO:67179843 Keywords : Basidiomycota * Tuber (truffle) * Tuber aestivum * Tuber uncinatum Subject RIV: EH - Ecology, Behaviour Impact factor: 3.851, year: 2016 http://www.biogeosciences.net/13/1145/2016/bg-13-1145-2016.pdf

Sea surface temperature estimates for the mid-Piacenzian Indian Ocean—Ocean Drilling Program sites 709, 716, 722, 754, 757, 758, and 763

Science.gov (United States)

Robinson, Marci M.; Dowsett, Harry J.; Stoll, Danielle K.

2018-01-30

Despite the wealth of global paleoclimate data available for the warm period in the middle of the Piacenzian Stage of the Pliocene Epoch (about 3.3 to 3.0 million years ago [Ma]; Dowsett and others, 2013, and references therein), the Indian Ocean has remained a region of sparse geographic coverage in terms of microfossil analysis. In an effort to characterize the surface Indian Ocean during this interval, we examined the planktic foraminifera from Ocean Drilling Program (ODP) sites 709, 716, 722, 754, 757, 758, and 763, encompassing a wide range of oceanographic conditions. We quantitatively analyzed the data for sea surface temperature (SST) estimation using both the modern analog technique (MAT) and a factor analytic transfer function. The data will contribute to the U.S. Geological Survey (USGS) Pliocene Research, Interpretation and Synoptic Mapping (PRISM) Project’s global SST reconstruction and climate model SST boundary condition for the mid-Piacenzian and will become part of the PRISM verification dataset designed to ground-truth Pliocene climate model simulations (Dowsett and others, 2013).

Ozone depletion potentials of halocarbons

International Nuclear Information System (INIS)

Karol, I.L.; Kiselev, A.A.

1992-01-01

The concept of ozone depletion potential (ODP) is widely used in the evaluation of numerous halocarbons and of their replacements for effects on ozone, but the methods, model assumptions and conditions of ODP calculation have not been analyzed adequately. In this paper, a model study of effects on ozone after the instantaneous releases of various amounts of CH 3 CCl 3 and of CHF 2 Cl(HCFC-22) in the several conditions of the background atmosphere are presented, aimed to understand the main connections of ODP values with the methods of their calculations. To facilitate the ODP computation in numerous versions for long after the releases, the above rather short-lived gases have been used. The variation of released gas global mass from 1 Mt to 1 Gt leads to ODP value increase atmosphere. The same variations are analyzed for the CFC-free atmosphere of 1960s conditions for the anthropogenically loaded atmosphere in the 21st century according to the known IPCC- A scenario (business as usual). Recommendations of proper ways of ODP calculations are proposed for practically important cases

Effect of cutting height and time on seed yield and seed quality of Stylosanthes guianensis CIAT 184

OpenAIRE

Pimpaporn Pholsen; Chureerat Satjipanon; Krailas Kiyothong

2002-01-01

The objectives of this experiment were to study the effect of cutting height and time on seed yield and seed quality of Stylosanthes guianensis CIAT 184 in Korat soil series at Khon Kaen Animal Nutrition Research Center, during April 2000 - May 2001. The experimental design was 2 × 4 factorial in randomized complete block design with 4 replications. The treatment consisted of 2 factors: - 1) Two levels of cutting height viz. 20 and 30 cm above ground; 2) Four periods of cutting time viz. at 6...

Evaluación del establecimiento de una colección de accesiones de Brachiaria brizantha asociadas con Stylosanthes guianensis CIAT-184 Evaluation of the establishment of a collection of Brachiaria brizantha accessions associated to Stylosanthes guianensis CIAT-184

Directory of Open Access Journals (Sweden)

Yuseika Olivera

2012-06-01

Full Text Available En un suelo ácido (pH ~ 4,9, de baja fertilidad, se estudió una colección de 20 accesiones de Brachiaria brizantha asociadas a Stylosanthes guianensis CIAT-184, con el objetivo de evaluar su comportamiento agronómico durante la etapa de establecimiento. Se utilizaron parcelas de 5 x 4 m, con tres réplicas. Los indicadores medidos y/o estimados fueron: el porcentaje de supervivencia (15, 30 y 45 días, la altura de la planta, la abundancia de hojas, el vigor, las afectaciones provocadas por las plagas y la infestación por enfermedades. Para la interpretación de los resultados se utilizó el análisis de componentes principales. En los primeros 45 días las accesiones CIAT-16317, CIAT-26032, CIAT-16485 y el cv. Mulato alcanzaron los mejores índices de supervivencia (por encima del 90%. Después de los 45 días se detectó una alta variabilidad (90,30% para las dos primeras componentes. Al agrupar las accesiones se identificó la formación de siete grupos, en algunos de los cuales predominaron individuos de porte alto, y en otros, plantas con buen vigor y hojosidad. De manera general, se puede concluir que hubo un comportamiento aceptable de la asociación entre las accesiones de B. brizantha y S. guianensis CIAT-184, ya que todas en mayor o menor medida cumplimentaron la etapa de establecimiento. Se destacaron las accesiones de los grupos IV, V y VII, ya que mostraron resultados positivos (por encima de la media en dos indicadores de los tres estimados. Se recomienda dar continuidad a la evaluación de la fase de explotación de este germoplasma con animales, de manera tal que sea posible, en el futuro mediato, seleccionar las accesiones más sobresalientes durante todo el periodo experimental.On a low-fertility, acid soil (pH ~ 4,9, a collection of 20 Brachiaria brizantha accessions associated to Stylosanthes guianensis CIAT-184 was studied, in order to evaluate its agronomic performance during the establishment stage. For such purpose

Structural characteristics of the acquired optic disc pit and the rate of progressive retinal nerve fiber layer thinning in primary open-angle glaucoma.

Science.gov (United States)

Lee, Seung Hyen; Lee, Eun Ji; Kim, Tae-Woo

2015-10-01

The optic disc pit (ODP) has been considered a region of localized susceptibility to the damage of glaucoma. To determine whether the rate of retinal nerve fiber layer (RNFL) thinning differs according to the presence and structural characteristics of an ODP in primary open-angle glaucoma. We performed a prospective case-control study that included 163 eyes with primary open-angle glaucoma (83 with an ODP and 80 without an ODP) from Glaucoma Clinic of Seoul National University Bundang Hospital. Participants were enrolled from the ongoing Investigating Glaucoma Progression Study from January 1, 2012, through May 31, 2014. Mean (SD) follow-up was 3.32 (0.49) years (through May 31, 2014). Optic nerve heads underwent swept-source optical coherence tomography (OCT) to determine the presence of focal lamina cribrosa alteration and its structural characteristics. Eyes with and without photographic ODPs and corresponding microscopic laminar alterations were assigned to the ODP and non-ODP groups, respectively. The rates of progressive thinning of global and 6 sectoral spectral-domain OCT RNFL thicknesses were determined by linear regression and compared between the 2 groups. We used a general linear model to determine the factors associated with the rate of RNFL thinning; data obtained from September 21, 2009, through May 31, 2014, were used to calculate the rate of RNFL thinning. The relationship between the presence and structural characteristics of ODPs and the rate of progressive OCT RNFL thinning. Thinning of the RNFL was faster in the ODP group than in the non-ODP group in the global (mean [SD], -1.44 [1.31] vs -0.93 [1.10] [95% CI, -0.97 to -0.19] μm/y; P = .008), temporoinferior (mean [SD], -4.17 [4.15] vs -1.97 [3.26] [95% CI, -3.36 to -1.04] μm/y; P < .001), and temporal (mean [SD], -1.92 [2.62] vs -0.89 [1.62] [95% CI, -1.70 to -0.35] μm/y; P = .003) sectors. The rate of RNFL thinning was maximum in the temporoinferior sector (mean [SD], -4

Deep water dissolution in Marine Isotope Stage 3 from the northern South China Sea

Science.gov (United States)

Huang, B.

2015-12-01

The production, transport, deposition, and dissolution of carbonate profoundly implicate the global carbon cycle affect the inventory and distribution of dissolved organic carbon (DIC) and alkalinity (ALK), which drive atmospheric CO2 change on glacial-interglacial timescale. the process may provide significant clues for improved understanding of the mechanisms that control the global climate system. In this study, we calculate and analyze the foraminiferal dissolution index (FDX) and the fragmentation ratios of planktonic foraminifera over 60-25 ka based on samples from 17924 and ODP 1144 in the northeastern South China Sea (SCS) to reconstruct the deep water carbonate dissolution during Marine Isotope Stage 3 (MIS 3). Result shows that the dissolution of carbonate increases gradually at 17924 but keeps stable at ODP 1144. The changes of FDX coincidence with that of fragmentation ratios at 17924 and ODP 1144 suggest both indexes can be used as reliable dissolving proxies of planktonic foraminifera. Comparing FDX and fragmentation ratios at both sites, we find the FDX and fragmentation ratios at 17924 are higher than those at 1144, indicating that carbonate dissolution is intenser in 17924 core during MIS 3. The increasing total percentage of both N. dutertrei and G. bulloides during MIS 3 reveals the rising primary productivity that may lead to deep water [CO32-] decrease. The slow down of thermohaline circulation may increase deep water residence time and accelerate carbonate dissolution. In addition, the covering of ice caps, iron supply and increased surface-water stratification also contribute to atmosphere CO2 depletion and [CO32-] decrease in deep water. In the meanwhile, regression result from colder temperature increases the input of ALK and DIC to the deep ocean and deepens the carbonate saturation depth, which makes the deep water [CO32-] rise. In ODP Site 1144, the decrease in [CO32-] caused by more CO2 restored in deep water is equal to the increase in

Pathogenicity and transmission of triple reassortant H3N2 swine influenza A viruses is attenuated following Turkey embryo propagation.

Science.gov (United States)

Raghunath, Shobana; Pudupakam, Raghavendra Sumanth; Deventhiran, Jagadeeswaran; Tevatia, Rahul; Leroith, Tanya

2017-03-01

Genetic lineages of swine influenza A viruses (SIVs) have recently been established in Turkeys in the United States. To identify molecular determinants that are involved in virulence and transmission of SIVs to Turkeys, we sequentially passaged two triple reassortant H3N2 SIV isolates from Minnesota in ten day old specific-pathogen free (SPF) Turkey embryos and tested them in seven-day old Turkey poults. We found that SIV replication in Turkey embryos led to minimal mutations in and around the receptor binding and antigenic sites of the HA molecule, while other gene segments were unchanged. The predominant changes associated with Turkey embryo passage were A223V, V226A and T248I mutations in the receptor-binding and glycosylation sites of the HA molecule. Furthermore, Turkey embryo propagation altered receptor specificity in SIV strain 07-1145. Embryo passaged 07-1145 virus showed a decrease in α2, 6 sialic acid receptor binding compared to the wild type virus. Intranasal infection of wild type SIVs in one-week-old Turkey poults resulted in persistent diarrhea and all the infected birds seroconverted at ten days post infection. The 07-1145 wild type virus also transmitted to age matched in-contact birds introduced one-day post infection. Turkeys infected with embryo passaged viruses displayed no clinical signs and were not transmitted to in-contact poults. Our results suggest that Turkey embryo propagation attenuates recent TR SIVs for infectivity and transmission in one week old Turkeys. Our findings will have important implications in identifying molecular determinants that control the transmission and virulence of TR SIVs in Turkeys and other species. Copyright © 2017 Elsevier B.V. All rights reserved.

CT-guided marking of pulmonary nodules with a special lung marking wire before video-assisted thoracoscopic surgery. Review of 184 cases; CT-gestuetzte Drahtmarkierung vor videoassistierter thorakoskopischer OP von pulmonalen Rundherden. Eine Auswertung von 184 Faellen

Energy Technology Data Exchange (ETDEWEB)

Schulze, M.K.; Eichfeld, U.; Kahn, T.; Stumpp, P. [Universitaetsklinikum Leipzig AoeR (Germany). Klinik und Poliklinik fuer Diagnostische und Interventionelle Radiologie

2012-06-15

Purpose: Minimally invasive techniques like video-assisted thoracoscopic surgery (VATS) are currently the method of choice for the resection of small pulmonary nodules, when they are located in the periphery of the lungs. To guarantee quick and safe intraoperative identification of the nodule, preoperative marking is necessary and sensible. We report about our experiences in 184 markings with a special lung marking wire, which is placed in or around the pulmonary nodule using CT guidance. Materials and Methods: In 184 patients (97 m, 87f, mean age: 58.1 {+-} 13.7 years) with pulmonary nodules, scheduled for resection with VATS, a special lung marking wire was placed preoperatively under CT guidance. We evaluated the technical success, safety, necessity of conversion to thoracotomy and histology in all patients. Results: The marking wire could be positioned successfully in 181 cases (98.4 %). There was one major complication (uncontrollable pneumothorax). Minor adverse events like small pneumothorax (53.3 %) or a perifocal bleeding (30.4 %) did not necessitate treatment. Complete resection of the marked nodule was successful in 98.4 % of the patients. Conversion to thoracotomy was necessary in 29 patients (15.9 %) due to bleeding, adhesions, malignancy or wire dislocation. Histology revealed a benign nodule in 96 cases (54.4 %) and a malignant lesion in 78 cases (45.6 %), of which only 21 nodules (11.5 %) turned out to present a primary pulmonary carcinoma. Conclusion: CT-guided marking of pulmonary nodules using a special marking wire followed by thoracoscopic resection is an efficient and safe method for diagnosing suspicious nodules in the periphery of the lung. (orig.)

18.4%-Efficient Heterojunction Si Solar Cells Using Optimized ITO/Top Electrode.

Science.gov (United States)

Kim, Namwoo; Um, Han-Don; Choi, Inwoo; Kim, Ka-Hyun; Seo, Kwanyong

2016-05-11

We optimize the thickness of a transparent conducting oxide (TCO) layer, and apply a microscale mesh-pattern metal electrode for high-efficiency a-Si/c-Si heterojunction solar cells. A solar cell equipped with the proposed microgrid metal electrode demonstrates a high short-circuit current density (JSC) of 40.1 mA/cm(2), and achieves a high efficiency of 18.4% with an open-circuit voltage (VOC) of 618 mV and a fill factor (FF) of 74.1% as result of the shortened carrier path length and the decreased electrode area of the microgrid metal electrode. Furthermore, by optimizing the process sequence for electrode formation, we are able to effectively restore the reduction in VOC that occurs during the microgrid metal electrode formation process. This work is expected to become a fundamental study that can effectively improve current loss in a-Si/c-Si heterojunction solar cells through the optimization of transparent and metal electrodes.

Nucleus Z=126 with magic neutron number N=184 may be related to the measured Maruhn-Greiner maximum at A/2=155 from compound nuclei at low energy nuclear reactions

Science.gov (United States)

Prelas, M. A.; Hora, H.; Miley, G. H.

2014-07-01

Evaluation of nuclear binding energies from theory close to available measurements of a very high number of superheavy elements (SHE) based on α-decay energies Qα, arrived at a closing shell with a significant neutron number 184. Within the option of several discussed magic numbers for protons of around 120, Bagge's numbers 126 and 184 fit well and are supported by the element generation measurements by low energy nuclear reactions (LENR) discovered in deuterium loaded host metals. These measurements were showing a Maruhn-Greiner maximum from fission of compound nuclei in an excited state with double magic numbers for mutual confirmation.

Glycosylation of the N-terminal potential N-glycosylation sites in the human α1,3-fucosyltransferase V and -VI (hFucTV and -VI)

DEFF Research Database (Denmark)

Christensen, Lise Lotte; Bross, Peter Gerd; Ørntoft, Torben Falck

2000-01-01

Human alpha1,3-fucosyltransferase V and -VI (hFucTV and -VI) each contain four potential N-glycosylation sites (hFucTV: Asn60, Asn105, Asn167 and Asn198 and hFucTVI: Asn46, Asn91, Asn153 and Asn184). Glycosylation of the two N-terminal potential N-glycosylation sites (hFucTV: Asn60, Asn105 and h......FucTVI: Asn46 and Asn91) have never been studied in detail. In the present study, we have analysed the glycosylation of these potential N-glycosylation sites. Initially, we compared the molecular mass of hFucTV and -VI expressed in COS-7 cells treated with tunicamycin with the mass of the proteins...... in untreated cells. The difference in molecular mass between the proteins in treated and untreated cells corresponded to the presence of at least three N-linked glycans. We then made a series of mutants, in which the asparagine residues in the N-terminal potential N-glycosylation sites were replaced...

14 CFR 11.45 - Where and when do I file my comments?

Science.gov (United States)

2010-01-01

... you do not follow the electronic filing instructions at the Federal Docket Management System Web site... do I file my comments? (a) Send your comments to the location specified in the rulemaking document on which you are commenting. If you are asked to send your comments to the Federal Document Management...

Possible world-wide middle miocene iridium anomaly and its relationship to periodicity of impacts and extinctions

Science.gov (United States)

Asaro, F.; Alvarez, W.; Michel, H. V.; Alvarez, L. W.; Anders, Mark H.; Montanari, A.; Kennett, James P.

1988-01-01

In a study of one million years of Middle Miocene sediment deposition in ODP Hole 689B in the Weddell Sea near Antarctica, a single iridium (Ir) anomaly of 44 (+ or - 10) x 10 to the 12th gram Ir per gram rock (ppt) was observed in core 6H, section 3, 50 to 60 cm, after background contributions associated with manganese precipitates and clay are subtracted. The ODP Hole 689B is 10,000 km away from another site, DSDP Hole 588B in the Tasman Sea north of New Zealand, where a single Ir anomaly of 144 + or - 7 ppt over a background of 11 ppt was found in an earlier study of 3 million years of deposition. From chemical measurements the latter deposition was thought to be impact-related. Ir measurements were made, following neutron activation, with the Iridium Coincidence Spectrometer. The age vs depth calibration curves given in the DSDP and ODP preliminary reports indicate the ages of the Iranomalies are identical, 11.7 million years, but the absolute and relative uncertainties in the curves are not known. Based on the newest age data the age estimate is 10 million years. As the Ir was deposited at the two sites at about the same time and they are one quarter of the way around the world from each other it seems likely that the deposition was world-wide. The impact of a large asteroid or comet could produce the wide distribution, and this data is supportive of the impact relationship deduced for Deep Sea Drilling Project (DSDP) 588B from the chemical evidence. If the surface densities of Ir at the two sites are representative of the world-wide average, the diameter of a Cl type asteroid containing the necessary Ir would be 3 + or - 1 km, which is large enough to cause world-wide darkness and hence extinctions although the latter point is disputed.

Atypical delta N-15 variations at the southern boundary of the East Pacific oxygen minimum zone over the last 50 ka

OpenAIRE

P. Martinez; F. Lamy; R. R. Robinson; L. Pichevin; I. Billy;  

2006-01-01

We report a nitrogen isotope record (ODP Site 1233) from the southern Chile margin at 41�S. The site is located slightly south of the southern boundary of the Peru�Chile upwelling system and the associated oxygen minimum zone off Peru and northern Chile. We show that our nitrogen isotope record, from the time interval 0�50 calendar kiloyears before present (ka B.P.), bears an atypical pattern both in shape and timing when compared with records obtained from either the continental margin...

Characterization of linear alkyl phosphonate self-assembled on perovskite substrate

Science.gov (United States)

Lazauskas, A.; Baltrusaitis, J.; Grigaliūnas, V.; Prosyčevas, I.

2015-07-01

In recent years, functional material surface functionalization has grown into an expanding area of research due to the development and design of advanced systems and devices for key areas in biotechnology, smart sensing, environmental applications and manufacturing. In this work, NdNiO3 surface was functionalized with octadecylphosphonic acid (ODP) using liquid phase reaction to attain superhydrophobic properties. The resulting ODP modified surface exhibited dual-scale roughness with a stable static contact angle of 170 ± 2°. Electron microscopy micrographs of ODP crystals formed revealed a non-uniform lateral growth characteristics. The presence of ODP hydrocarbon chains was confirmed using Fourier transform infrared spectroscopy with characteristic peaks at 2924 cm-1 and 2851 cm-1.

Mercury in Nelson's Sparrow subspecies at breeding sites.

Directory of Open Access Journals (Sweden)

Virginia L Winder

Full Text Available BACKGROUND: Mercury is a persistent, biomagnifying contaminant that can cause negative effects on ecosystems. Marshes are often areas of relatively high mercury methylation and bioaccumulation. Nelson's Sparrows (Ammodramus nelsoni use marsh habitats year-round and have been documented to exhibit tissue mercury concentrations that exceed negative effects thresholds. We sought to further characterize the potential risk of Nelson's Sparrows to mercury exposure by sampling individuals from sites within the range of each of its subspecies. METHODOLOGY/PRINCIPAL FINDINGS: From 2009 to 2011, we captured adult Nelson's Sparrows at sites within the breeding range of each subspecies (A. n. nelsoni: Grand Forks and Upham, North Dakota; A. n. alterus: Moosonee, Ontario; and A. n. subvirgatus: Grand Manan Island, New Brunswick and sampled breast feathers, the first primary feather (P1, and blood for total mercury analysis. Mean blood mercury in nelsoni individuals captured near Grand Forks ranged from 0.84 ± 0.37 to 1.65 ± 1.02 SD ppm among years, between 2.0 and 4.9 times as high as concentrations at the other sites (P<0.01. Breast feather mercury did not vary among sites within a given sampling year (site means ranged from 0.98 ± 0.69 to 2.71 ± 2.93 ppm. Mean P1 mercury in alterus (2.96 ± 1.84 ppm fw was significantly lower than in any other sampled population (5.25 ± 2.24-6.77 ± 3.51 ppm; P ≤ 0.03. CONCLUSIONS/SIGNIFICANCE: Our study further characterized mercury in Nelson's Sparrows near Grand Forks; we documented localized and potentially harmful mercury concentrations, indicating that this area may represent a biological mercury hotspot. This finding warrants further research to determine if wildlife populations of conservation or recreational interest in this area may be experiencing negative effects due to mercury exposure. We present preliminary conclusions about the risk of each sampled population to mercury exposure.

Mercury in Nelson's Sparrow Subspecies at Breeding Sites

Science.gov (United States)

Winder, Virginia L.; Emslie, Steven D.

2012-01-01

Background Mercury is a persistent, biomagnifying contaminant that can cause negative effects on ecosystems. Marshes are often areas of relatively high mercury methylation and bioaccumulation. Nelson's Sparrows (Ammodramus nelsoni) use marsh habitats year-round and have been documented to exhibit tissue mercury concentrations that exceed negative effects thresholds. We sought to further characterize the potential risk of Nelson's Sparrows to mercury exposure by sampling individuals from sites within the range of each of its subspecies. Methodology/Principal Findings From 2009 to 2011, we captured adult Nelson's Sparrows at sites within the breeding range of each subspecies (A. n. nelsoni: Grand Forks and Upham, North Dakota; A. n. alterus: Moosonee, Ontario; and A. n. subvirgatus: Grand Manan Island, New Brunswick) and sampled breast feathers, the first primary feather (P1), and blood for total mercury analysis. Mean blood mercury in nelsoni individuals captured near Grand Forks ranged from 0.84±0.37 to 1.65±1.02 SD ppm among years, between 2.0 and 4.9 times as high as concentrations at the other sites (Pmercury did not vary among sites within a given sampling year (site means ranged from 0.98±0.69 to 2.71±2.93 ppm). Mean P1 mercury in alterus (2.96±1.84 ppm fw) was significantly lower than in any other sampled population (5.25±2.24–6.77±3.51 ppm; P≤0.03). Conclusions/Significance Our study further characterized mercury in Nelson's Sparrows near Grand Forks; we documented localized and potentially harmful mercury concentrations, indicating that this area may represent a biological mercury hotspot. This finding warrants further research to determine if wildlife populations of conservation or recreational interest in this area may be experiencing negative effects due to mercury exposure. We present preliminary conclusions about the risk of each sampled population to mercury exposure. PMID:22384194

Shape effects in the vicinity of the Z=82 line: study of the $\\beta$-decay of $^{182,184,186}$Hg

CERN Multimedia

This proposal is aimed at the study of the $\\beta$-decay of the neutron-­deficient $^{182,184,186}$Hg nuclei using the total absorption technique. Recent theoretical results show that, from measurements of the Gamow-­Teller strength distribution, the shapes of the ground states of the decaying Hg nuclei can be inferred. This study offers an independent way to study the phenomenon of shape coexistence in a region of particular interest.

Nankai Stress History and Implications for an Overpressured Decollement

Science.gov (United States)

Moran, K.; O'Regan, M.

2005-12-01

The Nankai Trough, formed from the subduction of the Shikoku Basin beneath the island arc of southwestern Japan, is a relatively young accretionary complex converging at a rate of ~4 cm/yr [Shipboard Scientific Party, 2001a]. The region was studied during the Deep Sea Drilling Project and on three Ocean Drilling Program (ODP) Legs-131, 190 and 196. Three sites visited during these Legs form a single cross-margin transect (dubbed the Muroto Transect) that traverses the leading edge of the Nankai accretionary prism, from seaward of the deformation front at Site 1173, to close to the deformation front (Site 1174), and landward to the first frontal thrust (Site 808). The decollement, which forms the major boundary between the converging plates, occurs within the Lower Shikoku Basin stratigraphic unit. The ODP sites were drilled and cored to depths below the decollement (Sites 808 and 1174) and the proto-decollement (Site 1173). Here we present consolidation test results [Moran et al., 1993] that are consistent with porosity-depth functions from core and log measurements for the Lower Shikoku Basin sediments, assuming that the decollement is an overpressured seal. At 1173, where a true decollement has not yet formed, moderate fluid overpressures occur that can be fully attributed to high turbiditic sedimentation rates. Forward modeling of this site into the deformation front over a period of ~300 ky shows that the present 1173 porosity-depth function matches the porosity-depth function at 1174. These results suggest that the young decollement on the Muroto Transect at the deformation front and landward is highly overpressured and forms a seal to sediments below that can be classically modeled as a one-dimensional consolidation system.

Preparation of {sup 183,184}Re samples for modelling a rapid gas phase chemistry of Nielsbohrium (Ns), element 107

Energy Technology Data Exchange (ETDEWEB)

Eichler, R.; Gaeggeler, H.W.; Eichler, B.; Tuerler, A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

1997-09-01

Chemical gas phase reactions of the heavier group 7 elements in the system O{sub 2}/H{sub 2}O are presumably best suited for a separation of Nielsbohrium from the lighter transactinides. We expect a higher reaction velocity using the more reactive gas system O{sub 3}/H{sub 2}O{sub 2}. For the experimental verification of this idea we prepared {sup 183}Re/{sup 184}Re samples for thermochromatography experiments with both gas systems. (author) 8 refs.

A Low-Temperature Electron Microscopy and Electron Diffraction Study of La1.84Sr0.16CuO4

Science.gov (United States)

Onozuka, Takashi; Omori, Mamoru; Hirabayashi, Makoto; Syono, Yasuhiko

1987-10-01

A high-Tc superconducting compound, La1.84Sr0.16CuO4, has been investigated by electron microscopy and electron diffraction in the range from 10 K to ambient temperature. The tetragonal K2NiF4-type structure undergoes an orthorhombic distortion below about 130 K. In the low-temperature phase, extra diffraction spots and twin lamellae are observed reversibly on cooling and heating in situ. Based on the observed results, a plausible structure model with orthorhombic distortion is proposed.

Mid-Piacenzian Variability of Nordic Seas Surface Circulation Linked to Terrestrial Climatic Change in Norway

Science.gov (United States)

Panitz, Sina; De Schepper, Stijn; Salzmann, Ulrich; Bachem, Paul E.; Risebrobakken, Bjørg; Clotten, Caroline; Hocking, Emma P.

2017-12-01

During the mid-Piacenzian, Nordic Seas sea surface temperatures (SSTs) were higher than today. While SSTs provide crucial climatic information, on their own they do not allow a reconstruction of potential underlying changes in water masses and currents. A new dinoflagellate cyst record for Ocean Drilling Program (ODP) Site 642 is presented to evaluate changes in northward heat transport via the Norwegian Atlantic Current (NwAC) between 3.320 and 3.137 Ma. The record is compared with vegetation and SST reconstructions from Site 642 and SSTs from Iceland Sea ODP Site 907 to identify links between SSTs, ocean currents, and vegetation changes. The dinocyst record shows that strong Atlantic water influence via the NwAC corresponds to higher-than-present SSTs and cool temperate vegetation during Marine Isotope Stage (MIS) transition M2-M1 and KM5. Reduced Atlantic water inflow relative to the warm stages coincides with near-modern SSTs and boreal vegetation during MIS M2, KM6, and KM4-KM2. During most of the studied interval, a strong SST gradient between Sites 642 and 907 indicates the presence of a proto-Arctic Front (AF). An absent gradient during the first half of MIS KM6, due to reduced Atlantic water influence at Site 642 and warm, presumably Atlantic water reaching Site 907, is indicative of a weakened NwAC and East Greenland Current. We conclude that repeated changes in Atlantic water influence directly affect terrestrial climate and that an active NwAC is needed for an AF to develop. Obliquity forcing may have played a role, but the correlation is not consistent.

Laparoscopic versus open distal pancreatectomy for nonfunctioning pancreatic neuroendocrine tumors: a large single-center study.

Science.gov (United States)

Han, Sang Hyup; Han, In Woong; Heo, Jin Seok; Choi, Seong Ho; Choi, Dong Wook; Han, Sunjong; You, Yung Hun

2018-01-01

Pancreatic neuroendocrine tumors (PNETs) account for 1-2% of all pancreatic neoplasms. Nonfunctioning PNETs (NF-PNETs) account for 60-90% of all PNETs. Laparoscopic distal pancreatectomy (LDP) is becoming the treatment of choice for benign lesions in the body and tail of the pancreas. However, LDP has not yet been widely accepted as the gold standard for NF-PNETs. The purpose of this study is to evaluate the clinical and oncologic outcomes after laparoscopic versus open distal pancreatectomy (ODP) for NF-PNETs. Between April 1995 and September 2016, 94 patients with NF-PNETs underwent open or laparoscopic distal pancreatectomy at Samsung Medical Center. Patients were divided into two groups: those who underwent LDP and those who underwent ODP. Both groups were compared in terms of clinical and oncologic variables. LDP patients had a significantly shorter hospital stay compared with ODP patients, amounting to a mean difference of 2 days (p < 0.001). Overall complication rates did not differ significantly between the ODP and LDP groups (p = 0.379). The 3-year overall survival rates in the ODP and LDP groups were 93.7 and 100%, respectively (p = 0.069). In this study, LDP for NF-PNETs had similar oncologic outcomes compared with ODP. In addition, LDP was associated with a shorter hospital stay compared with ODP. Therefore, LDP is a safe and effective procedure for patients with NF-PNETs. A multicenter study and a randomized controlled trial are needed to better assess the clinical and oncologic outcomes.

Three-dimensional structure of the large cytoplasmic H-4-H-5 loop of Na(+)/K(+)-ATPase deduced by restraint-based comparative modeling shows only one ATP binding site

Czech Academy of Sciences Publication Activity Database

Ettrich, Rüdiger; Melicherčík, M.; Teisinger, Jan; Ettrichová, Olga; Krumscheid, R.; Hofbauerová, Kateřina; Kvasnička, P.; Schoner, W.; Amler, Evžen

2001-01-01

Roč. 7, č. 6 (2001), s. 184-192 ISSN 0948-5023 R&D Projects: GA MŠk VS961410; GA ČR GA204/98/0468; GA AV ČR IAA7011801; GA ČR GA204/98/0416 Grant - others:IWTZ(DE) TSR-088-97; Volkswagen Foundation(DE) I/74679 Institutional research plan: CEZ:AV0Z5011922 Keywords : Sodium potassium adenosine triphosphate * tertiary structure * adenosine triphosphate binding site Subject RIV: BO - Biophysics Impact factor: 1.011, year: 2001

A low-temperature electron microscopy and electron diffraction study of La1.84Sr0.16CuO4

International Nuclear Information System (INIS)

Onozuka, Takashi; Omori, Mamoru; Hirabayashi, Makoto; Syono, Yasuhiko

1987-01-01

A high-T c superconducting compound, La 1.84 Sr 0.16 CuO 4 , has been investigated by electron microscopy and electron diffraction in the range from 10 K to ambient temperature. The tetragonal K 2 NiF 4 -type structure undergoes an orthorhombic distortion below about 130 K. In the low-temperature phase, extra diffraction spots and twin lamellae are observed reversibly on cooling and heating in situ. Based on the observed results, a plausible structure model with orthorhombic distortion is proposed. (author)

Astrochronology of a Late Oligocene to Early Miocene Magnetostratigraphy from the Northwest Atlantic

Science.gov (United States)

van Peer, T. E.; Xuan, C.; Liebrand, D.; Lippert, P. C.; Wilson, P. A.

2016-12-01

The Oligocene-Miocene Boundary is defined by the geomagnetic polarity reversal C6Cn.2n/C6Cn.2r with an astronomically tuned age of 23 Ma. For late Oligocene to early Miocene reversals, only a few records (mainly from the equatorial Pacific and South Atlantic) integrate magneto- and cyclo-stratigraphy with astronomical tuning. Reversal ages acquired from these records show differences up to 100 kyr. We report new astronomically tuned ages for reversals between 21-26.5 Ma, based on integrated palaeomagnetic and X-Ray Fluorescence (XRF) data from rapidly accumulated drift sediments (mean sedimentation rate of 2.5 cm/kyr) at Integrated Ocean Drilling Program (IODP) Site U1406 (northwest Atlantic). The natural remanence preserved in the sediments is relatively weak (especially at high demagnetisation steps) and prone to influence from measurement noise. We introduce an optimisation protocol to improve the estimation of component directions used to define the reversals. For each 1-cm interval measurement, the protocol searches for the combination of a fixed number of steps of demagnetisation data that minimises the maximum angular deviation, statistically excluding the noisy measurement steps. For the tuning, we use the logarithm of the calcium over potassium ratio ln(Ca/K) from XRF core scanning data, a proxy of carbonate content in the sediment. Spectral and wavelet analyses of the 140-m long ln(Ca/K) record highlight dominant obliquity (including the 178 and 1200 kyr modulation) and additional eccentricity forcing. Supported by preliminary stable isotope analysis on benthic foraminifera, we tuned ln(Ca/K) minima to obliquity minima and eccentricity maxima. The resulting age model yield new independent ages for all reversals between C6Ar/C6AAn to C8r/C9n. Our results are generally consistent (within an obliquity cycle) with the Ocean Drilling Program (ODP) Site 1090 age model [Billups et al., 2004], but deviate up to 80 kyr relative to ODP Site 1218 [Pälike et al

Detection and quantification of proviral HIV-1 184 M/V in circulating CD4(+) T cells of patients on HAART with a viremia less than 1000 copies/ml

DEFF Research Database (Denmark)

Mohey, Rajesh; Jørgensen, Anne Louise; Møller, Bjarne K

2005-01-01

and incorporation of resistant forms in the long-lived CD4+ T cellular DNA compartment is not clear. Objective To investigate the relationship between lamivudine associated mutant-type 184V and the wild-type 184M proviral forms in the circulating CD4+ T cells of patients and low-level viremia. Study design Cross-sectional......Background Highly active anti-retroviral therapy (HAART) effectively reduces HIV replication but does not completely hinder it. Sub-optimal therapy leads to HIV resistance to the drugs administered. However, the role of low-level viremia (viral-load less than 1000 copies/ml) on mutation genesis...... study of 50 patients on long-term HAART, with a viremia of less than 1000 copies/ml. Patients were stratified into three groups; on lamivudine, group I (viral load

The Gravettian on the Middle Danube

Czech Academy of Sciences Publication Activity Database

Svoboda, Jiří

2007-01-01

Roč. 19, - (2007), s. 203-220 ISSN 1145-3370. [Gravettien: entités régionales d'une paléoculture européenne. Les Eyzies, 00.07.2004] R&D Projects: GA ČR GA404/06/0055 Institutional research plan: CEZ:AV0Z80010507 Keywords : Gravettian * Ahmarian * Pavlov ian * Willendorf-Kostenkian * Kašovian * settlement analysis * burial site analysis Subject RIV: AC - Archeology, Anthropology, Ethnology

Hydrothermal fluid composition at Middle Valley, Northern Juan de Fuca Ridge: Temporal and spatial variability

Science.gov (United States)

Cruse, Anna M.; Seewald, Jeffrey S.; Saccocia, Peter J.; Zierenberg, Robert

Hydrothermal fluids were collected in July 2000 from the Dead Dog and Ore Drilling Program (ODP) Mound vent fields at Middle Valley, a sediment-covered spreading center on the northern Juan de Fuca Ridge. Measured fluid temperatures varied from 187° to 281°C in focused flow vents and 40°C in ODP Hole 1035F. Cl concentrations indicate that ODP Mound fluids undergo phase separation in the subsurface, whereas Dead Dog fluids do not. The lack of phase separation at Dead Dog is consistent with other geochemical indicators of lower subsurface temperatures. Cooling and equilibration with quartz after phase separation at the ODP Mound results in exit temperatures and silica concentrations that are indistinguishable from those at Dead Dog. The sulfur isotopic composition of aqueous ΣH2S indicates extensive reduction of seawater SO4 and leaching of basaltic sulfur at both areas. A new area of venting, which resulted from drilling operations during ODP Leg 169, was discovered on the eastern side of the ODP Mound. The fluids in the new area have compositions that are similar to those of Hole 1035H and Shiner Bock, except for lower H2 and higher H2S concentrations. These differences reflect the conversion of pyrite to pyrrhotite in the ODP Mound as fluids react with sulfide minerals during upflow. Fluid temperatures and compositions have remained constant between 1990 and 2000 indicating that subsurface reaction zone conditions did not change over this period. Near constant concentrations of sediment-derived mobile trace elements suggest that the residence time of fluids in a high-temperature reservoir exceeds 10 years.

Effects of Mechanical Site Preparation on Growth of Oaks Planted on Former Agricultural Fields

Directory of Open Access Journals (Sweden)

John D. Hodges

2011-12-01

Full Text Available Mechanical site preparation is frequently proposed to alleviate problematic soil conditions when afforesting retired agricultural fields. Without management of soil problems, any seedlings planted in these areas may exhibit poor growth and survival. While mechanical site preparation methods currently employed in hardwood afforestation are proven, there is a substantial void in research comparing subsoiling, bedding, and combination plowing treatments. A total of 4,320 bare-root Nuttall oak (Quercus texana Buckley, Shumard oak (Quercus shumardii Buckley, and swamp chestnut oak (Quercus michauxii Nutt. seedlings were planted in February 2008 on three Mississippi sites. All sites were of comparable soils and received above average precipitation throughout the three-year duration of the study. Four site preparation treatments were replicated at each site, with 480 seedlings planted in each of nine replications, and a total of 1,440 seedlings per species planted across all sites. Mechanical treatments were installed using 3.1 m row centers, with treatments as follows: control, subsoiling, bedding, and combination plowing. Treatment effects on seedling height, groundline diameter (GLD, and survival were analyzed. Seedlings exhibited greater height in bedded and combination plowed areas (79.7 cm to 102.7 cm and 82.6 cm to 100.1 cm, respectively compared to subsoiled or control areas (70.4 cm to 84.6 cm and 71.4 cm to 86.9 cm, respectively. Greater GLD was observed in bedded and combination plowed areas (11.9 mm to 18.4 mm and 12.2 mm to 18.3 mm, respectively compared to subsoiled or control areas (10.2 mm to 14.6 mm and 10.5 mm to 15.6 mm, respectively. Survival was high for this study (94.%, and no differences were detected among treatments.

Laparoscopic versus open distal pancreatectomy for pancreatic ductal adenocarcinoma: a single-center experience.

Science.gov (United States)

Zhang, Ai-Bin; Wang, Ye; Hu, Chen; Shen, Yan; Zheng, Shu-Sen

2017-06-01

The aim of this study was to compare complications and oncologic outcomes of patients undergoing laparoscopic distal pancreatectomy (LDP) and open distal pancreatectomy (ODP) at a single center. Distal pancreatectomies performed for pancreatic ductal adenocarcinoma during a 4-year period were included in this study. A retrospective analysis of a database of this cohort was conducted. Twenty-two patients underwent LDP for pancreatic ductal adenocarcinoma, in comparison to seventy-six patients with comparable tumor characteristics treated by ODP. No patients with locally advanced lesions were included in this study. Comparing LDP group to ODP group, there were no significant differences in operation time (P=0.06) or blood loss (P=0.24). Complications (pancreatic fistula, P=0.62; intra-abdominal abscess, P=0.44; postpancreatectomy hemorrhage, P=0.34) were similar. There were no significant differences in the number of lymph nodes harvested (11.2±4.6 in LDP group vs. 14.4±5.5 in ODP group, P=0.44) nor the rate of patients with positive lymph nodes (36% in LDP group vs. 41% in ODP group, P=0.71). Incidence of positive margins was similar (9% in LDP group vs. 13% in ODP group, P=0.61). The mean overall survival time was (29.6±3.7) months for the LDP group and (27.6±2.1) months for ODP group. There was no difference in overall survival between the two groups (P=0.34). LDP is a safe and effective treatment for selected patients with pancreatic ductal adenocarcinoma. A slow-compression of pancreas tissue with the GIA stapler is effective in preventing postoperative pancreatic fistula. The oncologic outcome is comparable with the conventional open approach. Laparoscopic radical antegrade modular pancreatosplenectomy contributed to oncological clearance.

Tom test 8/26/02 11:45am

Science.gov (United States)

2000-01-01

Members of the flight and ground crews prepare to unload equipment from NASA's B377SGT Super Guppy Turbine cargo aircraft on the ramp at NASA's Dryden Flight Research Center at Edwards Air Force Base, Calif. The outsize cargo plane had delivered the latest version of the X-38 flight test vehicle to NASA Dryden when this photo was taken on June 11, 2000. The B-377SGT Super Guppy Turbine evolved from the 1960s-vintage Pregnant Guppy, Mini Guppy and Super Guppy, used for transporting sections of the Saturn rocket used for the Apollo program moon launches and other outsized cargo. The various Guppies were modified from 1940's and 50's-vintage Boeing Model 377 and C-97 Stratocruiser airframes by Aero Spacelines, Inc., which operated the aircraft for NASA. NASA's Flight Research Center assisted in certification testing of the first Pregnant Guppy in 1962. One of the turboprop-powered Super Guppies, built up from a YC-97J airframe, last appeared at Dryden in May, 1976 when it was used to transport the HL-10 and X-24B lifting bodies from Dryden to the Air Force Museum at Wright-Patterson Air Force Base, Ohio. NASA's present Super Guppy Turbine, the fourth and last example of the final version, first flew in its outsized form in 1980. It and its three sister ships were built in the 1970s for Europe's Airbus Industrie to ferry outsized structures for Airbus jetliners to the final assembly plant in Toulouse, France. It later was acquired by the European Space Agency, and then acquired by NASA in late 1997 for transport of large structures for the International Space Station to the launch site. It replaced the earlier-model Super Guppy, which has been retired and is used for spare parts. NASA's Super Guppy Turbine carries NASA registration number N941NA, and is based at Ellington Field near the Johnson Space Center. For more information on NASA's Super Guppy Turbine, log onto the Johnson Space Center Super Guppy web page at http://spaceflight.nasa.gov/station/assembly/superguppy/

ODP Leg 210 Drills the Newfoundland Margin in the Newfoundland-Iberia Non-Volcanic Rift

Science.gov (United States)

Tucholke, B. E.; Sibuet, J.

2003-12-01

The final leg of the Ocean Drilling Project (Leg 210, July-September 2003) was devoted to studying the history of rifting and post-rift sedimentation in the Newfoundland-Iberia rift. For the first time, drilling was conducted in the Newfoundland Basin along a transect conjugate to previous drill sites on the Iberia margin (Legs 149 and 173) to obtain data on a complete `non-volcanic' rift system. The prime site during this leg (Site 1276) was drilled in the transition zone between known continental crust and known oceanic crust at chrons M3 and younger. Extensive geophysical work and deep-sea drilling have shown that this transition-zone crust on the conjugate Iberia margin is exhumed continental mantle that is strongly serpentinized in its upper part. Transition-zone crust on the Newfoundland side, however, is typically a kilometer or more shallower and has much smoother topography, and seismic refraction data suggest that the crust may be thin (about 4 km) oceanic crust. A major goal of Site 1276 was to investigate these differences by sampling basement and a strong, basinwide reflection (U) overlying basement. Site 1276 was cored from 800 to 1737 m below seafloor with excellent recovery (avg. 85%), bottoming in two alkaline diabase sills >10 m thick that are estimated to be 100-200 meters above basement. The sills have sedimentary contacts that show extensive hydrothermal metamorphism. Associated sediment structural features indicate that the sills were intruded at shallow levels within highly porous sediments. The upper sill likely is at the level of the U reflection, which correlates with lower Albian - uppermost Aptian(?) fine- to coarse-grained gravity-flow deposits. Overlying lower Albian to lower Oligocene sediments record paleoceanographic conditions similar to those on the Iberia margin and in the main North Atlantic basin, including deposition of `black shales'; however, they show an extensive component of gravity-flow deposits throughout.

Coulomb excitation of $^{182-184}$ Hg: Shape coexistence in the neutron-deficient lead region

CERN Multimedia

We put forward a study of the interplay between individual nucleon behavior and collective degrees of freedom in the nucleus, as manifested in shape coexistence in the neutron-deficient lead region. As a first step of this experimental campaign, we propose to perform Coulomb excitation on light mercury isotopes to probe their excited states and determine transitional and diagonal E2 matrix elements, especially reducing the current uncertainties. The results from previous Coulomb excitation measurements in this mass region performed with 2.85 MeV/u beams from REX-ISOLDE have shown the feasibility of these experiments. Based on our past experience and the results obtained, we propose a detailed study of the $^{182-184}$Hg nuclei, that exhibit a pronounced mixing between 2 low-lying excited states of apparently different deformation character, using the higher energy beams from HIE-ISOLDE which are crucial to reach our goal. The higher beam energy should result in an increased sensitivity with respect to the qua...

Minimally Invasive versus Open Distal Pancreatectomy for Ductal Adenocarcinoma (DIPLOMA): A Pan-European Propensity Score Matched Study

NARCIS (Netherlands)

van Hilst, Jony; de Rooij, Thijs; Klompmaker, Sjors; Rawashdeh, Majd; Aleotti, Francesca; Al-Sarireh, Bilal; Alseidi, Adnan; Ateeb, Zeeshan; Balzano, Gianpaolo; Berrevoet, Frederik; Björnsson, Bergthor; Boggi, Ugo; Busch, Olivier R.; Butturini, Giovanni; Casadei, Riccardo; del Chiaro, Marco; Chikhladze, Sophia; Cipriani, Federica; van Dam, Ronald; Damoli, Isacco; van Dieren, Susan; Dokmak, Safi; Edwin, Bjørn; van Eijck, Casper; Fabre, Jean-Marie; Falconi, Massimo; Farges, Olivier; Fernández-Cruz, Laureano; Forgione, Antonello; Frigerio, Isabella; Fuks, David; Gavazzi, Francesca; Gayet, Brice; Giardino, Alessandro; Bas Groot, Koerkamp; Hackert, Thilo; Hassenpflug, Matthias; Kabir, Irfan; Keck, Tobias; Khatkov, Igor; Kusar, Masa; Lombardo, Carlo; Marchegiani, Giovanni; Marshall, Ryne; Menon, Krish V.; Montorsi, Marco; Orville, Marion; de Pastena, Matteo; Pietrabissa, Andrea; Poves, Ignaci; Primrose, John; Pugliese, Raffaele; Ricci, Claudio; Roberts, Keith; Røsok, Bård; Sahakyan, Mushegh A.; Sánchez-Cabús, Santiago; Sandström, Per; Scovel, Lauren; Solaini, Leonardo; Soonawalla, Zahir; Souche, F. Régis; Sutcliffe, Robert P.; Tiberio, Guido A.; Tomazic, Aleš; Troisi, Roberto; Wellner, Ulrich; White, Steven; Wittel, Uwe A.; Zerbi, Alessandro; Bassi, Claudio; Besselink, Marc G.; Abu Hilal, Mohammed

2017-01-01

The aim of this study was to compare oncological outcomes after minimally invasive distal pancreatectomy (MIDP) with open distal pancreatectomy (ODP) in patients with pancreatic ductal adenocarcinoma (PDAC). Cohort studies have suggested superior short-term outcomes of MIDP vs. ODP. Recent

Methods of measurement and evaluation of natural radionuclide contents in buildings, at building sites, and in building materials and water

International Nuclear Information System (INIS)

1998-01-01

The recommendations should serve as guidelines for specifying the scope of measurement and ways of evaluating the measuring results when satisfying the relevant requirements laid down by the Czech Atomic Act (Act No. 18/1997) and Decree No. 184/1997 in the field of natural radiation sources occurring in the environment without deliberate use. The document consists of the following sections: Methodology for the measurement and assessment of natural exposure of persons in dwelling rooms of buildings; Methodology of determination of the radon risk of building sites; Principles of systematic measurement and evaluation of natural radionuclide contents of building materials; and Principles of systematic measurement and evaluation of natural radionuclide contents of supplied water. (P.A.)

Platinum-group elements, S, Se and Cu in highly depleted abyssal peridotites from the Mid-Atlantic Ocean Ridge (ODP Hole 1274A): Influence of hydrothermal and magmatic processes

Science.gov (United States)

Marchesi, Claudio; Garrido, Carlos J.; Harvey, Jason; González-Jiménez, José María; Hidas, Károly; Lorand, Jean-Pierre; Gervilla, Fernando

2013-11-01

Highly depleted harzburgites and dunites were recovered from ODP Hole 1274A, near the intersection between the Mid-Atlantic Ocean Ridge and the 15°20'N Fracture Zone. In addition to high degrees of partial melting, these peridotites underwent multiple episodes of melt-rock reaction and intense serpentinization and seawater alteration close to the seafloor. Low concentrations of Se, Cu and platinum-group elements (PGE) in harzburgites drilled at around 35-85 m below seafloor are consistent with the consumption of mantle sulfides after high degrees (>15-20 %) of partial melting and redistribution of chalcophile and siderophile elements into PGE-rich residual microphases. Higher concentrations of Cu, Se, Ru, Rh and Pd in harzburgites from the uppermost and lowest cores testify to late reaction with a sulfide melt. Dunites were formed by percolation of silica- and sulfur-undersaturated melts into low-Se harzburgites. Platinum-group and chalcophile elements were not mobilized during dunite formation and mostly preserve the signature of precursor harzburgites, except for higher Ru and lower Pt contents caused by precipitation and removal of platinum-group minerals. During serpentinization at low temperature (desulfurization to S-poor sulfides (mainly heazlewoodite) and awaruite. Contrary to Se and Cu, sulfur does not record the magmatic evolution of peridotites but was mostly added in hydrothermal sulfides and sulfate from seawater. Platinum-group elements were unaffected by post-magmatic low-temperature processes, except Pt and Pd that may have been slightly remobilized during oxidative seawater alteration.

Generation of highly stable and active strong base sites on organized nano-porous alumina by calcium oxide

Science.gov (United States)

Tarlani, Aliakbar; Zarabadi, Mir Pouyan

2013-02-01

In a new approach, strong basic sites has been successfully prepared by loading of calcium nitrate (Ca) on organized nano-porous alumina (ONPA). The prepared CaONPAs were characterized by low-angle X-ray diffraction (XRD), N2 adsorption-desorption isotherms (Brunauer-Emmett-Teller (BET)-Barret-Joyner-Halenda (BJH)), transmission electron microscopy (TEM) and thermogravimetric analysis (TGA). Measuring of the amount of the basic sites and the basicity was carried out by titration method, temperature-programmed desorption (TPD-CO2) and Hammett indicators. Resistance of the basic sites was also tested by washing with water. N2 sorption measurements showed that supporting of the calcium nitrate on ONPA can lead to the bimodal porosity at lower loading. BET surface area of the bare ONPA was 212 m2/g which decreased to 111 m2/g for the 25% of loading of Ca (25CaONPA). The results pointed out that CaONPA samples have basicity between 18.4 < H_ < 22 for 15 and 25% of loadings and well-preserved of the basicity after washing with water especially for 5 and 15% samples. Also no crystalline phase of CaO was observed for 25CaONPA which was calcined at 600 °C.

[Comparison of laparoscopic distal pancreatectomy and open distal pancreatectomy in pancreatic ductal adenocarcinoma].

Science.gov (United States)

Xu, K; Su, J J; Su, M; Yan, L; Feng, J; Xin, X L; Chen, Y L

2017-10-23

Objective: To compare and evaluate the curative effect of laparoscopic distal pancreatectomy(LDP) and traditional open distal pancreatectomy(ODP) in pancreatic ductal adenocarcinoma. Methods: The clinical data of 15 patients treated by LDP and 87 contemporaneous cases treated by ODP from January 2010 to November 2015 was collected, and the curative effect and prognosis of these patients were retrospectively analyzed. Results: The operation time of LDP group was (286.5±48.1) min, significantly longer than that of OPD group(226.6±56.8) min ( P 0.05). In both LDP group and ODP group, none occurred percutaneous drainage, re-admissions, second operation or perioperative death. Conclusions: Compared to ODP, LDP is much safer and more steady in perioperative periodand operation. Patients of pancreatic ductal adenocarcinoma received LDP can acquire more benefit and recovery sooner, and LDP is a safe and effective operative method.

The Value of Decision Analytical Modeling in Surgical Research: An Example of Laparoscopic Versus Open Distal Pancreatectomy.

Science.gov (United States)

Tax, Casper; Govaert, Paulien H M; Stommel, Martijn W J; Besselink, Marc G H; Gooszen, Hein G; Rovers, Maroeska M

2017-11-02

To illustrate how decision modeling may identify relevant uncertainty and can preclude or identify areas of future research in surgery. To optimize use of research resources, a tool is needed that assists in identifying relevant uncertainties and the added value of reducing these uncertainties. The clinical pathway for laparoscopic distal pancreatectomy (LDP) versus open (ODP) for nonmalignant lesions was modeled in a decision tree. Cost-effectiveness based on complications, hospital stay, costs, quality of life, and survival was analyzed. The effect of existing uncertainty on the cost-effectiveness was addressed, as well as the expected value of eliminating uncertainties. Based on 29 nonrandomized studies (3.701 patients) the model shows that LDP is more cost-effective compared with ODP. Scenarios in which LDP does not outperform ODP for cost-effectiveness seem unrealistic, e.g., a 30-day mortality rate of 1.79 times higher after LDP as compared with ODP, conversion in 62.2%, surgically repair of incisional hernias in 21% after LDP, or an average 2.3 days longer hospital stay after LDP than after ODP. Taking all uncertainty into account, LDP remained more cost-effective. Minimizing these uncertainties did not change the outcome. The results show how decision analytical modeling can help to identify relevant uncertainty and guide decisions for future research in surgery. Based on the current available evidence, a randomized clinical trial on complications, hospital stay, costs, quality of life, and survival is highly unlikely to change the conclusion that LDP is more cost-effective than ODP.

Phosphonate self-assembled monolayers on aluminum surfaces

International Nuclear Information System (INIS)

Hoque, E.; DeRose, J.A.; Hoffmann, P.; Mathieu, H.J.; Bhushan, B.; Cichomski, M.

2006-01-01

Substrates of aluminum (Al) deposited by physical vapor deposition onto Si substrates and then chemically reacted with perfluorodecylphosphonic acid (PFDP/Al/Si), decylphosphonic acid (DP/Al/Si), and octadecylphosphonic acid (ODP/Al/Si) were studied by x-ray photoelectron spectroscopy (XPS), contact angle measurements, atomic force microscopy (AFM), and friction force microscopy, a derivative of AFM, to characterize their surface chemical composition, roughness, and micro-/nanotribological properties. XPS analysis confirmed the presence of perfluorinated and nonperfluorinated alkylphosphonate molecules on the PFDP/Al/Si, DP/Al/Si, and ODP/Al/Si. The sessile drop static contact angle of pure water on PFDP/Al/Si was typically more than 130 deg. and on DP/Al/Si and ODP/Al/Si typically more than 125 deg. indicating that all phosphonic acid reacted Al/Si samples were very hydrophobic. The surface roughness for PFDP/Al/Si, DP/Al/Si, ODP/Al/Si, and bare Al/Si was approximately 35 nm as determined by AFM. The surface energy for PFDP/Al/Si was determined to be approximately 11 mN/m by the Zisman plot method compared to 21 and 20 mN/m for DP/Al/Si and ODP/Al/Si, respectively. Tribology involves the measure of lateral forces due to friction and adhesion between two surfaces. Friction, adhesion, and wear play important roles in the performance of micro-/nanoelectromechanical systems. PFDP/Al/Si gave the lowest adhesion and coefficient of friction values while bare Al/Si gave the highest. The adhesion and coefficient of friction values for DP/Al/Si and ODP/Al/Si were comparable

Oxothiomolybdenum derivatives of the superlacunary crown heteropolyanion {P8W48}: structure of [K4{Mo4O4S4(H2O)3(OH)2}2(WO2)(P8W48O184)]30– and studies in solution.

Science.gov (United States)

Korenev, Vladimir S; Floquet, Sébastien; Marrot, Jérôme; Haouas, Mohamed; Mbomekallé, Israël-Martyr; Taulelle, Francis; Sokolov, Maxim N; Fedin, Vladimir P; Cadot, Emmanuel

2012-02-20

Reaction of the cyclic lacunary [H(7)P(8)W(48)O(184)](33-) anion (noted P(8)W(48)) with the [Mo(2)S(2)O(2)(H(2)O)(6)](2+) oxothiocation led to two compounds, namely, [K(4){Mo(4)O(4)S(4)(H(2)O)(3)(OH)(2)}(2)(WO(2))(P(8)W(48)O(184))](30-) (denoted 1) and [{Mo(4)O(4)S(4)(H(2)O)(3)(OH)(2)}(2)(P(8)W(48)O(184))](36-) (denoted 2), which were characterized in the solid state and solution. In the solid state, the structure of [K(4){Mo(4)O(4)S(4)(H(2)O)(3)(OH)(2)}(2)(WO(2))(P(8)W(48)O(184))](30-) reveals the presence of two disordered {Mo(4)O(4)S(4)(H(2)O)(3)(OH)(2)}(2+) "handles" connected on both sides of the P(8)W(48) ring. Such a disorder is consistent with the presence of two geometrical isomers where the relative disposition of the two {Mo(4)O(4)S(4)(H(2)O)(3)(OH)(2)}(2+) handles are arranged in a perpendicular or parallel mode. Such an interpretation is fully supported by (31)P and (183)W NMR solution studies. The relative stability of both geometrical isomers appears to be dependent upon the nature of the internal alkali cations, i.e., Na(+) vs K(+), and increased lability of the two {Mo(4)O(4)S(4)(H(2)O)(3)(OH)(2)}(2+) handles, compared to the oxo analogous, was clearly identified by significant broadening of the (31)P and (183)W NMR lines. Solution studies carried out by UV-vis spectroscopy showed that formation of the adduct [{Mo(4)O(4)S(4)(H(2)O)(3)(OH)(2)}(2)(P(8)W(48)O(184))](36-) occurs in the 1.5-4.7 pH range and corresponds to a fast and quantitative condensation process. Furthermore, (31)P NMR titrations in solution reveal formation of the "monohandle" derivative [{Mo(4)O(4)S(4)(H(2)O)(3)(OH)(2)}(P(8)W(48)O(184))](38-) as an intermediate prior to formation of the "bishandle" derivatives. Furthermore, the electrochemical behavior of [{Mo(4)O(4)S(4)(H(2)O)(3)(OH)(2)}(2)(P(8)W(48)O(184))](36-) was studied in aqueous medium and compared with the parent anion P(8)W(48).

GPCR Interaction: 184 [GRIPDB[Archive

Lifescience Database Archive (English)

Full Text Available tion of C5aR dimers.Upon C5a stimulation, mutant receptors did not internalize when individually express...ed. C5a stimulation of cells that co-expressed wild type C5aR together with either un...terfaces of C5aR A Complement component C5a C5aR A Complement component C5a C5aR Experiment Neither an intact NH2 term...inus nor the presence of COOH-terminal phosphorylation sites appeared to be required for the forma...liganded or phosphorylation-deficient mutant resulted in co-internalization of mutant receptors with C5aR. 18772131 NH2-terminally modified C5aR mutant NP_001727.1 ...

Core Description and a Preliminarily Sedimentology Study of Site 1202D, Leg 195, in the Southern Okinawa Trough

Directory of Open Access Journals (Sweden)

Chi-Yue Huang

2005-01-01

Full Text Available ODP Site 1202 of Leg 195 was designed primarily for a high-resolution study of the paleoceanography of the Kuroshio Current in the southern Okinawa Trough off NE Taiwan. Four holes were drilled in which Hole 1202D is described in detail in this study for an assessment of core quality for paleoceanography study and understanding of sedimentological features, especially turbidite sedimentation and the sediment provenances during the Late Quaternary in the southern Okinawa Trough. Pelagic mud with insignificant silt or sand layers is observed from the core top down to 133 m (mbsf; Marine Isotope Stages 1-3, but the silt-sand layer ratio (SLR: total thickness of silt and sand layers / 1.5 m of core increases gradually from a value of 50 % between 223 and 279 m, followed by decreases to values 250 _ Slate fragments are commonly found in fine-grained turbidite dominant intervals (160 - 280 m, while mica flakes can be observed in the muds throughout the core. The major detrital components were derived primarily from the Miocene slate belt of the pre-collision accretionary prism of the Central Range in northern Taiwan. The occurrence of volcanics could represent submarine volcanic activity in the active-opening Okinawa Trough back-arc basin off NE Taiwan. Shallow-marine fossils including benthic foraminifers, echinoids, bryozoans and mollusks are also found in the fine-grained turbidite dominant intervals. These fossil assemblages could have been deposited in the shallow shelf and then transported to the depositional site along with voluminous terrigenous materials derived from Taiwan, via submarine channels or by slope failures due to frequent earthquakes induced by plate convergence/collision and extension in the southwestern Okinawa Trough off NE Taiwan. It is concluded that the top 133 m of the core is better suited for paleoceanographic reconstruction.

Ontorat: automatic generation of new ontology terms, annotations, and axioms based on ontology design patterns.

Science.gov (United States)

Xiang, Zuoshuang; Zheng, Jie; Lin, Yu; He, Yongqun

2015-01-01

It is time-consuming to build an ontology with many terms and axioms. Thus it is desired to automate the process of ontology development. Ontology Design Patterns (ODPs) provide a reusable solution to solve a recurrent modeling problem in the context of ontology engineering. Because ontology terms often follow specific ODPs, the Ontology for Biomedical Investigations (OBI) developers proposed a Quick Term Templates (QTTs) process targeted at generating new ontology classes following the same pattern, using term templates in a spreadsheet format. Inspired by the ODPs and QTTs, the Ontorat web application is developed to automatically generate new ontology terms, annotations of terms, and logical axioms based on a specific ODP(s). The inputs of an Ontorat execution include axiom expression settings, an input data file, ID generation settings, and a target ontology (optional). The axiom expression settings can be saved as a predesigned Ontorat setting format text file for reuse. The input data file is generated based on a template file created by a specific ODP (text or Excel format). Ontorat is an efficient tool for ontology expansion. Different use cases are described. For example, Ontorat was applied to automatically generate over 1,000 Japan RIKEN cell line cell terms with both logical axioms and rich annotation axioms in the Cell Line Ontology (CLO). Approximately 800 licensed animal vaccines were represented and annotated in the Vaccine Ontology (VO) by Ontorat. The OBI team used Ontorat to add assay and device terms required by ENCODE project. Ontorat was also used to add missing annotations to all existing Biobank specific terms in the Biobank Ontology. A collection of ODPs and templates with examples are provided on the Ontorat website and can be reused to facilitate ontology development. With ever increasing ontology development and applications, Ontorat provides a timely platform for generating and annotating a large number of ontology terms by following

Modeling of the installation with the code MELCOR 1.8.4

International Nuclear Information System (INIS)

Pomier Baez, L.E.; Nunez Mc Leod, J.E.

1998-01-01

Full text: The calculation code MELCOR 1.8.4 is an integrated program that allow to simulate the development of accidents in nuclear plants with refrigerated reactors with light water. This code can simulate the whole spectrum of phenomenons. This work carried out the validation of the packages of the code MELCOR dedicated to evaluate the behaviour under conditions of two-phase flow, through the comparison of the results of the simulation with the experimental data of the installation TPTF (Two-Phase Test Facility) (ROSA-IV) of the Institute JAERI (Japan Atomic Energy Research Institute) of Japan. The main objective of the experiments TPTF is obtain data on the thermohydraulic behaviour from light water reactors (PWR) during an accident with small loss of coolant (SBLOCA), and the capacity of MELCOR code was evaluated in the simulation of these kind of accidents. Diverse options of the code were studies, in order to analyzing the behaviour of the feigned phenomenon. The effect of the change in the nodalization of the nuclear installation was studies, as well as the management of diverse control functions. The results of the evaluation show a good concordance with the experimental data, especially in the prediction of the behaviour of the steam fraction in relation with the mass flow, the quality of the steam and the mixture level in the exit volume that represent two possibilities state in the vessel reactor during the accidental situation. (author) [es

Isotopic evidences of past upwelling intensity in the Arabian Sea

Digital Repository Service at National Institute of Oceanography (India)

Naidu, P.D.

and understand the history of upwelling as it is recorded in deep-sea sediments. The southwest (SW) monsoon strongly influences the climatic conditions in South and Southeast Asia and biological productivity in the Arabian Sea. ability at the ODP Site 728... climatic change and ocean history (McCrea, 1950; Epstein et al., 1953; Emiliani, 1955). The isotopic role of planktic forami- nifera expanded, it was recognized that foraminifera did not secret their shells in isotopic equilibrium with ambient water (Be...

Bilateral optic disc pit with maculopathy in a patient with cleft lip and cleft palate

Directory of Open Access Journals (Sweden)

Anisha Seth

2015-01-01

Full Text Available Optic disc pit (ODP is small, gray-white, oval depression found at the optic nerve head. It is a congenital defect that occurs due to imperfect closure of superior edge of the embryonic fissure. Cleft lip and palate are also congenital midline abnormalities occurring due to defect in the fusion of frontonasal prominence, maxillary prominence and mandibular prominence. There is only one case report describing the occurrence of ODP in a young patient with cleft lip and palate who also had basal encephalocele. We describe a 52-year-old patient with congenital cleft lip and palate with bilateral ODP with maculopathy but without any other midline abnormality.

Microstructure of the optic disc pit in open-angle glaucoma.

Science.gov (United States)

Choi, Yun Jeong; Lee, Eun Ji; Kim, Bo Hyuk; Kim, Tae-Woo

2014-11-01

To investigate the structural and clinical characteristics of the optic disc pit (ODP) in primary open-angle glaucoma (POAG) via enhanced depth imaging (EDI) spectral-domain optical coherence tomography (SD-OCT). Prospective, observational case series. Seventy POAG eyes clinically diagnosed with an ODP via stereo disc photography. Optic discs were scanned using EDI SD-OCT. Serial horizontal and vertical B-scan images covering the optic discs were obtained from each eye. The structural characteristics of the ODP were investigated via 3-dimensional images constructed from the serial B-scans, focusing on the presence of alterations in the contour of the lamina cribrosa (LC) or prelaminar tissue (PLT), in conjunction with associated clinical characteristics. The structural characteristics of the ODP and associated clinical characteristics. In the EDI SD-OCT images, the ODP was viewed as an isolated alteration of the LC (n = 14, 20.0%) or PLT (n = 16, 22.9%) or an alteration of both the LC and PLT (n = 40, 57.1%). Alterations of the LC were located at the mid-periphery near the LC insertion (n = 17) or far periphery adjacent to the LC insertion (n = 37), and the depth of alteration was deep (n = 23), involving nearly full-thickness LC, or shallow (n = 31), with partially visible LC at the base. Fifty-four eyes (77.1%) exhibited parafoveal visual field (VF) defect within 10 degrees of fixation, and in 98.1% of these eyes (53/54) it was spatially associated with the location of ODP. The parafoveal VF defect was more prevalent in eyes with LC alteration than those without (83.3% vs. 56.2%, P = 0.023) and in eyes with deep LC defect than those with shallow defect (95.7% vs. 74.2%, P = 0.036). Disc hemorrhage (32.4% vs. 0.0%, P = 0.008) and peripapillary retinoschisis (18.9 vs. 0.0%, P = 0.055) were more strongly associated with LC alterations located at the far periphery than at the mid-periphery. Enhanced depth imaging SD-OCT facilitated visualization of the varied

AXAIRQ User's Manual

International Nuclear Information System (INIS)

Simpkins, A.A.

1995-10-01

AXAIRQ is the primary dose assessment code used at the Savannah River Site to predict downwind doses following a hypothetical atmospheric release of relatively short duration. Purpose is to perform calculations for safety-related documentation, and AXAIRQ strictly adheres to the guidance in US NRC Regulatory Guide 1.145 (USNRC 1982) entitled Atmospheric Dispersion Models for Potential Accident Consequence Assessments at Nuclear Power Plants. Doses are determined for the plume shine, ground shine, and inhalation pathways. Ingestion is not considered

Diets and habitat analyses of mule deer on the 200 areas of the Hanford Site in southcentral Washington

Energy Technology Data Exchange (ETDEWEB)

Uresk, D.W.; Uresk, V.A.

1980-10-01

Forty-four food items were identified in the fecal pellets of the mule deer (Odocoileus hemionus hemionus) on three areas of the Hanford Site. Microscopic analysis of plant fragments indicated that bitterbrush was the most common species occurring in the diets of deer from the B-C Cribs area. Russian thistle (Salsola kali) and goldenrod (Solidago sp.) were the most abundant plants found in the fecal pellets collected from B Pond and Gable Mountain Pond habitats, respectively. The similarity in diets among the habitats was low, ranging from 10% to 16%. Preference indices of forage plants among sites were not similar (7% to 19%). The B-C Cribs, B Pond and Gable Mountain Pond habitats were characterized for canopy cover and frequency of occurrence of plant species. Twelve species were sampled in the B-C Cribs and B Pond areas; 22 species were identified on the Gable Mountain site. The most commonly occurring plant was cheatgrass (Bromus tectorum) in all three sites. The similarity in frequency and canopy cover of plants was low among sites. Mule deer inhabiting the Hanford site can serve as a pathway for movement of radioactive material from low-level radioactive waste management areas to man. Maximum levels of /sup 137/Cs found in deer pellet groups collected from B Pond and Gable Mountain Pond areas were 100 pCi/g and 128 pCi/g, respectively. Background levels were reported at B-C Cribs area. Maximum /sup 90/Sr values found in deer pellets at B Pond were 107 pCi/g and 184 pCi/g at Gable Mountain Pond.

Diets and habitat analyses of mule deer on the 200 areas of the Hanford Site in southcentral Washington

International Nuclear Information System (INIS)

Uresk, D.W.; Uresk, V.A.

1980-10-01

Forty-four food items were identified in the fecal pellets of the mule deer (Odocoileus hemionus hemionus) on three areas of the Hanford Site. Microscopic analysis of plant fragments indicated that bitterbrush was the most common species occurring in the diets of deer from the B-C Cribs area. Russian thistle (Salsola kali) and goldenrod (Solidago sp.) were the most abundant plants found in the fecal pellets collected from B Pond and Gable Mountain Pond habitats, respectively. The similarity in diets among the habitats was low, ranging from 10% to 16%. Preference indices of forage plants among sites were not similar (7% to 19%). The B-C Cribs, B Pond and Gable Mountain Pond habitats were characterized for canopy cover and frequency of occurrence of plant species. Twelve species were sampled in the B-C Cribs and B Pond areas; 22 species were identified on the Gable Mountain site. The most commonly occurring plant was cheatgrass (Bromus tectorum) in all three sites. The similarity in frequency and canopy cover of plants was low among sites. Mule deer inhabiting the Hanford site can serve as a pathway for movement of radioactive material from low-level radioactive waste management areas to man. Maximum levels of 137 Cs found in deer pellet groups collected from B Pond and Gable Mountain Pond areas were 100 pCi/g and 128 pCi/g, respectively. Background levels were reported at B-C Cribs area. Maximum 90 Sr values found in deer pellets at B Pond were 107 pCi/g and 184 pCi/g at Gable Mountain Pond

Water in orthopyroxene from abyssal spinel peridotites of the East Pacific Rise (ODP Leg 147: Hess Deep)

Science.gov (United States)

Hesse, Kirsten T.; Gose, Jürgen; Stalder, Roland; Schmädicke, Esther

2015-09-01

Abyssal spinel peridotites from Hess Deep, East Pacific Rise (ODP Leg 147) were investigated concerning their major, minor, and trace element mineral chemistry and the incorporation of structural water in orthopyroxene. The rocks are partially serpentinized harzburgites containing primary minerals of olivine, orthopyroxene, clinopyroxene, and spinel. Orthopyroxene is enstatitic with Mg# (Mg/(Mg + Fe)) between 0.90 and 0.92 and Al2O3 from 0.5 to 2.9 wt.%. The residual harzburgite experienced high degrees of melt removal in the spinel peridotite stability field. The average degree of partial melting was calculated to be 17.5% (range: 16.4-17.8%). Trace element data of ortho- and clinopyroxenes reflect this strong depletion, characteristic for the restitic nature of abyssal peridotites. Mantle re-equilibration temperatures around 1000 °C indicate that, after melt extraction and before exhumation to the ocean floor, the rocks experienced significant cooling in the spinel peridotite facies. Water contents of orthopyroxene range from 86 to 233 wt. ppm H2O with an average concentration of 142 wt. ppm H2O. These results represent the first data on water contents in the sub-pacific mantle obtained by direct measurements of sub-oceanic peridotite. The water contents are not related to mineral chemistry, stratigraphy, melting degree, mantle equilibrium conditions or oxidation state. Calculated post-melt peridotite water contents vary between 40 and 100 wt. ppm H2O. Compared to Mid-Atlantic Ridge peridotites, the East Pacific Rise samples of Leg 147 contain somewhat lower water concentrations than samples from Leg 153 and considerably higher contents than those of Leg 209 (Gose et al., 2009; Schmädicke et al., 2011). In Leg 147, the strongest OH absorbtion band occurs at 3420 cm- 1, wheras orthopyroxene from MAR peridotite (Legs 153 and 209) has its strongest absorbtion band at 3566 and 3522 cm- 1. The mantle equilibrium temperature of Leg 147 peridotites is lower than that

Chemostratigraphy at DSDP Sites 386 (Bermuda Rise) and 144 (Demerara Rise), Implications for Euxinic Conditions During OAE-2

Science.gov (United States)

Horst, P. A.; Maurrasse, F. J.; Sinninghe-Damsté, J. S.; Sandler, A.

2008-05-01

). Biomarker data indicate that during OAE 2 similar paleoceanographic conditions prevailed at both DSDP Sites, 144 on the Demerara Rise and 386 on the Bermuda Rise. A. Forster, H. Sturt, P.A. Meyers, et al., in preliminary shipboard results from Sites 1257 and 1258, Leg 207, J. Erbacher, D.C. Mosher, M.J. Malone, et al., Proc. ODP, Init.Repts.207,1-22 [Online]: http://wwwodp.tamu.edu/publications/207_IR/VOLUME/ CHAPTERS/IR207_10.PDF. [Cited 2006-02-09] M.M.M. Kuypers, et al., Paleoceanography, 17, 4, 1051-1063 (2002) B.R.T. Simoneit, in Initial Reports of the Deep Sea Drilling Project, Vol. 43, Tucholke, B.E., Vogt, P.R., et al., 1979, Eds, Washington (U.S. Government Printing Office), pp. 643-650 (1979) B.R.T. Simoneit and D.H.Stuermer, in Cretaceous Oceans, S.O. Schlanger and M.B. Cita, Eds, Academic Press, New York, pp. 145-163 (1982)

Basement Basalts from IODP Site 1438, Amami-Sankaku Basin: Implications for Sources and Melting Processes during Subduction Initiation in the Izu-Bonin-Mariana System

Science.gov (United States)

McCarthy, A. J.; Hickey-Vargas, R.; Yogodzinski, G. M.; Ishizuka, O.; Hocking, B.; Bizimis, M.; Savov, I. P.; Kusano, Y.; Arculus, R. J.

2016-12-01

IODP Expedition 351 Site 1438 is located in the Amami-Sankaku basin, just west of the Kyushu-Palau Ridge (KPR), a remnant of the early Izu-Bonin-Mariana (IBM) volcanic arc. 150 meters of basement basalt were drilled beneath 1460 m of volcaniclastic sediments and sedimentary rock. The age range inferred for these basalts is 51-52 Ma, close to the 48-52 Ma age of basalts associated with subduction initiation in the IBM forearc (forearc basalts or FABs). Site 1438 basement basalts form several distinct subunits, all relatively mafic (MgO = 6-14 %; Mg# = 51-83). Non-fluid-mobile incompatible trace element patterns are profoundly depleted. Sm/Nd (0.34-0.43) and Lu/Hf (0.18-0.37) reach values higher than most normal MORBs while La/Yb (0.31-0.98) and Ti/V (15.8-27.0) are lower. These features are shared with basalts drilled just west of the KPR at ODP Site 1201 and DSDP Site 447, and many FABs. Abundances of fluid-mobile incompatible elements vary together and are correlated with subunits defined by flow margins and rock physical properties, suggesting control by post-eruptive seawater alteration rather than varying inputs of subduction fluids. Hf-Nd isotopes for Site 1438 basement basalts range from (present-day) ɛNd of 7.0 to 9.5 and ɛHf of 14.5 to 19.8 in a well-correlated array. Their more radiogenic Hf-isotope character could indicate an Indian-type MORB source, however, basalts with ɛHf >16.5, are more radiogenic than many Indian MORB. Pb isotope data will help distinguish differing mantle source domains and origins for fluid-mobile elements. Overall, the combined geochemical data indicate that the mantle source of basement basalts in drill sites west of the KPR (1438, 1201, 447) are closely similar to those for FAB, and that as a group, these rocks are more depleted than more than 90% of global MORB. Our interpretation is that both IBM forearc basalts and basalts from drill sites immediately west of the KPR formed by melting of the same uniquely depleted mantle

Indian contributions in the field of palaeoceanography (2006-2012)

Digital Repository Service at National Institute of Oceanography (India)

Gupta, A.K.; Sinha, D; Singh, A.K.; Naidu, P.D; Saraswat, R.; Rai, A.K.

.mail: anilg@wihg.res.in Proc Indian natn Sci Acad 78 No. 3 September 2012 pp. 313-319  Printed in India. Introduction Palaeoceanography, one of the youngest branches of Earth Science, owes its existence and subsequent exponential development to researches... biochronology of ODP site 763A, Exmouth Plateau Southeast Indian Ocean. Jour. Foram. Res., v. 38, no. 3, p. 251-270. Sinha, D. and Singh A. K., 2007. Ocean circulation in the Indian ocean during last 5 million years: Planktic foraminiferal evidences. Ind. Jour...

Mid-late Holocene changes in the El Niño Southern Oscillation and Hadley Cell intensity; their effect on sea-surface conditions in the mid-latitude southeast Pacific Ocean (41°S)

OpenAIRE

Verleye, T.

2010-01-01

The study focuses on the observed effects of changes in the El Niño Southern Oscillation (ENSO) and Hadley Cell intensity on sea-surface water conditions in the SE Pacific (41°S; Site ODP1233) during the last 8.000 years. Recent studies suggest that periods characterised by a negative Southern Oscillation Index (SOI; El Niño) cause positive precipitation anomalies during austral winter (and annually) in Mid-South Chile, while austral summer periods are rather drier. This because El Niño weake...

Active Edge Sites Engineering in Nickel Cobalt Selenide Solid Solutions for Highly Efficient Hydrogen Evolution

KAUST Repository

Xia, Chuan

2017-01-06

An effective multifaceted strategy is demonstrated to increase active edge site concentration in NiCoSe solid solutions prepared by in situ selenization process of nickel cobalt precursor. The simultaneous control of surface, phase, and morphology result in as-prepared ternary solid solution with extremely high electrochemically active surface area (C = 197 mF cm), suggesting significant exposure of active sites in this ternary compound. Coupled with metallic-like electrical conductivity and lower free energy for atomic hydrogen adsorption in NiCoSe, identified by temperature-dependent conductivities and density functional theory calculations, the authors have achieved unprecedented fast hydrogen evolution kinetics, approaching that of Pt. Specifically, the NiCoSe solid solutions show a low overpotential of 65 mV at -10 mV cm, with onset potential of mere 18 mV, an impressive small Tafel slope of 35 mV dec, and a large exchange current density of 184 μA cm in acidic electrolyte. Further, it is shown that the as-prepared NiCoSe solid solution not only works very well in acidic electrolyte but also delivers exceptional hydrogen evolution reaction (HER) performance in alkaline media. The outstanding HER performance makes this solid solution a promising candidate for mass hydrogen production.

Lifetimes of high-spin states in {sup 180-184}Pt

Energy Technology Data Exchange (ETDEWEB)

Carpenter, M.P.; Ahmad, I.; Crowell, B. [and others

1995-08-01

Over the past few years, lifetimes were measured, using the recoil distance method, to investigate shape-coexistence and shape transitions in the even mass {sup 182-186}Pt isotopes. In all three cases, one observes a sharp increase in the transition quadrupole moment, Q{sub t}, at low frequencies followed by a rapid and significant decline in the backbending region. It was shown that the initial increase in the Q{sub t} can be explained in terms of the mixing at low spins of two bands of very different deformation, and the decline in the backbending region is brought about by mixing between the ground and a two-quasiparticle band. No lifetime information exists for these nuclei above the backbend, and there is some contention whether or not the backbend is due to the alignment of h{sub 9/2} protons, i{sub 13/2} neutrons or the near simultaneous alignment of both. Nilsson-Strutinsky calculations indicate very different shapes for the nuclei after the backbend, depending on which orbitals align. Thus, lifetime information on the states above the backbend should help determine which interpretation is correct. In order to determine the lifetimes of states in the even mass {sup 180-184}Pt nuclei above the backbend, we performed a recent experiment at Gammasphere using a {sup 64}Ni beam on Pb backed Sn targets in order to populate the nucleus of interest via a 4n reaction. At the time of the experiment, thirty-six Ge detectors were available for use in Gammasphere and approximately 100 x 10{sup 6} 3-fold and higher events were taken for each nucleus. Currently, angle-sorted matrices were created from the data, and spectra representing the ground bands show well developed lineshapes for transitions above the backbend. A full lineshape analysis of the data will begin shortly.

Implications of China's Open-Door Policy for Families: A Family Impact Analysis

Science.gov (United States)

Quach, Andrew S.; Anderson, Elaine A.

2008-01-01

China's open-door policy (ODP) was created in 1978 as a response to the severe economic depression affecting the country after the Cultural Revolution. The policy was designed to restore China's financial status and lift the nation out of destitution. By all accounts, the ODP has been successful in improving the country's monetary condition.…

Search for Chargino and Neutralino Production at $\\sqrt{s}$ = 181-184 GeV at LEP

CERN Document Server

Abbiendi, G; Alexander, Gideon; Allison, J; Altekamp, N; Anderson, K J; Anderson, S; Arcelli, S; Asai, S; Ashby, S F; Axen, D A; Azuelos, Georges; Ball, A H; Barberio, E; Barlow, R J; Bartoldus, R; Batley, J Richard; Baumann, S; Bechtluft, J; Behnke, T; Bell, K W; Bella, G; Bellerive, A; Bentvelsen, Stanislaus Cornelius Maria; Bethke, Siegfried; Betts, S; Biebel, O; Biguzzi, A; Bird, S D; Blobel, Volker; Bloodworth, Ian J; Bobinski, M; Bock, P; Böhme, J; Bonacorsi, D; Boutemeur, M; Braibant, S; Bright-Thomas, P G; Brigliadori, L; Brown, R M; Burckhart, Helfried J; Burgard, C; Bürgin, R; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chrisman, D; Ciocca, C; Clarke, P E L; Clay, E; Cohen, I; Conboy, J E; Cooke, O C; Couyoumtzelis, C; Coxe, R L; Cuffiani, M; Dado, S; Dallavalle, G M; Davis, R; De Jong, S; del Pozo, L A; de Roeck, A; Desch, Klaus; Dienes, B; Dixit, M S; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Eatough, D; Estabrooks, P G; Etzion, E; Evans, H G; Fabbri, Franco Luigi; Fanti, M; Faust, A A; Fiedler, F; Fierro, M; Fleck, I; Folman, R; Fürtjes, A; Futyan, D I; Gagnon, P; Gary, J W; Gascon, J; Gascon-Shotkin, S M; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Gibson, V; Gibson, W R; Gingrich, D M; Glenzinski, D A; Goldberg, J; Gorn, W; Grandi, C; Gross, E; Grunhaus, Jacob; Gruwé, M; Hanson, G G; Hansroul, M; Hapke, M; Harder, K; Hargrove, C K; Hartmann, C; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Herndon, M; Herten, G; Heuer, R D; Hildreth, M D; Hill, J C; Hillier, S J; Hobson, P R; Höcker, Andreas; Homer, R James; Honma, A K; Horváth, D; Hossain, K R; Howard, R; Hüntemeyer, P; Igo-Kemenes, P; Imrie, D C; Ishii, K; Jacob, F R; Jawahery, A; Jeremie, H; Jimack, Martin Paul; Jones, C R; Jovanovic, P; Junk, T R; Karlen, D A; Kartvelishvili, V G; Kawagoe, K; Kawamoto, T; Kayal, P I; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Koetke, D S; Kokott, T P; Kolrep, M; Komamiya, S; Kowalewski, R V; Kress, T; Krieger, P; Von Krogh, J; Kühl, T; Kyberd, P; Lafferty, G D; Lanske, D; Lauber, J; Lautenschlager, S R; Lawson, I; Layter, J G; Lazic, D; Lee, A M; Lellouch, Daniel; Letts, J; Levinson, L; Liebisch, R; List, B; Littlewood, C; Lloyd, A W; Lloyd, S L; Loebinger, F K; Long, G D; Losty, Michael J; Ludwig, J; Liu, D; Macchiolo, A; MacPherson, A L; Mader, W F; Mannelli, M; Marcellini, S; Markopoulos, C; Martin, A J; Martin, J P; Martínez, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McKigney, E A; McMahon, T J; McPherson, R A; Meijers, F; Menke, S; Merritt, F S; Mes, H; Meyer, J; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Mir, R; Mohr, W; Montanari, A; Mori, T; Nagai, K; Nakamura, I; Neal, H A; Nellen, B; Nisius, R; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Oreglia, M J; Orito, S; Pálinkás, J; Pásztor, G; Pater, J R; Patrick, G N; Patt, J; Pérez-Ochoa, R; Petzold, S; Pfeifenschneider, P; Pilcher, J E; Pinfold, James L; Plane, D E; Poffenberger, P R; Polok, J; Przybycien, M B; Rembser, C; Rick, Hartmut; Robertson, S; Robins, S A; Rodning, N L; Roney, J M; Roscoe, K; Rossi, A M; Rozen, Y; Runge, K; Runólfsson, O; Rust, D R; Sachs, K; Saeki, T; Sahr, O; Sang, W M; Sarkisyan-Grinbaum, E; Sbarra, C; Schaile, A D; Schaile, O; Scharf, F; Scharff-Hansen, P; Schieck, J; Schmitt, B; Schmitt, S; Schöning, A; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Sittler, A; Skuja, A; Smith, A M; Snow, G A; Sobie, Randall J; Söldner-Rembold, S; Sproston, M; Stahl, A; Stephens, K; Steuerer, J; Stoll, K; Strom, D; Ströhmer, R; Surrow, B; Talbot, S D; Tanaka, S; Taras, P; Tarem, S; Teuscher, R; Thiergen, M; Thomson, M A; Von Törne, E; Torrence, E; Towers, S; Trigger, I; Trócsányi, Z L; Tsur, E; Turcot, A S; Turner-Watson, M F; Van Kooten, R; Vannerem, P; Verzocchi, M; Voss, H; Wäckerle, F; Wagner, A; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wermes, N; White, J S; Wilson, G W; Wilson, J A; Wyatt, T R; Yamashita, S; Yekutieli, G; Zacek, V; Zer-Zion, D

1999-01-01

A search for charginos and neutralinos, predicted by supersymmetric theories, has been performed using a data sample of 57 pb-1 at centre-of-mass energies of 181-184 GeV taken with the OPAL detector at LEP. No evidence for chargino or neutralino production has been found. Upper limits on chargino and neutralino pair production cross-sections are obtained as a function of the chargino mass, the lightest neutralino mass, and the second lightest neutralino mass. For large chargino masses the limits have been improved with respect to the previous analyses at lower centre-of-mass energies. Exclusion regions at 95% confidence level of parameters of the Constrained Minimal Supersymmetric Standard Model are determined for the case of a large universal scalar mass, m_0, implying heavy scalar fermions, and for the case of a small m_0 resulting in light scalar fermions and giving the worst-case limits. Within this framework and for the lightest chargino-neutralino mass difference greater than 5 GeV the 95% C.L. lower li...

Magnetization of lower oceanic crust and upper mantle

Science.gov (United States)

Kikawa, E.

2004-05-01

The location of the magnetized rocks of the oceanic crust that are responsible for sea-floor spreading magnetic anomalies has been a long-standing problem in geophysics. The recognition of these anomalies was a key stone in the development of the theory of plate tectonics. Our present concept of oceanic crustal magnetization is much more complex than the original, uniformly magnetized model of Vine-Matthews-Morley Hypothesis. Magnetic inversion studies indicated that the upper oceanic extrusive layer (Layer 2A of 0.5km thick) was the only magnetic layer and that it was not necessary to postulate any contribution from deeper parts of oceanic crust. Direct measurements of the magnetic properties of the rocks recovered from the sea floor, however, have shown that the magnetization of Layer 2A, together with the observations that this layer could record geomagnetic field reversals within a vertical section, is insufficient to give the required size of observed magnetic anomalies and that some contribution from lower intrusive rocks is necessary. Magnetization of oceanic intrusive rocks were observed to be reasonably high enough to contribute to sea-floor spreading magnetic anomalies, but were considered somewhat equivocal until late 1980Os, in part because studies had been conducted on unoriented dredged and ophiolite samples and on intermittent DSDP/ODP cores. Since ODP Leg 118 that cored and recovered continuous 500m of oceanic intrusive layer at Site 735B, Southwest Indian Ridge with an extremely high recovery of 87 percent, there have been several ODP Legs (legs 147, 153, 176, 179 and 209) that were devoted to drilling gabbroic rocks and peridotites. In terms of the magnetization intensities, all of the results obtained from these ODP Legs were supportive of the model that a significant contribution must come from gabbros and peridotites and the source of the lineated magnetic anomalies must reside in most of the oceanic crust as well as crust-mantle boundary

The Impact of Fe-Ti Oxide Concentration on the Structural Rigidity of the Lower Oceanic Crust, Atlantis Bank, Southwest Indian Ridge

Science.gov (United States)

Deans, J. R.; Winkler, D. A.

2017-12-01

Fe-Ti oxides are important components of oceanic core complexes (OCC) formed at slow-spreading ridges, since Fe-Ti oxide phases form throughout the crustal column and are weaker than silicate phases. This study investigated the predicted relationship between the presence and concentration of Fe-Ti oxides and the presence/intensity of crystal-plastic deformation in samples from Atlantis Bank, Southwest Indian Ridge (SWIR). Atlantis Bank is an OCC that formed through the exhumation of lower oceanic crust along a detachment shear zone/fault. OCCs form along slow-spreading ridges and are characterized by the complex interactions between magmatism and crustal extension, thus, making them more susceptible to crystal-plastic deformation at higher temperatures and for weaker phases like Fe-Ti oxides to preferentially partition strain. Atlantis Bank has been the focus of many scientific expeditions to various sites including; Ocean Drilling Program (ODP) Holes 735B and 1105A, and the International Oceanic Discovery Program (IODP) Hole U1473A. A total of 589 thin sections from all three holes were analyzed using the software package Fiji to calculate the Fe-Ti oxide concentration within the thin sections. The Fe-Ti oxide percentage was correlated with the crystal-plastic fabric (CPF) intensity, from 0-5 (no foliation - ultramylonite), for each thin section using the statistical software R. All three holes show a positive correlation between the abundance of Fe-Ti oxides and the CPF intensity. Specifically, 76.3% of samples with a concentration of 5% or more Fe-Ti oxides have a corresponding CPF intensity value of 2 or more (porphyroclastic foliation - ultramylonitic). The positive correlation may be explained by the Fe-Ti oxides preferentially partitioning strain, especially at temperatures below where dry plagioclase can recrystallize. This allows for a mechanism of continued slip along the shear zone or form new shear zones at amphibolite grade conditions while the lower

PB1-F2 Protein Does Not Impact the Virulence of Triple-Reassortant H3N2 Swine Influenza Virus in Pigs but Alters Pathogenicity and Transmission in Turkeys.

Science.gov (United States)

Deventhiran, Jagadeeswaran; Kumar, Sandeep R P; Raghunath, Shobana; Leroith, Tanya; Elankumaran, Subbiah

2016-01-01

PB1-F2 protein, the 11th influenza A virus (IAV) protein, is considered to play an important role in primary influenza virus infection and postinfluenza secondary bacterial pneumonia in mice. The functional role of PB1-F2 has been reported to be a strain-specific and host-specific phenomenon. Its precise contribution to the pathogenicity and transmission of influenza virus in mammalian host, such as swine, and avian hosts, such as turkeys, remain largely unknown. In this study, we explored the role of PB1-F2 protein of triple-reassortant (TR) H3N2 swine influenza virus (SIV) in pigs and turkeys. Using the eight-plasmid reverse genetics system, we rescued wild-type SIV A/swine/Minnesota/1145/2007 (H3N2) (SIV 1145-WT), a PB1-F2 knockout mutant (SIV 1145-KO), and its N66S variant (SIV 1145-N66S). The ablation of PB1-F2 in SIV 1145 modulated early-stage apoptosis but did not affect the viral replication in swine alveolar macrophage cells. In pigs, PB1-F2 expression did not affect nasal shedding, lung viral load, immunophenotypes, and lung pathology. On the other hand, in turkeys, SIV 1145-KO infected poults, and its in-contacts developed clinical signs earlier than SIV 1145-WT groups and also displayed more extensive histopathological changes in intestine. Further, turkeys infected with SIV 1145-N66S displayed poor infectivity and transmissibility. The more extensive histopathologic changes in intestine and relative transmission advantage observed in turkeys infected with SIV 1145-KO need to be further explored. Taken together, these results emphasize the host-specific roles of PB1-F2 in the pathogenicity and transmission of IAV. Novel triple-reassortant H3N2 swine influenza virus emerged in 1998 and spread rapidly among the North American swine population. Subsequently, it showed an increased propensity to reassort, generating a range of reassortants. Unlike classical swine influenza virus, TR SIV produces a full-length PB1-F2 protein, which is considered an important

45 CFR 35.7 - Payment of approved claims.

Science.gov (United States)

2010-10-01

... duly authorized agent shall sign the voucher for payment, Standard Form 1145, before payment is made. (b) When the claimant is represented by an attorney, the voucher for payment (SF 1145) shall... 45 Public Welfare 1 2010-10-01 2010-10-01 false Payment of approved claims. 35.7 Section 35.7...

40 CFR 10.7 - Payment of approved claim.

Science.gov (United States)

2010-07-01

..., claimant or his duly authorized agent shall sign the voucher for payment, Standard Form 1145, before payment is made. (b) When the claimant is represented by an attorney, the voucher for payment (SF 1145... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Payment of approved claim. 10.7 Section...

Resonance – Journal of Science Education | Indian Academy of ...

Indian Academy of Sciences (India)

Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 12. Perkin's Mauve: The History of the Chemistry. Andrew Filarowski. Volume 16 Issue 12 December 2011 pp 1140-1145. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/016/12/1140-1145 ...

76 FR 47985 - Standard Instrument Approach Procedures, and Takeoff Minimums and Obstacle Departure Procedures...

Science.gov (United States)

2011-08-08

...;Prices of new books are listed in the first FEDERAL REGISTER issue of each #0;week. #0; #0; #0; #0;#0... and Takeoff Minimums and ODP copies may be obtained from: 1. FAA Public Inquiry Center (APA-200), FAA... Minimums and ODPs, in addition to their complex nature and the need for a special format make publication...

ALX 111: ALX1-11, parathyroid hormone (1-84) - NPS Allelix, PREOS, PTH, recombinant human parathyroid hormone, rhPTH (1-84).

Science.gov (United States)

2003-01-01

ALX 111 [parathyroid hormone (1-84) - NPS Allelix, recombinant human parathyroid hormone, rhPTH (1-84), PREOS] is a full-length, recombinant human parathyroid hormone. It has potential as an anti-osteoporotic agent, due to its properties as a bone formation stimulant. This profile has been selected from R&D Insight, a pharmaceutical intelligence database produced by Adis International Ltd. It has been recommended that ALX 111 should be given for 1 to 2 years and may be given in combination with an antiresorptive agent, such as estrogen or a bisphosphonate. In December 1999, Allelix Biopharmaceuticals merged with NPS Pharmaceuticals. This combined company is operating as NPS Pharmaceuticals in the US and as NPS Allelix in Canada. The merger has enabled a phase III study of ALX 111 to begin in the US, Europe and South America. NPS harmaceuticals has signed an agreement with Bio-Imaging Technologies, which will provide all image handling and analysis for this trial. Until 1994, Allelix Biopharmaceuticals and Glaxo in Canada were involved in a joint venture to investigate the efficacy of ALX 111 in osteoporosis. Allelix was subsequently, until September 1998, collaborating with Astra of Sweden in developing ALX 111. Astra had acquired exclusive worldwide rights to ALX 111 and was responsible for development of the agent. However, Astra returned all rights to ALX 111 to Allelix as a result of its merger with Zeneca to form AstraZeneca. In December 1999, Allelix Biopharmaceuticals merged with NPS Pharmaceuticals. This combined company is operating as NPS Pharmaceuticals in the US and as NPS Allelix in Canada. The merger has enabled a phase III study of ALX 111 to begin in the US, Europe and South America. The phase III trial of ALX 111 for the treatment of osteoporosis has completed patient enrolment, and phase II trials have been completed in Canada and the Netherlands. The 18-month, phase III, multicentre, placebo-controlled trial (Treatment of Osteoporosis with

BAKARA/184. AYETİN MEÂLİ ÜZERİNDEN HÜSEYİN KAZIM KADRİ’NİN NÛRU’L‐BEYÂN’INA BİR BAKIŞ

Directory of Open Access Journals (Sweden)

Osman KARA

2014-06-01

Full Text Available Cumhuriyetin ilk yıllarında başkanlığınıHüseyin Kazım Kadri’nin (ö. 1934 yaptığıbir heyet tarafından kaleme alınan Nûru’l BeyânadlıKur’an tercümesinde, Bakara Suresi’nin 184. ayetine verilen anlam, o dönemde ciddi tartışmalara konu olmuş, hatta tartışmaya dönemin Diyanet İşleri  Başkanıda katılmıştır. İşte bu yazısöz konusu tartışmalarımerkeze alarak Bakara 2/184 ayetinin mana ve medlulünü tespite çalışmayıhedeflemektedir. Bu yüzden makalede evvelemirde söz konusu ayetin tercümesi etrafında gündeme gelen tartışmalarızikredeceğiz, akabinde de İslam tefsir geleneğinde bu ayet çerçevesinde serdedilen mana takdirlerini ve yorumlarınıkaydetmeye çalışacağız, buradan hareketle de ayetin mana ve medlulünü tespite çalışacağız.

Notes on the present situation of Anastrepha fraterculus in Argentina

International Nuclear Information System (INIS)

Manso, F.; Basso, A.

1999-01-01

Behavioural and karyotypical results from Anastrepha fraterculus samples received in our laboratory during the period 92-94 are discussed. The work represents the partial situation of this pest in Argentina. Data from guava fruits indicate 1) that the oviposition behaviour does not agree with the autocontrol mechanism via ODP previously described, 2) that a selection mechanism associated to fruit size and quality exists, allowing the female to choose the oviposition site, 3) if different varieties of fruits are available, then the fly shows preference for one of them. The oviposition behaviour in samples of peaches is different from that observed on guava samples and agrees with the ODP mechanism. In some localities, A. fraterculus and C. capitata share the same substrate or fruit (same unit). Samples from commercial oranges do not show evidence of Anastrepha attack. A more frequent karyotype fArg 1 (wild type karyotype) as well as high karyotypic variation, mainly measured through the polymorphism of sexual chromosomes, are present within different geographic populations sharing the same host species. To date, we do not have enough information to associate a particular behaviour to a karyotype. The chromosomal analysis is merely descriptive. (author)

Towards an Accurate Orbital Calibration of Late Miocene Climate Events: Insights From a High-Resolution Chemo- and Magnetostratigraphy (8-6 Ma) from Equatorial Pacific IODP Sites U1337 and U1338

Science.gov (United States)

Drury, A. J.; Westerhold, T.; Frederichs, T.; Wilkens, R.; Channell, J. E. T.; Evans, H. F.; Hodell, D. A.; John, C. M.; Lyle, M. W.; Roehl, U.; Tian, J.

2015-12-01

In the 8-6 Ma interval, the late Miocene is characterised by a long-term -0.3 ‰ reduction in benthic foraminiferal δ18O and distinctive short-term δ18O cycles, possibly related to dynamic Antarctic ice sheet variability. In addition, the late Miocene carbon isotope shift (LMCIS) marks a permanent long-term -1 ‰ shift in oceanic δ13CDIC, which is the largest, long-term perturbation in the global marine carbon cycle since the mid Miocene Monterey excursion. Accurate age control is crucial to investigate the origin of the δ18O cyclicity and determine the precise onset of the LMCIS. The current Geological Time Scale in the 8-6 Ma interval is constructed using astronomical tuning of sedimentary cycles in Mediterranean outcrops. However, outside of the Mediterranean, a comparable high-resolution chemo-, magneto-, and cyclostratigraphy at a single DSDP/ODP/IODP site does not exist. Generating an accurate astronomically-calibrated chemo- and magneto-stratigraphy in the 8-6 Ma interval became possible with retrieval of equatorial Pacific IODP Sites U1337 and U1338, as both sites have sedimentation rates ~2 cm/kyr, high biogenic carbonate content, and magnetic polarity stratigraphies. Here we present high-resolution correlation of Sites U1337 and U1338 using Milankovitch-related cycles in core images and X-ray fluorescence core scanning data. By combining inclination and declination data from ~400 new discrete samples with shipboard measurements, we are able to identify 14 polarity reversals at Site U1337 from the young end of Chron C3An.1n (~6.03 Ma) to the onset of Chron C4n.2n (~8.11 Ma). New high-resolution (<1.5 kyr) stable isotope records from Site U1337 correlate highly with Site U1338 records, enabling construction of a high-resolution stack. Initial orbital tuning of the U1337-U1338 records show that the δ18O cyclicity is obliquity driven, indicating high-latitude climate forcing. The LMCIS starts ~7.55 Ma and is anchored in Chron C4n.1n, which is

34 CFR 35.7 - Payment of approved claims.

Science.gov (United States)

2010-07-01

... sign the voucher for payment, Standard Form 1145, before payment is made. (b) When the claimant is represented by an attorney, the voucher for payment (SF 1145) shall designate both the claimant and his... 34 Education 1 2010-07-01 2010-07-01 false Payment of approved claims. 35.7 Section 35.7 Education...

12 CFR 793.7 - Payment of approved claims.

Science.gov (United States)

2010-01-01

... voucher for payment, Standard Form 1145, before payment is made. (b) When the claimant is represented by an attorney, the voucher for payment (S.F. 1145) shall designate both the claimant and his attorney... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Payment of approved claims. 793.7 Section 793.7...

16 CFR 1145.1 - Scope.

Science.gov (United States)

2010-01-01

... be eliminated or reduced to a sufficient extent by action under the Federal Hazardous Substances Act...), or the Flammable Fabrics Act (FFA) (15 U.S.C. 1191-1204) will be regulated under the Consumer Product...

Variability induced by spaceflight environment on high oil and normal maize lines

International Nuclear Information System (INIS)

Xu Xiaowei; Xu Li; Dong Xin; Jin Weiwei; Chen Shaojiang

2011-01-01

High oil inbred line BY815 and two normal inbred lines 1145 and F349 treated with spaceflight were used for variability analysis. Results showed that the mutation rate of BY815 was 21.61% in SP 1 , while the mutation rates of 1145 and F349 were 2.57% and 3.13% respectively. Only six mutants were found from these three materials in SP 2 , of which two mutants, HT-3 from BY815 exhibiting albino leaf color and HT-5 from 1145 exhibiting stripe-like spots leaves, were worthy of further study. Genetic analysis of the two mutants showed that the segregation ratio of normal and mutant phenotypes was 3 : 1, which was in accordance with Mendel's single gene inheritance law. Cytological observation of all the six mutants showed no chromosome abnormalities. By using SSR (simple sequence repeat) method, 130 pairs of primers were employed and only one mutant originated from inbred line 1145 showed polymorphic and the mutated loci rate of the genome in this mutant was 8.46%. (authors)

Origin of ash in the Central Indian Ocean Basin and its implication for the volume estimate of the 74,000 year BP Youngest Toba eruption

Digital Repository Service at National Institute of Oceanography (India)

Pattan, J.N.; Pearce, N.J.G.; Banakar, V.K.; Parthiban, G.

.86) 4.22 (0 .33) ? 4.94 N 91 274 72 53 16 1, Central Indian Ocean Basin 7 (present study); 2, YTT from Sum a tra, Malaysia, Bay of Bengal and India 10 ; 3, YTT from the Indian subcont i- nent 15 ; 4, YTT from....4 7.5 6.6 5.9 6.9 6.9 5.1 5.8 6.5 1, Central Indian Ocean Basin (pr esent study, n = 8); 2, YTT from Sumatra, Malaysia, ODP site 758, Bay of Bengal and India 10 ( n...

Major turbidity flows in the Western Indus Fan between 290 and 360 kyr

Digital Repository Service at National Institute of Oceanography (India)

Govil, P.; Naidu, P.D.; Radhika, T.K.

controlled by the surface - water biological production, rate of dissolution du r- ing its journey through the water column as well as on the sea floor and dilution by the non - carbonate fraction and terr i- genous matter 7 . The ODP Site 720A... sediment a- tion of a few centimetres thickness within the main feeder channel and Indus Canyon. This kind o f turbidite sedime n- tation was noticed on the eastern part of the Indus Fan du r- ing the Last Glacial Maximum when the sea level was low 10...

Deposition of pyromagnetically-enhanced Marlboro Clay offset from spherule peak at onset of CIE and Paleocene-Eocene boundary at the midshelf Millville core site (NJ Coastal Plain)

Science.gov (United States)

Kent, D. V.; Lanci, L.; Wang, H.; Wright, J.

2017-12-01

magnetotactic bacteria. The pyromagnetic enhancement of soils and their (re)deposition can be viewed as local manifestations of a major event that triggered various global reverberations. For example, there is no counterpart of the Marlboro Clay in ODP Site 1051 on Blake Nose where a spherule layer was also found at the onset of the CIE (Schaller+2016 op. cit.).

Multicenter study of pars plana vitrectomy for optic disc pit maculopathy: MACPIT study.

Science.gov (United States)

Avci, R; Kapran, Z; Ozdek, Ş; Teke, M Y; Oz, O; Guven, D; Yilmaz, S; Kaderli, B; Durukan, A H; Sobaci, G; Unver, Y B; Akduman, L; Kaynak, S; Dogan, I; Inan, U U

2017-09-01

PurposeTo evaluate surgical intervention with pars plana vitrectomy (PPV) for correction of optic disc pit maculopathy (ODP-M).Patients and methodsRetrospective chart review from 13 centres of 51 eyes of 50 patients with ODP-M who underwent PPV between 2002-2014. Anatomic and final best-corrected visual acuity (BCVA) outcomes were evaluated for all cases with different adjuvant techniques.ResultsThere were 23 males and 27 females with median age 25.5 (6-68) years. Preoperative median foveal thickness was 694.5 (331-1384) μm and improved to 252.5 (153-1405) μm. Median BCVA improved from 20/200 (20/20000 to 20/40) to 20/40 (20/2000 to 20/20) with 20/40 or better in 31 eyes. Complete retinal reattachment was achieved in 44 eyes (86.3%) at 7.1 (5.9) months. The good surgical outcomes were achieved in different adjuvant groups. Median follow-up was 24 (6 to 120) months.ConclusionsThese results confirm the long-term effectiveness of PPV for ODP-M. Prospective studies are needed to determine the effectiveness of any adjuvant technique in improving the success of PPV for ODP-M.

Angular momentum distribution for the formation of evaporation residues in fusion of 19F with 184W near the Coulomb barrier

International Nuclear Information System (INIS)

Nath, S.; Gehlot, J.; Prasad, E.; Sadhukhan, Jhilam; Shidling, P.D.; Madhavan, N.; Muralithar, S.; Golda, K.S.; Jhingan, A.; Varughese, T.; Rao, P.V. Madhusudhana; Sinha, A.K.; Pal, Santanu

2011-01-01

We present γ-ray multiplicity distributions for the formation of evaporation residues in the fusion reaction 19 F + 184 W → 203 83 Bi 120 at beam energies in the range of 90-110 MeV. The measurements were carried out using a 14 element BGO detector array and the Heavy Ion Reaction Analyzer at the Inter University Accelerator Centre. The data have been unfolded to obtain angular momentum distributions with inputs from the statistical model calculation. Comparison with another neighboring system, viz. 19 F + 175 Lu → 194 80 Hg 114 with nearly similar entrance-channel mass asymmetry, hints at the depletion of higher angular momenta after crossing of the Z=82 shell in the compound nucleus.

Analysis of steam generator tube rupture as a severe accident using MELCOR 1.8.4

International Nuclear Information System (INIS)

Yang Hongrun; Hidaka, Akihide; Sugimoto, Jun

1999-03-01

This report presents the results from the MELCOR 1.8.4 calculations for Steam Generator Tube Rupture (SGTR) with stuck open of all the safety valves in faulted SG as a severe accident. The calculations are based on Surry nuclear power plant. After performed using the once-through primary system model alone by 1.0x10 5 s, the calculations were conducted with both of the once-through and the hot leg countercurrent natural circulation models. The results, including event sequences, processes and progressions of core degradation, radionuclides release from core and reactor cavity, and source terms to the environment are described in detail. It is concluded that the availability of High Pressure Safety Injection (HPSI) can significantly delay the progression of core heat-up and approximately 7% of cesium iodide (CsI) can be released to the environment directly through the stuck open safety valve. Comparisons between the results from the two models are also given in this report. The present analyses also showed that during SGTR accident, the hot leg countercurrent natural circulation flow cannot be established well and therefore it has little effect on the mitigation of the core degradation. (author)

Testing the ``Wildfire Hypothesis:'' Terrestrial Organic Carbon Burning as the Cause of the Paleocene-Eocene Boundary Carbon Isotope Excursion

Science.gov (United States)

Moore, E. A.; Kurtz, A. C.

2005-12-01

The 3‰ negative carbon isotope excursion (CIE) at the Paleocene-Eocene boundary has generally been attributed to dissociation of seafloor methane hydrates. We are testing the alternative hypothesis that the carbon cycle perturbation resulted from wildfires affecting the extensive peatlands and coal swamps formed in the Paleocene. Accounting for the CIE with terrestrial organic carbon rather than methane requires a significantly larger net release of fossil carbon to the ocean-atmosphere, which may be more consistent with the extreme global warming and ocean acidification characteristic of the Paleocene-Eocene Thermal Maximum (PETM). While other researchers have noted evidence of fires at the Paleocene-Eocene boundary in individual locations, the research presented here is designed to test the "wildfire hypothesis" for the Paleocene-Eocene boundary by examining marine sediments for evidence of a global increase in wildfire activity. Such fires would produce massive amounts of soot, widely distributed by wind and well preserved in marine sediments as refractory black carbon. We expect that global wildfires occurring at the Paleocene-Eocene boundary would produce a peak in black carbon abundance at the PETM horizon. We are using the method of Gelinas et al. (2001) to produce high-resolution concentration profiles of black carbon across the Paleocene-Eocene boundary using seafloor sediments from ODP cores, beginning with the Bass River core from ODP leg 174AX and site 1209 from ODP leg 198. This method involves the chemical and thermal extraction of non-refractory carbon followed by combustion of the residual black carbon and measurement as CO2. Measurement of the δ 13C of the black carbon will put additional constraints on the source of the organic material combusted, and will allow us to determine if this organic material was formed prior to or during the CIE.

The environment and vegetation of the flux measurement site near Skukuza, Kruger National Park

Directory of Open Access Journals (Sweden)

R.J. Scholes

2001-07-01

Full Text Available The SAFARI-2000 intensive study site is located 13 km WSW of Skukuza. Detailed measurements of the exchanges of energy, water, carbon dioxide and other substances between the savanna and the atmosphere have been made there since April 2000. This paper provides basic information regarding the climate, soils and vegetation at the site. The site is located near the top of a gentle rise in an undulating granitic landscape. Most of the data were collected within a 300 m square centred on the flux tower situated at 25@01.184' S, 31@29.813' E and oriented true north. The tower stands exactly on the ecotone between a ridgetop broad-leafed Combretum savanna on sandy soil and a midslope fme-leafed Acacia savanna on clayey soil. The ecotone is marked by a 10 m wide band of sedges. The tree basal area within the sample square was 6.8 mVha (@ 1.0 standard error, the tree density 128 @ 16 plants/ha and the tree crown cover 24 @ 4 . Shrubs, defined as woody plants greater than 0.5 m but less than 2.5 m tall, contributed a further 7.6 crown cover. The basal area weighted mean height of the trees was 9 m, and the maximum height 13m. Nineteen woody plant species were recorded within the square, with 70 of the woody plant basal area dominated by Combretum apiculatum, Sclerocarya birrea and Acacia nigrescens. The rooted basal area of grasses was 7.1 @ 0.6 and in June 2000 the grass standing crop was 400 g DM m2.

The dual FAAH/MAGL inhibitor JZL195 has enhanced effects on endocannabinoid transmission and motor behavior in rats as compared to those of the MAGL inhibitor JZL184

OpenAIRE

Seillier, Alexandre; Aguilar, David Dominguez; Giuffrida, Andrea

2014-01-01

The biological actions of the endocannabinoids anandamide and 2-arachidonoyl glycerol (2-AG) are terminated by enzymatic hydrolysis of these lipids via fatty acid amide hydrolase (FAAH ) and monoacylglycerol lipase (MAGL), respectively. While several selective FAAH inhibitors have been developed and characterized in vitro and in vivo, none of the initial MAGL blockers have shown adequate potency and specificity for in vivo applications. More recently, a selective MAGL inhibitor, JZL184, has b...

Analysis of foundation type alternative and deep-excavation on candidate site location of Panjang Island, Serang

International Nuclear Information System (INIS)

Heri Syaeful; June Mellawati

2013-01-01

Panjang Island is one of the alternatives location which is being studied as NPP site candidate. Its soil surface dominated by sand and eggshell deposit to the depth of tens of meter, beside that also the interlayer of sand and clay to the depth of 120 m. Purpose of the research is to analyze the alternative of foundation type and simulation of deep-excavation during foundation construction especially related to the slope stability aspect. The methods includes data collection of the analysis result of soil/rock mechanical laboratory, measurement of shear wave velocity by PS logging method, and analysis of alternative foundation type and deep-excavation. The analysis result of foundation type that can be applied on Panjang Island candidate site is combination of raft and pile foundation. Rock with Vs > 400 m/s in depth of 44 meter could be made as base of raft foundation construction. In the bottom it connected to pile foundation which is constructed to base rock in the depth of 120 m in Vs > 900 m/s. The result of slope stability analysis on deep-excavation with slope height of 44 m, vertical angle, on normal condition yield safety factor of 0,184 and on the condition of seismic load 0,138. Simulation of anchor installation with spacing 1.25 m as much as 15 pieces yield safety factor higher than 1.0 m. (author)

Insights on the evolution of mid-ocean basins: the Atlantis Basin of southern Azores

Science.gov (United States)

Alves, T.; Bouriak, S.; Volkonskaya, A.; Monteiro, J.; Ivanov, M.

2003-04-01

Single-channel seismic reflection and sidescan (OKEAN) data acquired in an unstudied region of the North Atlantic give important insights on the evolution of mid-ocean basins. Located on the eastern flank of the Mid-Atlantic Ridge, south of the Azores Islands, the study area contains more than 1,000 ms two-way travel-time of sediments with a similar seismic stratigraphy to that of ODP sites 950-952 in the Madeira Abyssal Plain. Processed thickness values correspond to a maximum thickness of about 1450 m and an average thickness of more than 500 m based on velocity data from ODP sites 950-952. The structure of the surveyed area and its location in relation to the Madeira Abyssal Plain and Mid-Atlantic Ridge indicate the existence, south of Azores, of two distinct sedimentary basins separated by major structural lineaments (Azores-Gibraltar and Atlantis Fracture Zones) and by seamount chains (Cruiser-Great Meteor Chain, Plato-Atlantis Chain). The basement of the sedimentary basins is irregular, showing multiple dome-shaped volcanic structures identical to those in the Norwegian-Greenland Sea and Madeira Abyssal Plain. However, half-graben/graben basement blocks predominate east of 30ºW underneath a moderately deformed overburden. The complex structure observed most likely reflects changes in the direction and velocity of ocean spreading plus variations in the regional thermal gradients induced by local hot spots. In parallel, some of the sub-surface structures identified next to basin-bounding Fracture Zones may have resulted from transtensional and transpressional tectonism.

PTH(1-84) Replacement Therapy in Hypoparathyroidism (HypoPT): a Randomized Controlled Trial on Pharmacokinetics and Dynamic effects Following 24 Weeks of treatment

DEFF Research Database (Denmark)

Sikjær, Tanja Tvistholm; Amstrup, Anne Kristine; Rolighed, Lars

In HypoPT, lack of PTH necessitates treatment with calcium and vitamin D analogues in order to avoid hypocalcemia. To study if replacement with the missing hormone possesses advantages, we randomized 62 patients with HypoPT to 24-wks with a daily SC injection in the thigh of PTH(1-84) 100 μg...... or similar placebo, as add to conventional therapy. At end of study, we performed a 24h biochemical monitoring on 39 patients (22 on PTH) in order to assess effects on diurnal variations in calcium-phosphate homeostasis. Following injection, blood samples were obtained at 0.25, 0.5, 1.0, 1.5, 2, 3, 4, 5, 6...

Gender differences in the relative age effect among US olympic development program youth soccer players.

Science.gov (United States)

Vincent, John; Glamser, Francis D

2006-04-01

A large body of research has shown that a disproportionate number of elite youth male soccer players competing in age-segmented competition are born early in the selection year. The advantage of being born early in a cohort has been termed the "relative age effect". Although there has been an exponential growth in women's soccer, few studies have examined the relative age effect in female youth soccer. This study compared the relative age effect of 1,344 female and male youth soccer players considered by the US Olympic Development Program (ODP), in 2001, to be the most talented soccer players born in 1984. The birth dates were taken from the women's state and regional ODP, and national team rosters, and were analysed using basic descriptive statistics and chi-square tests. Results revealed only a marginal relative age effect for female ODP regional and national team players and no relative age effect for female ODP state team players. In comparison, a strong relative age effect was found in male state, regional and national team players. The results suggest that there are gender differences in the relative age effect of 17-year-old elite female and male soccer players. The gender differences may be explained by a complex interaction of biological and maturational differences with socialization influences.

Desktop-Stereolithography 3D-Printing of a Poly(dimethylsiloxane)-Based Material with Sylgard-184 Properties.

Science.gov (United States)

Bhattacharjee, Nirveek; Parra-Cabrera, Cesar; Kim, Yong Tae; Kuo, Alexandra P; Folch, Albert

2018-05-01

The advantageous physiochemical properties of poly(dimethylsiloxane) (PDMS) have made it an extremely useful material for prototyping in various technological, scientific, and clinical areas. However, PDMS molding is a manual procedure and requires tedious assembly steps, especially for 3D designs, thereby limiting its access and usability. On the other hand, automated digital manufacturing processes such as stereolithography (SL) enable true 3D design and fabrication. Here the formulation, characterization, and SL application of a 3D-printable PDMS resin (3DP-PDMS) based on commercially available PDMS-methacrylate macromers, a high-efficiency photoinitiator and a high-absorbance photosensitizer, is reported. Using a desktop SL-printer, optically transparent submillimeter structures and microfluidic channels are demonstrated. An optimized blend of PDMS-methacrylate macromers is also used to SL-print structures with mechanical properties similar to conventional thermally cured PDMS (Sylgard-184). Furthermore, it is shown that SL-printed 3DP-PDMS substrates can be rendered suitable for mammalian cell culture. The 3DP-PDMS resin enables assembly-free, automated, digital manufacturing of PDMS, which should facilitate the prototyping of devices for microfluidics, organ-on-chip platforms, soft robotics, flexible electronics, and sensors, among others. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Annual report for 1979, Results of environmental radioactivity control on the 'B. Kidric' Institute site - precipitations, dust deposition, soil, plants, river sludge (Danube), Annex 2; Godisnji izvestaj za 1979. godinu, Rezultati rada na poslovima kontrole radioaktivnosti zivotne sredine na teritoriji Instituta 'B.Kidric' Deo: padavine i natalozena prasina, vode, zemljiste, rastinje, recni mulj (Dunav), Prilog 2

Energy Technology Data Exchange (ETDEWEB)

Ajdacic, N; Martic, M; Vujovic, V; Janicijevic, Z; Jovanovic, J [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

1980-10-15

As previously, the control of the environmental radioactivity on the Institute site, was done by measuring the total beta activity of the following samples: precipitation, fallout deposits; water, soil, plants, and water and sediments from the Danube river at 1145 km. The regular control included 1706 samples. In addition to the regular control of the environment of the nuclear facility a number of water and heavy water samples were analyzed related to the repair and renewal actions at the RA reactor. Results of these analyses (total beta activity, electric conductivity and gamma spectrometry) were submitted in separate reports. Upon demand of the dosimetry service responsible for the control of the working environment of Radioisotope Laboratory 070, six samples (surface contamination, plants and soil) were taken from the area behind the HL building where radioactive waste is kept. Total beta activity of these samples has shown significant contamination of the soil and plants. Director and the decontamination service of the radiation protection laboratory were informed immediately about these results so that adequate measures could be undertaken. [Serbo-Croat] Kontrola radioaktivnosti zivotne sredine na teritoriji IBK, kao i prethodnih godina, vrsena je merenjem totalne beta radioaktivnosti uzoraka: padavina i natalozene prasine, voda, zemljista, rastinja i uzoraka vode i sedimenata uzimanih sa 1145 km reke Dunav. U okviru redovne kontrole sakupljeno je 1706 uzoraka. Pored redovne kontrole radioaktivnosti okoline nuklearnog postrojenja obradjeno je i mereno vise uzoraka voda, kao i teske vode (u vezi sa remontom reaktora RA), Rezultati ovih analiza (totalna beta aktivnost, elekticna provodljivost i gama specrometrijska analiza) podneti su u vidu posebnih izvestaja. Na zahtev dozimetrijske sluzbe odgovorne za kontrolu radne sredine u OOUR-070, odredjena je totalna beta aktivnost sest uzoraka briseva, rastinja i zemljista u cilju ustanovljavanja kontaminacije

Si-metasomatism in serpentinized peridotite: The effects of talc-alteration on strontium and boron isotopes in abyssal serpentinites from Hole 1268a, ODP Leg 209

Science.gov (United States)

Harvey, Jason; Savov, Ivan P.; Agostini, Samuele; Cliff, Robert A.; Walshaw, Richard

2014-02-01

Ultramafic rocks recovered from Hole 1268a, Ocean Drilling Program Leg 209, to the south of the 15°20‧N Fracture Zone on the Mid-Atlantic ridge have experienced a complex history of melt depletion and subsequent interaction with a series of fluids under varying temperature and pH conditions. After intense melt depletion, varying degrees of serpentinization at 100-200 °C took place, initially under seawater-like pH conditions. Subsequently, interaction with a higher temperature (300-350 °C) fluid with low (4-5) pH and low MgO/SiO2 resulted in the heterogeneous alteration of these serpentinites to talc-bearing ultramafic lithologies. The proximity of the currently active, high temperature Logatchev hydrothermal field, located on the opposite flank of the Mid-Atlantic ridge, suggests that unlike more distal localities sampled during ODP Leg 209, Hole 1268a has experienced Si-metasomatism (i.e. talc-alteration) by a Logatchev-like hydrothermal fluid. Serpentinite strontium isotope ratios were not materially shifted by interaction with the subsequent high-T fluid, despite the likelihood that this fluid had locally interacted with mid-ocean ridge gabbro. 87Sr/86Sr in the ultramafic lithologies of Hole 1268a are close to that of seawater (c.0.709) and even acid leached serpentinites retain 87Sr/86Sr in excess of 0.707, indistinguishable from Logatchev hydrothermal fluid. On the other hand, boron isotope ratios appear to have been shifted from seawater-like values in the serpentinites (δ11B = c.+40‰) to much lighter values in talc-altered serpentinites (δ11B = +9 to +20‰). This is likely a consequence of the effects of changing ambient pH and temperature during the mineralogical transition from serpentine to talc. Heterogeneous boron isotope systematics have consequences for the composition of ultramafic portions of the lithosphere returned to the convecting mantle by subduction. Inhomogeneities in δ11B, [B] and mineralogy introduce significant uncertainties in

Extraintestinal manifestations in Crohn's disease and ulcerative colitis: results from a prospective, population-based European inception cohort.

Science.gov (United States)

Isene, Rune; Bernklev, Tomm; Høie, Ole; Munkholm, Pia; Tsianos, Epameonondas; Stockbrügger, Reinhold; Odes, Selwyn; Palm, Øyvind; Småstuen, Milada; Moum, Bjørn

2015-03-01

In chronic inflammatory bowel disease (IBD) (Crohn's disease [CD] and ulcerative colitis [UC]), symptoms from outside the gastrointestinal tract are frequently seen, and the joints, skin, eyes, and hepatobiliary area are the most usually affected sites (called extraintestinal manifestations [EIM]). The reported prevalence varies, explained by difference in study design and populations under investigation. The aim of our study was to determine the prevalence of EIM in a population-based inception cohort in Europe and Israel. IBD patients were incepted into a cohort that was prospectively followed from 1991 to 2004. A total of 1145 patients were followed for 10 years. The cumulative prevalence of first EIM was 16.9% (193/1145 patients) over a median follow-up time of 10.1 years. Patients with CD were more likely than UC patients to have immune-mediated (arthritis, eye, skin, and liver) manifestations: 20.1% versus 10.4% (p colitis compared to proctitis in UC increased the risk of EIM. In a European inception cohort, EIMs in IBD were consistent with that seen in comparable studies. Patients with CD are twice as likely as UC patients to experience EIM, and more extensive distribution of inflammation in UC increases the risk of EIM.

The influence of saliva flow stimulation on the absorbed radiation dose to the salivary glands during radioiodine therapy of thyroid cancer using 124I PET(/CT) imaging

International Nuclear Information System (INIS)

Jentzen, Walter; Schmitz, Jochen; Freudenberg, Lutz; Eising, Ernst; Bockisch, Andreas; Stahl, Alexander; Balschuweit, Dorothee; Hilbel, Thomas

2010-01-01

A serious side effect of high-activity radioiodine therapy in the treatment of differentiated thyroid cancer is radiogenic salivary gland damage. This damage may be diminished by lemon-juice-induced saliva flow immediately after 131 I administration. The aim of this study was to assess the effect of chewing lemon slices on the absorbed (radiation) doses to the salivary glands. Ten patients received (pretherapy) 124 I PET(/CT) dosimetry before their first radioiodine therapy. The patients underwent a series of six PET scans at 0.5, 1, 2, 4, 48 and ≥96 h and one PET/CT scan at 24 h after administration of 27 MBq 124 I. Blood samples were also collected at about 2, 4, 24, 48, and 96 h. Contrary to the standard radioiodine therapy protocol, the patients were not stimulated with lemon juice. Specifically, the patients chewed no lemon slices during the pretherapy procedure and neither ate food nor drank fluids until after completion of the last PET scan on the first day. Organ absorbed doses per administered 131 I activity (ODpAs) as well as gland and blood uptake curves were determined and compared with published data from a control patient group, i.e. stimulated per the standard radioiodine therapy protocol. The calculations for both groups used the same methodology. A within-group comparison showed that the mean ODpA for the submandibular glands was not significantly different from that for the parotid glands. An intergroup comparison showed that the mean ODpA in the nonstimulation group averaged over both gland types was reduced by 28% compared to the mean ODpA in the stimulation group (p=0.01). Within each gland type, the mean ODpA reductions in the nonstimulation group were statistically significant for the parotid glands (p=0.03) but not for the submandibular glands (p=0.23). The observed ODpAs were higher in the stimulation group because of increased initial gland uptake rather than group differences in blood kinetics. The 124 I PET(/CT) salivary gland

The influence of saliva flow stimulation on the absorbed radiation dose to the salivary glands during radioiodine therapy of thyroid cancer using {sup 124}I PET(/CT) imaging

Energy Technology Data Exchange (ETDEWEB)

Jentzen, Walter; Schmitz, Jochen; Freudenberg, Lutz; Eising, Ernst; Bockisch, Andreas; Stahl, Alexander [Universitaet Duisburg-Essen, Klinik fuer Nuklearmedizin, Essen (Germany); Balschuweit, Dorothee; Hilbel, Thomas [Fachhochschule Gelsenkirchen, Fachbereich Physikalische Technik, Gelsenkirchen (Germany)

2010-12-15

A serious side effect of high-activity radioiodine therapy in the treatment of differentiated thyroid cancer is radiogenic salivary gland damage. This damage may be diminished by lemon-juice-induced saliva flow immediately after {sup 131}I administration. The aim of this study was to assess the effect of chewing lemon slices on the absorbed (radiation) doses to the salivary glands. Ten patients received (pretherapy) {sup 124}I PET(/CT) dosimetry before their first radioiodine therapy. The patients underwent a series of six PET scans at 0.5, 1, 2, 4, 48 and {>=}96 h and one PET/CT scan at 24 h after administration of 27 MBq {sup 124}I. Blood samples were also collected at about 2, 4, 24, 48, and 96 h. Contrary to the standard radioiodine therapy protocol, the patients were not stimulated with lemon juice. Specifically, the patients chewed no lemon slices during the pretherapy procedure and neither ate food nor drank fluids until after completion of the last PET scan on the first day. Organ absorbed doses per administered {sup 131}I activity (ODpAs) as well as gland and blood uptake curves were determined and compared with published data from a control patient group, i.e. stimulated per the standard radioiodine therapy protocol. The calculations for both groups used the same methodology. A within-group comparison showed that the mean ODpA for the submandibular glands was not significantly different from that for the parotid glands. An intergroup comparison showed that the mean ODpA in the nonstimulation group averaged over both gland types was reduced by 28% compared to the mean ODpA in the stimulation group (p=0.01). Within each gland type, the mean ODpA reductions in the nonstimulation group were statistically significant for the parotid glands (p=0.03) but not for the submandibular glands (p=0.23). The observed ODpAs were higher in the stimulation group because of increased initial gland uptake rather than group differences in blood kinetics. The {sup 124}I PET

Rapid directional changes associated with a 6.5 kyr-long Blake geomagnetic excursion at the Blake-Bahama Outer Ridge

DEFF Research Database (Denmark)

Bourne, Mark; McNiocaill, Conall; Thomas, Alexander

2012-01-01

Geomagnetic excursions are recognized as intrinsic features of the Earth's magnetic field. High-resolution records of field behaviour, captured in marine sedimentary cores, present an opportunity to determine the temporal and geometric character of the field during geomagnetic excursions...... and provide constraints on the mechanisms producing field variability. We present here the highest resolution record yet published of the Blake geomagnetic excursion (similar to 125 ka) measured in three cores from Ocean Drilling Program (ODP) Site 1062 on the Blake-Bahama Outer Ridge. The Blake excursion has...... a controversial structure and timing but these cores have a sufficiently high sedimentation rate (similar to 10 cm ka(-1)) to allow detailed reconstruction of the field behaviour at this site during the excursion. Palaeomagnetic measurements of the cores reveal rapid transitions (

40 CFR 159.184 - Toxic or adverse effect incident reports.

Science.gov (United States)

2010-07-01

... site (e.g., home, yard, commercial turf, agricultural (specify crop), industrial, building/office... domestic animal: (A) Type of animal (e.g., livestock, poultry, bird, fish, household pet e.g., dog/cat etc...

Optic Disc Pit with Sectorial Retinitis Pigmentosa

OpenAIRE

Balikoglu-Yilmaz, Melike; Taskapili, Muhittin; Yilmaz, Tolga; Teke, Mehmet Yasin

2013-01-01

Sectorial retinitis pigmentosa (RP) and optic disc pit (ODP) are rare clinical conditions. We present a 40-year-old woman with a history of mild night blindness and decreased vision in the right eye for about 5 years. Fundus examination revealed retinal pigmentary changes in the superior and inferotemporal sectors covering the macula and reduced arterial calibre and ODP at the temporal edge of the optic disc. In addition, fundus autofluorescence, spectral-domain optical coherence tomography, ...

Design and analysis of group-randomized trials in cancer: A review of current practices.

Science.gov (United States)

Murray, David M; Pals, Sherri L; George, Stephanie M; Kuzmichev, Andrey; Lai, Gabriel Y; Lee, Jocelyn A; Myles, Ranell L; Nelson, Shakira M

2018-06-01

The purpose of this paper is to summarize current practices for the design and analysis of group-randomized trials involving cancer-related risk factors or outcomes and to offer recommendations to improve future trials. We searched for group-randomized trials involving cancer-related risk factors or outcomes that were published or online in peer-reviewed journals in 2011-15. During 2016-17, in Bethesda MD, we reviewed 123 articles from 76 journals to characterize their design and their methods for sample size estimation and data analysis. Only 66 (53.7%) of the articles reported appropriate methods for sample size estimation. Only 63 (51.2%) reported exclusively appropriate methods for analysis. These findings suggest that many investigators do not adequately attend to the methodological challenges inherent in group-randomized trials. These practices can lead to underpowered studies, to an inflated type 1 error rate, and to inferences that mislead readers. Investigators should work with biostatisticians or other methodologists familiar with these issues. Funders and editors should ensure careful methodological review of applications and manuscripts. Reviewers should ensure that studies are properly planned and analyzed. These steps are needed to improve the rigor and reproducibility of group-randomized trials. The Office of Disease Prevention (ODP) at the National Institutes of Health (NIH) has taken several steps to address these issues. ODP offers an online course on the design and analysis of group-randomized trials. ODP is working to increase the number of methodologists who serve on grant review panels. ODP has developed standard language for the Application Guide and the Review Criteria to draw investigators' attention to these issues. Finally, ODP has created a new Research Methods Resources website to help investigators, reviewers, and NIH staff better understand these issues. Published by Elsevier Inc.

Hanford annual first quarter seismic report, fiscal year 1998: Seismicity on and near the Hanford Site, Pasco Basin, Washington

Energy Technology Data Exchange (ETDEWEB)

Hartshorn, D.C.; Reidel, S.P.; Rohay, A.C.

1998-02-01

Hanford Seismic Monitoring provides an uninterrupted collection of high-quality raw and processed seismic data from the Hanford Seismic Network (HSN) for the US Department of Energy and its contractors. The staff also locates and identifies sources of seismic activity and monitors changes in the historical pattern of seismic activity at the hanford Site. The data are compiled, archived, and published for use by the Hanford Site for waste management, Natural Phenomena Hazards assessments, and engineering design and construction. In addition, the seismic monitoring organization works with the Hanford Site Emergency Services Organization to provide assistance in the event of an earthquake on the Hanford Site. The HSN and the Eastern Washington Regional Network (EWRN) consist of 41 individual sensor sites and 15 radio relay sites maintained by the Hanford Seismic Monitoring staff. The operational rate for the first quarter of FY98 for stations in the HSN was 98.5%. The operational rate for the first quarter of FY98 for stations of the EWRN was 99.1%. For the first quarter of FY98, the acquisition computer triggered 184 times. Of these triggers 23 were local earthquakes: 7 in the Columbia River Basalt Group, and 16 in the crystalline basement. The geologic and tectonic environments where these earthquakes occurred are discussed in this report. The most significant earthquakes in this quarter were a series of six events which occurred in the Cold Creek depression (approximately 4 km SW of the 200 West Area), between November 6 and November 11, 1997. All events were deep (> 15 km) and were located in the crystalline basement. The first event was the largest, having a magnitude of 3.49 M{sub c}. Two events on November 9, 1997 had magnitudes of 2.81 and 2.95 M{sub c}, respectively. The other events had magnitudes between 0.7 and 1.2 M{sub c}.

Atmospheric lifetimes and Ozone Depletion Potentials of trans-1-chloro-3,3,3-trifluoropropylene and trans-1,2-dichloroethylene in a three-dimensional model

Directory of Open Access Journals (Sweden)

K. O. Patten

2010-11-01

Full Text Available The chloroalkenes trans-1-chloro-3,3,3-trifluoropropylene (tCFP and trans-1,2-dichloroethylene (tDCE have been proposed as candidate replacements for other compounds in current use that cause concerns regarding potential environmental effects including destruction of stratospheric ozone. Because tCFP and tDCE contain chlorine atoms, the effects of these short-lived compounds on stratospheric ozone must be established. In this study, we derive the atmospheric lifetimes and Ozone Depletion Potentials (ODPs for tCFP and for tDCE assuming emissions from land surfaces at latitudes 30° N to 60° N using the MOZART 3 three-dimensional model of atmospheric chemistry and physics. 53% of the ozone loss due to tCFP and 98% of the ozone loss due to tDCE take place in the troposphere, rather than in the stratosphere as generally expected from longer-lived chlorocarbons. The atmospheric lifetime of tCFP against chemical reaction is 40.4 days, and its ODP is quite small at 0.00034. The tDCE atmospheric lifetime is 12.7 days, and its ODP is 0.00024, which is the lowest ODP found for any chlorocarbon we have studied. Our study suggests that chlorine from tCFP and tDCE are unlikely to affect ozone at quantities likely to be emitted to the atmosphere.

Preferência por local de oviposição de Aedes albopictus (Skuse (Diptera, Culicidae, em relação à presença de imaturos da própria espécie, sob condições de laboratório Aedes (Stegomyia albopictus (Skuse (Diptera, Culicidae, preference for oviposition site related with homospecific immatures presence, under laboratory conditions

Directory of Open Access Journals (Sweden)

Andreia Aparecida Barbosa

2002-12-01

Full Text Available Aedes (Stegomyia albopictus (Skuse, 1894 is an exotic Culicidae species in Brazil. Since its first report in this country, the mosquito has been increasing its geographic distribution. This mosquito is a natural dengue and Japanese Encephalitis virus vector in Asia. The females preference for oviposition sites related with homospecific immature presence was assessed. The experiment was performed with Aedes albopictus from laboratory colony since March ]999, in the Laboratório de Entomologia Médica e Veterinária, Departamento de Zoologia, Universidade Federal do Paraná. The preferred container was the one that kept pupae for 24 hours, with 643 eggs, 30,6% at total. The eggs recipients received 11,45% from total set by the females, and the following numbers to the others: larva 1 (15,79%, larva 2 (14,69%, pupa 1 (20,74%, pupa 2 (30,58%, control (6,75%. Although the ANOVA did not detect significant difference among the treatments, the data possibly indicate that Aedes albopictus prefer laying eggs in containers previously colonized by immature.

Investigation of neutron-rich rare-earth nuclei including the new isotopes 177Tm and 184Lu

International Nuclear Information System (INIS)

Rykaczewski, K.; Gippert, K.L.; Runte, E.; Schmidt-Ott, W.D.; Tidemand-Petersson, P.; Kurcewicz, W.; Nazarewicz, W.

1989-01-01

Decays of neutron-rich isotopes in the rare-earth region were studied by means of on-line mass separation and β-γ spectroscopy using multinucleon-transfer reactions between beams of 136 Xe (9 and 11.7 MeV/u), 186 W (11.7 and 15 MeV/u) and 238 U (11.4 MeV/u) and targets of nat W and Ta. The higher beam energies appear to be advantageous for the production of such isotopes. Two new isotopes were identified: 177 Tm with a half-life T 1/2 = 85±10/15 s, and 184 Lu with T 1/2 ≅ 18 s. A new 47 s-activity found at A = 171 is tentatively assigned to the decay of the new isotope 171 Ho. The properties of the ground and excited states of neutron-rich lanthanide isotopes are interpreted within the shell model using the deformed Woods-Saxon potential. A change of the ground-state configuration for odd-mass neutron-rich lutetium isotopes from π 7/2 + [404] to π 9/2 - [514] is suggested, this change being due to the influence of a large hexadecapole deformation. The role of a possible isometric state in 180 Lu for the nucleosynthesis of 180m Ta is discussed. (orig.)

Comparative Magnetic Minima: Characterizing Quiet Times in the Sun and Stars. Symposium of the International Astronomical Union (286th) Held in Mendoza, Argentina on October 3-7, 2011

Science.gov (United States)

2011-10-01

11:15 – 11:45 Invited Talk – Stars in Magnetic Grand Minima: Where Are They and What Are They Like? Steven Saar (Presentation file) 11:45 – 12:00...of Archaeology and Ancient History, University Rd, Leicester LE1 7RH, United Kingdom IAUS 279 Death of Massive Stars: Supernovae and Gamma-Ray Bursts...of Astronomy & Astrophysics, 525 Davey Lab, University Park, PA 16802, USA IAUS 283 Planetary Nebulae: an Eye to the Future A. MANCHADO, Instituto de

Search for an excess in the production of four-jet events from $e^+ e^-$ collisions at $\\sqrt{s}$ = 130-184 GeV

CERN Document Server

Ackerstaff, K.; Allison, John; Altekamp, N.; Anderson, K.J.; Anderson, S.; Arcelli, S.; Asai, S.; Ashby, S.F.; Axen, D.; Azuelos, G.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Bartoldus, R.; Batley, J.R.; Baumann, S.; Bechtluft, J.; Behnke, T.; Bell, Kenneth Watson; Bella, G.; Bentvelsen, S.; Bethke, S.; Betts, S.; Biebel, O.; Biguzzi, A.; Bird, S.D.; Blobel, V.; Bloodworth, I.J.; Bobinski, M.; Bock, P.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Brigliadori, L.; Brown, Robert M.; Burckhart, H.J.; Burgard, C.; Burgin, R.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Chrisman, D.; Clarke, P.E.L.; Cohen, I.; Conboy, J.E.; Cooke, O.C.; Couyoumtzelis, C.; Coxe, R.L.; Cuffiani, M.; Dado, S.; Dallapiccola, C.; Dallavalle, G.Marco; Davis, R.; De Jong, S.; del Pozo, L.A.; de Roeck, A.; Desch, K.; Dienes, B.; Dixit, M.S.; Doucet, M.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Eatough, D.; Estabrooks, P.G.; Etzion, E.; Evans, H.G.; Evans, M.; Fabbri, F.; Fanfani, A.; Fanti, M.; Faust, A.A.; Feld, L.; Fiedler, F.; Fierro, M.; Fischer, H.M.; Fleck, I.; Folman, R.; Fong, D.G.; Foucher, M.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gascon, J.; Gascon-Shotkin, S.M.; Geddes, N.I.; Geich-Gimbel, C.; Geralis, T.; Giacomelli, G.; Giacomelli, P.; Giacomelli, R.; Gibson, V.; Gibson, W.R.; Gingrich, D.M.; Glenzinski, D.; Goldberg, J.; Goodrick, M.J.; Gorn, W.; Grandi, C.; Gross, E.; Grunhaus, J.; Gruwe, M.; Hajdu, C.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Hargrove, C.K.; Hart, P.A.; Hartmann, C.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herndon, M.; Herten, G.; Heuer, R.D.; Hildreth, M.D.; Hill, J.C.; Hillier, S.J.; Hobson, P.R.; Hocker, James Andrew; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Hutchcroft, D.E.; Igo-Kemenes, P.; Imrie, D.C.; Ishii, K.; Jawahery, A.; Jeffreys, P.W.; Jeremie, H.; Jimack, M.; Joly, A.; Jones, C.R.; Jones, M.; Jost, U.; Jovanovic, P.; Junk, T.R.; Kanzaki, J.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Kayal, P.I.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kirk, J.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Koetke, D.S.; Kokott, T.P.; Kolrep, M.; Komamiya, S.; Kowalewski, Robert V.; Kress, T.; Krieger, P.; von Krogh, J.; Kyberd, P.; Lafferty, G.D.; Lahmann, R.; Lai, W.P.; Lanske, D.; Lauber, J.; Lautenschlager, S.R.; Lawson, I.; Layter, J.G.; Lazic, D.; Lee, A.M.; Lefebvre, E.; Lellouch, D.; Letts, J.; Levinson, L.; List, B.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Ludwig, J.; Lui, D.; Macchiolo, A.; Macpherson, A.; Mannelli, M.; Marcellini, S.; Markopoulos, C.; Markus, C.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; Mckigney, E.A.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Menke, S.; Merritt, F.S.; Mes, H.; Meyer, J.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Mincer, A.; Mir, R.; Mohr, W.; Montanari, A.; Mori, T.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nellen, B.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oh, A.; Oldershaw, N.J.; Oreglia, M.J.; Orito, S.; Palinkas, J.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Perez-Ochoa, R.; Petzold, S.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poffenberger, P.; Poli, B.; Posthaus, A.; Rembser, C.; Robertson, S.; Robins, S.A.; Rodning, N.; Roney, J.M.; Rooke, A.; Rossi, A.M.; Routenburg, P.; Rozen, Y.; Runge, K.; Runolfsson, O.; Ruppel, U.; Rust, D.R.; Sachs, K.; Saeki, T.; Sahr, O.; Sang, W.M.; Sarkisian, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharf, F.; Scharff-Hansen, P.; Schieck, J.; Schleper, P.; Schmitt, B.; Schmitt, S.; Schoning, A.; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Sittler, A.; Skillman, A.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Springer, Robert Wayne; Sproston, M.; Stephens, K.; Steuerer, J.; Stockhausen, B.; Stoll, K.; Strom, David M.; Strohmer, R.; Szymanski, P.; Tafirout, R.; Talbot, S.D.; Taras, P.; Tarem, S.; Teuscher, R.; Thiergen, M.; Thomson, M.A.; von Torne, E.; Torrence, E.; Towers, S.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turcot, A.S.; Turner-Watson, M.F.; Ueda, I.; Utzat, P.; Van Kooten, Rick J.; Vannerem, P.; Verzocchi, M.; Vikas, P.; Vokurka, E.H.; Voss, H.; Wackerle, F.; Wagner, A.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wermes, N.; White, J.S.; Wilson, G.W.; Wilson, J.A.; Wyatt, T.R.; Yamashita, S.; Yekutieli, G.; Zacek, V.; Zer-Zion, D.

1998-01-01

Events with four distinct jets from e^+e^- collisions, collected by the OPAL detector at centre-of-mass energies between 130 and 184 GeV, are analysed for a peak in the sum of dijet masses. This search is motivated by the ALEPH Collaboration's observation of a clear excess of events with dijet mass sums close to 105 GeV in data taken at centre-of-mass energies of 130 and 136 GeV in 1995. We have observed no significant excess of four-jet events compared to the Standard Model expectation for any dijet mass sum at any energy. Our observation is inconsistent with the excess observed by ALEPH in 1995. Upper limits are determined on the production cross-section as a function of the dijet mass sum.

Refinement on geometry of Matuyama-Brunhes polarity transition from paleomagnetic records

Science.gov (United States)

Oda, H.; Fabian, K.; Leonhardt, R.

2012-04-01

The Bayesian model of the Matuyama/Brunhes (MB) geomagnetic polarity reversal was extended from the previous model IMMAB4 (Leonhardt and Fabian, 2007), which was based on one volcanic record and three sedimentary records from the Atlantic sector. The essential improvement on the model was achieved by incorporating a new volcanic record from Tahiti (Mochizuki et al., 2011). This record is unique in that it contains important absolute paleointensity data for the Pacific region, which provide new constraints for the global geomagnetic reversal scenario. The full vector development of transitional geomagnetic field in the central part of the Pacific significantly stabilized the solution in this important region, which was completely missing in the previous model IMMAB4. The sedimentary high-quality record of ODP Site 769 by Oda et al. (2000) previously was only used to check the reliability of the model IMMAB4 by comparing the VGP paths of the model and the data. An integrated sedimentary record of ODP Site 769 was developed from Oda et al. (2000) in combination with the relative paleointensity record provided by Schneider et al. (1992) and Kent&Schneider (1995). The record will also be included into the construction of the new model. Additionally, two records from the Antarctic region (Guyodo et al., 2001; Macri et al., 2010) were found, and might prove useful for further refining the model. To fulfill the aim, we have also revised the data structure, and developed a GUI based correlation software to simplify refinement of the model and further development of the scheme. In the presentation, we will show the revised morphological development of the Earth's magnetic field during Matuyama-Brunhes polarity transition.

Caudal Ganglionic Eminence Precursor Transplants Disperse and Integrate as Lineage-Specific Interneurons but Do Not Induce Cortical Plasticity

Directory of Open Access Journals (Sweden)

Phillip Larimer

2016-08-01

Full Text Available The maturation of inhibitory GABAergic cortical circuits regulates experience-dependent plasticity. We recently showed that the heterochronic transplantation of parvalbumin (PV or somatostatin (SST interneurons from the medial ganglionic eminence (MGE reactivates ocular dominance plasticity (ODP in the postnatal mouse visual cortex. Might other types of interneurons similarly induce cortical plasticity? Here, we establish that caudal ganglionic eminence (CGE-derived interneurons, when transplanted into the visual cortex of neonatal mice, migrate extensively in the host brain and acquire laminar distribution, marker expression, electrophysiological properties, and visual response properties like those of host CGE interneurons. Although transplants from the anatomical CGE do induce ODP, we found that this plasticity reactivation is mediated by a small fraction of MGE-derived cells contained in the transplant. These findings demonstrate that transplanted CGE cells can successfully engraft into the postnatal mouse brain and confirm the unique role of MGE lineage neurons in the induction of ODP.

Site specific information in site selection

International Nuclear Information System (INIS)

Aeikaes, T.; Hautojaervi, A.

1998-01-01

The programme for the siting of a deep repository for final disposal of spent nuclear fuel was started already in 1983 and is carried out today by Posiva Oy which continues the work started by Teollisuuden Voima Oy. The programme aims at site selection by the end of the year 2000. The programme has progressed in successive interim stages with defined goals. After an early phase for site identification, five sites were selected in 1987 for preliminary site characterisation. Three of these were selected and judged to be best suited for the more detailed characterisation in 1992. An additional new site was included into the programme based on a separate feasibility study in the beginning of 1997. Since the year 1983 several safety assessments together with technical plans of the facility have been completed. When approaching the site selection the needs for more detailed consideration of the site specific properties in the safety assessment have been increased. The Finnish regulator STUK has published a proposal for general safety requirements for the final disposal of spent nuclear fuel in Finland. This set of requirements has been projected to be used in conjunction of the decision making by the end 2000. Based on the site evaluation all sites can provide a stable environment and there is evidence that the requirements for the longevity of the canister can be fulfilled at each site. In this manner the four candidate sites do not differ too much from each other. The main difference between the sites is in the salinity of the deep groundwater. The significance of differences in the salinity for the long-term safety cannot be defined yet. The differences may contribute to the discussion of the longevity of the bentonite buffer and also to the modelling of the groundwater flow and transport. The use of the geosphere as a transport barrier is basically culminated on the questions about sparse but fast flow routes and 'how bad channeling can be'. To answer these questions

Plutonium explosive dispersal modeling using the MACCS2 computer code

International Nuclear Information System (INIS)

Steele, C.M.; Wald, T.L.; Chanin, D.I.

1998-01-01

The purpose of this paper is to derive the necessary parameters to be used to establish a defensible methodology to perform explosive dispersal modeling of respirable plutonium using Gaussian methods. A particular code, MACCS2, has been chosen for this modeling effort due to its application of sophisticated meteorological statistical sampling in accordance with the philosophy of Nuclear Regulatory Commission (NRC) Regulatory Guide 1.145, ''Atmospheric Dispersion Models for Potential Accident Consequence Assessments at Nuclear Power Plants''. A second advantage supporting the selection of the MACCS2 code for modeling purposes is that meteorological data sets are readily available at most Department of Energy (DOE) and NRC sites. This particular MACCS2 modeling effort focuses on the calculation of respirable doses and not ground deposition. Once the necessary parameters for the MACCS2 modeling are developed and presented, the model is benchmarked against empirical test data from the Double Tracks shot of project Roller Coaster (Shreve 1965) and applied to a hypothetical plutonium explosive dispersal scenario. Further modeling with the MACCS2 code is performed to determine a defensible method of treating the effects of building structure interaction on the respirable fraction distribution as a function of height. These results are related to the Clean Slate 2 and Clean Slate 3 bunkered shots of Project Roller Coaster. Lastly a method is presented to determine the peak 99.5% sector doses on an irregular site boundary in the manner specified in NRC Regulatory Guide 1.145 (1983). Parametric analyses are performed on the major analytic assumptions in the MACCS2 model to define the potential errors that are possible in using this methodology

Plutonium explosive dispersal modeling using the MACCS2 computer code

Energy Technology Data Exchange (ETDEWEB)

Steele, C.M.; Wald, T.L.; Chanin, D.I.

1998-11-01

The purpose of this paper is to derive the necessary parameters to be used to establish a defensible methodology to perform explosive dispersal modeling of respirable plutonium using Gaussian methods. A particular code, MACCS2, has been chosen for this modeling effort due to its application of sophisticated meteorological statistical sampling in accordance with the philosophy of Nuclear Regulatory Commission (NRC) Regulatory Guide 1.145, ``Atmospheric Dispersion Models for Potential Accident Consequence Assessments at Nuclear Power Plants``. A second advantage supporting the selection of the MACCS2 code for modeling purposes is that meteorological data sets are readily available at most Department of Energy (DOE) and NRC sites. This particular MACCS2 modeling effort focuses on the calculation of respirable doses and not ground deposition. Once the necessary parameters for the MACCS2 modeling are developed and presented, the model is benchmarked against empirical test data from the Double Tracks shot of project Roller Coaster (Shreve 1965) and applied to a hypothetical plutonium explosive dispersal scenario. Further modeling with the MACCS2 code is performed to determine a defensible method of treating the effects of building structure interaction on the respirable fraction distribution as a function of height. These results are related to the Clean Slate 2 and Clean Slate 3 bunkered shots of Project Roller Coaster. Lastly a method is presented to determine the peak 99.5% sector doses on an irregular site boundary in the manner specified in NRC Regulatory Guide 1.145 (1983). Parametric analyses are performed on the major analytic assumptions in the MACCS2 model to define the potential errors that are possible in using this methodology.

Development of an accident consequence assessment code for evaluating site suitability of light- and heavy-water reactors based on the Korean Technical standards

Energy Technology Data Exchange (ETDEWEB)

Hwang, Won Tae; Jeong, Hae Sung; Jeong, Hyo Joon; Kil, A Reum; Kim, Eun Han; Han, Moon Hee [Nuclear Environment Safety Research Division, Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

2016-12-15

Methodologies for a series of radiological consequence assessments show a distinctive difference according to the design principles of the original nuclear suppliers and their technical standards to be imposed. This is due to the uncertainties of the accidental source term, radionuclide behavior in the environment, and subsequent radiological dose. Both types of PWR and PHWR are operated in Korea. However, technical standards for evaluating atmospheric dispersion have been enacted based on the U.S. NRC's positions regardless of the reactor types. For this reason, it might cause a controversy between the licensor and licensee of a nuclear power plant. It was modelled under the framework of the NRC Regulatory Guide 1.145 for light-water reactors, reflecting the features of heavy-water reactors as specified in the Canadian National Standard and the modelling features in MACCS2, such as atmospheric diffusion coefficient, ground deposition, surface roughness, radioactive plume depletion, and exposure from ground deposition. An integrated accident consequence assessment code, ACCESS (Accident Consequence Assessment Code for Evaluating Site Suitability), was developed by taking into account the unique regulatory positions for reactor types under the framework of the current Korean technical standards. Field tracer experiments and hand calculations have been carried out for validation and verification of the models. The modelling approaches of ACCESS and its features are introduced, and its applicative results for a hypothetical accidental scenario are comprehensively discussed. In an applicative study, the predicted results by the light-water reactor assessment model were higher than those by other models in terms of total doses.

Site organization and site arrangement

International Nuclear Information System (INIS)

Boissonnet, B.; Macqueron, J.F.

1976-01-01

The present paper deals with criteria for the choice of a production unit or power plant site, the organization and development of a site in terms of its particular characteristics and takes into account personnel considerations in site organizations as well as the problem of integrating the architecture into the environment. (RW) [de

Minimally invasive versus open distal pancreatectomy (LEOPARD): study protocol for a randomized controlled trial.

Science.gov (United States)

de Rooij, Thijs; van Hilst, Jony; Vogel, Jantien A; van Santvoort, Hjalmar C; de Boer, Marieke T; Boerma, Djamila; van den Boezem, Peter B; Bonsing, Bert A; Bosscha, Koop; Coene, Peter-Paul; Daams, Freek; van Dam, Ronald M; Dijkgraaf, Marcel G; van Eijck, Casper H; Festen, Sebastiaan; Gerhards, Michael F; Groot Koerkamp, Bas; Hagendoorn, Jeroen; van der Harst, Erwin; de Hingh, Ignace H; Dejong, Cees H; Kazemier, Geert; Klaase, Joost; de Kleine, Ruben H; van Laarhoven, Cornelis J; Lips, Daan J; Luyer, Misha D; Molenaar, I Quintus; Nieuwenhuijs, Vincent B; Patijn, Gijs A; Roos, Daphne; Scheepers, Joris J; van der Schelling, George P; Steenvoorde, Pascal; Swijnenburg, Rutger-Jan; Wijsman, Jan H; Abu Hilal, Moh'd; Busch, Olivier R; Besselink, Marc G

2017-04-08

Observational cohort studies have suggested that minimally invasive distal pancreatectomy (MIDP) is associated with better short-term outcomes compared with open distal pancreatectomy (ODP), such as less intraoperative blood loss, lower morbidity, shorter length of hospital stay, and reduced total costs. Confounding by indication has probably influenced these findings, given that case-matched studies failed to confirm the superiority of MIDP. This accentuates the need for multicenter randomized controlled trials, which are currently lacking. We hypothesize that time to functional recovery is shorter after MIDP compared with ODP even in an enhanced recovery setting. LEOPARD is a randomized controlled, parallel-group, patient-blinded, multicenter, superiority trial in all 17 centers of the Dutch Pancreatic Cancer Group. A total of 102 patients with symptomatic benign, premalignant or malignant disease will be randomly allocated to undergo MIDP or ODP in an enhanced recovery setting. The primary outcome is time (days) to functional recovery, defined as all of the following: independently mobile at the preoperative level, sufficient pain control with oral medication alone, ability to maintain sufficient (i.e. >50%) daily required caloric intake, no intravenous fluid administration and no signs of infection. Secondary outcomes are operative and postoperative outcomes, including clinically relevant complications, mortality, quality of life and costs. The LEOPARD trial is designed to investigate whether MIDP reduces the time to functional recovery compared with ODP in an enhanced recovery setting. Dutch Trial Register, NTR5188 . Registered on 9 April 2015.

Transient ElectroMagnetic and Electric Self-Potential survey in the TAG hydrothermal field in MAR

Science.gov (United States)

Tao, C.; Deng, X.; Wu, G.; Xi, Z.; Zhou, D.; Zuo, L.

2012-12-01

The TAG hydrothermal field is one of the most studied hydrothermal fields. This field covers an area of 5km×5km, which includes low-temperature Mn- and Fe-oxides and nontronites zone, relict massive sulfide mounds as well as active hydrothermal mound(TAG mound) [Thompson, 1985, Rona, 1993]. Drilling program was performed in the ODP (Ocean Drilling Program) Leg 158 in the TAG mound [Humphris, 1996]. In 1996, electrical resistivity survey in the TAG mound was conducted using innovative transient electric dipole-dipole instruments which was carried by DSV 'Alvin' [Cairns et al., 1996, Von Herzen et al., 1996]. In June 2012, the 2nd Leg of the Chinese 26th cruise was carried out in the TAG hydrothermal field at Mid Atlantic Ridge by R/V DAYANGYIHAO. Six TEM (Transient ElectroMagnetic) survey lines were deployed, with four of which across the ODP Leg 158 drilling area. Besides, two SP (Electric Self-Potential) survey lines were across the ODP drilling area. The survey results of TEM preliminary revealed the vertical structure of the TAG hydrothermal field. The survey results of both TEM and SP are consistent with the ODP drilling result, and also agree well with the temperature and water-column anomalies obtained in this leg. Preliminary results show that the TEM and SP methods are capable of revealing the horizontal and vertical distribution of the hydrothermal sulfide fields.

Obstetrical Management of an Extremely Overweight Pregnant Woman (184 kg bw with Special Attention on Thromboprophylaxis

Directory of Open Access Journals (Sweden)

Boldizsar Horváth

2013-01-01

Full Text Available The 27-year-old pregnant woman has been overweight since her childhood. Endocrinological assessments did not confirm hormonal disease. Her pregnancy was without complication. A signs of intrauterine distress were observed and elective caesarean section was performed under heparin protection because of anatomy unsuitable for delivery per vias naturals. The mother’s bodyweight was 184 kg. By monitoring the change in fX activity LMWH treatment (Enoxaparin initiated with a dose of 120 mg twice daily and then the dose was gradually elevated to 200 mg twice daily thereby achieving the lower range of the desired therapeutic effect. Apart from mild disorder of wound healing, the recovery was free of complication. The patient suffered from thrombophilia (extremely overweight, pregnant, thrombophlebitis under the knee, surgery, and postoperative immobilization. In case of quite extreme bodyweight there is no dosage recommendation or clinical practice for LMWH. Because of the extreme overweight and the therapeutic dose titration test of heparin, monitoring of fX activity by measurement of inhibition, dosage of heparin other than the recommended (abdominal wall instead of upper arm SC, and the very fluctuating heparin dosage which is well correlating with clinical practice, it is reasonably expected that this case will take interest.

Geochemical implications of gabbro from the slow-spreading Northern Central Indian Ocean Ridge, Indian Ocean

Digital Repository Service at National Institute of Oceanography (India)

Ray, Dwijesh; Misra, S.; Banerjee, R.; Weis, D.

., 1989) and the dynamics of crystallization of plutonic rocks (Bloomer et al., 1989; Meyer et al., 1989). The recovery of gabbroic rocks is mostly restricted to major transform faults or fracture zones transecting mid-ocean ridges, e.g., Mid... gabbro of Indian Ocean Ridge System (Fig 1) is ODP leg 118 from SWIR (Dick et al., 2002; Coogan et al, 2001). Gabbro from Leg 179 (ODP Hole 735B from Atlantis II fracture zone, Dick et al., 2000) and Leg 179 (Hole 1105A) near Leg 118 have also been...

Analysis of Environmental Impact for Concrete Using LCA by Varying the Recycling Components, the Compressive Strength and the Admixture Material Mixing

Directory of Open Access Journals (Sweden)

Taehyoung Kim

2016-04-01

Full Text Available Concrete is a type of construction material in which cement, aggregate, and admixture materials are mixed. When cement is produced, large amounts of substances that impact the environment are emitted during limestone extraction and clinker manufacturing. Additionally, the extraction of natural aggregate causes soil erosion and ecosystem destruction. Furthermore, in the process of transporting raw materials such as cement and aggregate to a concrete production company, and producing concrete in a batch plant, substances with an environmental impact are emitted into the air and water system due to energy use. Considering the fact that the process of producing concrete causes various environmental impacts, an assessment of various environmental impact categories is needed. This study used a life cycle assessment (LCA to evaluate the environmental impacts of concrete in terms of its global warming potential, acidification potential, eutrophication potential, ozone depletion potential, photochemical ozone creation potential, and abiotic depletion potential (GWP, AP, EP, ODP, POCP, ADP. The tendency was that the higher the strength of concrete, the higher the GWP, POCP, and ADP indices became, whereas the AP and EP indices became slightly lower. As the admixture mixing ratio of concrete increased, the GWP, AP, ODP, ADP, and POCP decreased, but EP index showed a tendency to increase slightly. Moreover, as the recycled aggregate mixing ratio of concrete increased, the AP, EP, ODP, and ADP decreased, while GWP and POCP increased. The GWP and POCP per unit compressed strength (1 MPa of high strength concrete were found to be about 13% lower than that for its normal strength concrete counterpart. Furthermore, in the case of AP, EP, ODP, and ADP per unit compressed strength (1 MPa, high-strength concrete was found to be about 10%~25% lower than its normal strength counterpart. Among all the environmental impact categories, ordinary cement was found to have

Isotopes based assessment of groundwater renewal and related anthropogenic effects in water scarce areas: Sand dunes study in Qasim area, Saudi Arabia

International Nuclear Information System (INIS)

Al-Sagaby, A.; Moallim, A.

2001-01-01

The investigation of recharge in the sand dune, Qasim, Saudi Arabia, with the help of chloride concentration and isotope content has revealed inconsistent pattern and less homogeneity. Monotonic chloride concentration and isotope content was the result of seasonal recharge occurrence in the study area. In addition, applying chloride mass-balance method, recharge rate calculation in the sand dune site, Qasim, Saudi Arabia, was made. The results (1.80 and 1.84mmy -1 - dune site) estimated during this project using this method was a long way below the recharge rates (30mmy -1 , 13.4mmy -1 in the dune site and 5mmy -1 in the swale site) obtained with the application of tritium method in the previous years (1994 and 1996). 1.80 and 1.84mmy -1 was for CRP-Saud-9405 project and was calculated 1997 and 1998 respectively. The reason for the lower recharge rate with the application of chloride mass-balance method could be the source of chloride input and high evaporation, which causes accumulation of chloride salts in the area. (author)

Real-Time PCR Quantification and Diversity Analysis of the Functional Genes aprA and dsrA of Sulfate-Reducing Prokaryotes in Marine Sediments of the Peru Continental Margin and the Black Sea.

Science.gov (United States)

Blazejak, Anna; Schippers, Axel

2011-01-01

Sulfate-reducing prokaryotes (SRP) are ubiquitous and quantitatively important members in many ecosystems, especially in marine sediments. However their abundance and diversity in subsurface marine sediments is poorly understood. In this study, the abundance and diversity of the functional genes for the enzymes adenosine 5'-phosphosulfate reductase (aprA) and dissimilatory sulfite reductase (dsrA) of SRP in marine sediments of the Peru continental margin and the Black Sea were analyzed, including samples from the deep biosphere (ODP site 1227). For aprA quantification a Q-PCR assay was designed and evaluated. Depth profiles of the aprA and dsrA copy numbers were almost equal for all sites. Gene copy numbers decreased concomitantly with depth from around 10(8)/g sediment close to the sediment surface to less than 10(5)/g sediment at 5 mbsf. The 16S rRNA gene copy numbers of total bacteria were much higher than those of the functional genes at all sediment depths and used to calculate the proportion of SRP to the total Bacteria. The aprA and dsrA copy numbers comprised in average 0.5-1% of the 16S rRNA gene copy numbers of total bacteria in the sediments up to a depth of ca. 40 mbsf. In the zone without detectable sulfate in the pore water from about 40-121 mbsf (Peru margin ODP site 1227), only dsrA (but not aprA) was detected with copy numbers of less than 10(4)/g sediment, comprising ca. 14% of the 16S rRNA gene copy numbers of total bacteria. In this zone, sulfate might be provided for SRP by anaerobic sulfide oxidation. Clone libraries of aprA showed that all isolated sequences originate from SRP showing a close relationship to aprA of characterized species or form a new cluster with only distant relation to aprA of isolated SRP. For dsrA a high diversity was detected, even up to 121 m sediment depth in the deep biosphere.

[Organ donation following physician-hastened death at home].

Science.gov (United States)

Mulder, J G H; Sonneveld, J P C

2017-01-01

Patients considering physician-hastened death (PHD) increasingly express a wish to donate organs after death. This fairly unique proposition stems from patients' desire to do something good with (parts of) the same diseased body that has prompted them to request physician-hastened death. In this article we describe a patient with amyotrophic lateral sclerosis (ALS) who expressed this wish. In March 2017 a national guideline on 'Organ donation following physician-hastened death' (ODP) was presented to the Minister of Health, Welfare and Sport of the Netherlands. From the development of this guideline it emerged that, for PHD patients, being forced to experience their final conscious moments in hospital - in order to facilitate organ donation - was a key reason for not choosing ODP. Together with an anaesthesiologist-intensivist, the GP of the ALS patient developed a domestic ODP, thereby overcoming the hurdle of experiencing death in hospital and maintaining the possible option of organ donation. The applied solution is an 'anaesthesia bridge' which separates the experience of farewells, and losing consciousness under pre-medication at home, from biological death and organ donation in hospital.

Resolving the Subsidence Anomaly of the East Tasman Plateau Using New Insights from the Cascade Seamount, Southwest Tasman Sea

Science.gov (United States)

Vorsanger, S. L.; Scher, H.; Johnson, S.; Mundana, R.; Sauermilch, I.; Duggan, B.; Whittaker, J. M.

2017-12-01

The Cascade Seamount is a wave-planated feature located on the microcontinent of the East Tasman Plateau (ETP). The minimum subsidence rate of the Seamount and the ETP can be estimated by dividing the present-day depth of the wave-cut surface (640 m) by the age of Cascade Seamount basalts as determined by potassium-argon (K-Ar) dating (33.4 and 36 Ma). This approach yields a subsidence rate of 18 m/Myr. However, significantly more rapid subsidence rates of the East Tasman Plateau (ETP) — upon which the Cascade Seamount rests — since the Eocene-Oligocene transition have been proposed utilizing a nearby sediment core, Ocean Drilling Program (ODP) Site 1172. Late Eocene paleodepths determined by Stickley et al. (2004) using sedimentological and biostratigraphic techniques, indicate a subsidence rate of 85 m/Myr for the ETP. These two results present a paradox, which implies that the ETP subsided at a rate greater than the Seamount itself, over the same time interval. It also implies that the seamount formed above sea level. The subsidence ambiguity may be attributed to the presence of a turbidity current deposit in the sediment core, or uncertainty in the age and/or location of the K-Ar dated basalts of the Cascade Seamount. Statistical analysis of the published grain size measurements will be used to test for the presence of a turbidity current deposit in ODP Site 1172. We will also measure 87Sr/86Sr ratios of marine carbonate samples from conglomerates obtained from the Cascade Seamount during the August 2016 RV Investigator voyage (IN2016_E01) to confirm the age of the wave planated surfaces by Strontium Isotope Stratigraphy. This will allow for a more robust calculation for the subsidence of the ETP which was a critical barrier in the Tasmanian Gateway that allowed for the formation of the Antarctic Circumpolar Current.

Changes in ocean circulation in the South-east Atlantic Ocean during the Pliocene

Science.gov (United States)

Petrick, B. F.; McClymont, E.; Felder, S.; Leng, M. J.

2013-12-01

The Southeast Atlantic Ocean is an important ocean gateway because major oceanic systems interact with each other in a relatively small geographic area. These include the Benguela Current, Antarctic Circumpolar Current, and the input of warm and saline waters from the Indian Ocean via the Agulhas leakage. However, there remain questions about circulation change in this region during the Pliocene, including whether there was more or less Agulhas Leakage, which may have implications for the strength of the global thermohaline circulation. ODP Site 1087 (31°28'S, 15°19'E, 1374m water depth) is located outside the Benguela upwelling region and is affected by Agulhas leakage in the modern ocean. Sea-surface temperatures (SSTs) are thus sensitive to the influence of Agulhas Leakage at this site. Our approach is to apply several organic geochemistry proxies and foraminiferal analyses to reconstruct the Pliocene history of ODP 1087, including the UK37' index (SSTs), pigments (primary productivity) and planktonic foraminifera (water mass changes). SSTs during the Pliocene range from 17 to 22.5 °C (mean SSTs at 21 °C), and show variability on orbital and suborbital time scales. Our results indicate that the Benguela upwelling system had intensified and/or shifted south during the Pliocene. We find no evidence of Agulhas leakage, meaning that either Agulhas Leakage was severely reduced or displaced during the mid-Pliocene. Potential causes of the observed signals include changes to the local wind field and/or changes in the temperature of intermediate waters which upwell in the Benguela system. Pronounced cooling is observed during cold stages in the Pliocene, aligned with the M2 and KM2 events. These results may indicate that changes to the extent of the Antarctic ice sheet had impact on circulation in the south east Atlantic during the Pliocene via displacement of the Antarctic Circumpolar Currents.

Outdoor and Indoor Aerosol Size, Number, Mass and Compositional Dynamics at an Urban Background Site during Warm Season.

Czech Academy of Sciences Publication Activity Database

Talbot, Nicholas; Kubelová, Lucie; Makeš, Otakar; Cusack, Michael; Ondráček, Jakub; Vodička, Petr; Schwarz, Jaroslav; Ždímal, Vladimír

2016-01-01

Roč. 131, APR 2016 (2016), s. 171-184 ISSN 1352-2310 EU Projects: European Commission(XE) 315760 - HEXACOMM Institutional support: RVO:67985858 Keywords : aerosol * composition * dissociation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.629, year: 2016

Early Site Permit Demonstration Program: Siting Guide, Site selection and evaluation criteria for an early site permit application

International Nuclear Information System (INIS)

1993-01-01

In August 1991, the Joint Contractors came to agreement with Sandia National Laboratories (SNL) and the Department of Energy (DOE) on a workscope for the cost-shared Early Site Permit Demonstration Program. One task within the scope was the development of a guide for site selection criteria and procedures. A generic Siting Guide his been prepared that is a roadmap and tool for applicants to use developing detailed siting plans for their specific region of the country. The guide presents three fundamental principles that, if used, ensure a high degree of success for an ESP applicant. First, the site selection process should take into consideration environmentally diverse site locations within a given region of interest. Second, the process should contain appropriate opportunities for input from the public. Third, the process should be applied so that it is clearly reasonable to an impartial observer, based on appropriately selected criteria, including criteria which demonstrate that the site can host an advanced light water reactor (ALWR). The Siting Guide provides for a systematic, comprehensive site selection process in which three basic types of criteria (exclusionary, avoidance, and suitability) are presented via a four-step procedure. It provides a check list of the criteria for each one of these steps. Criteria are applied qualitatively, as well as presented numerically, within the guide. The applicant should use the generic guide as an exhaustive checklist, customizing the guide to his individual situation

Site Closure Strategy Model for Creosote Site

International Nuclear Information System (INIS)

Coll, F.R.; Gray, D.R.

2009-01-01

In conjunction with RCRA site corrective action at an active wood preserving facility, a risk-based site closure strategy was developed and incorporated the performance of a dense non-aqueous phase liquid (DNAPL) source recovery remedy, a monitored natural attenuation (MNA) remedy for dissolved phase groundwater, and institutional controls. Innovative creosote DNAPL source recovery has been undertaken at the Site since 1998. Pooled creosote DNAPL is present 90 feet below ground within a transmissive sand and gravel aquifer with a saturated thickness of approximately 80 feet. The creosote DNAPL source is situated on the property boundary of the site and has generated a 1/2 mile off-site dissolved phase plume, creating significant NAPL management and remedial technology verification issues. To date, over 120,000 gallons of creosote DNAPL have been recovered from the subsurface utilizing a modified circulation well technology. A mass discharge flux protocol was developed to serve as a major performance metrics for the continuation of source removal efforts and to support the application of monitored natural attenuation as an associated remedial technology for groundwater. The mass removal success has supported the MNA remedy for dissolved phase groundwater and the associated development of institutional controls. The enacted site management strategy outlines the current and future risk management activities for the Site and represents an appropriate site closure strategy for the Site. (authors)

A novel functional site of extracellular matrix metalloproteinase inducer (EMMPRIN) that limits the migration of human uterine cervical carcinoma cells.

Science.gov (United States)

Sato, Takashi; Watanabe, Mami; Hashimoto, Kei; Ota, Tomoko; Akimoto, Noriko; Imada, Keisuke; Nomizu, Motoyoshi; Ito, Akira

2012-01-01

EMMPRIN (extracellular matrix metalloproteinase inducer)/CD147, a membrane-bound glycoprotein with two extracellular loop domains (termed loops I and II), progresses tumor invasion and metastasis by increasing the production of matrix metalloproteinase (MMP) in peritumoral stoma cells. EMMPRIN has also been associated with the control of migration activity in some tumor cells, but little is known about how EMMPRIN regulates tumor cell migration. In the present study, EMMPRIN siRNA suppressed the gene expression and production of EMMPRIN in human uterine cervical carcinoma SKG-II cells. An in vitro scratch wound assay showed enhancement of migration of EMMPRIN-knockdown SKG-II cells. In addition, the SKG-II cell migration was augmented by adding an E. coli-expressed human EMMPRIN mutant with two extracellular loop domains (eEMP-I/II), which bound to the cell surface of SKG-II cells. However, eEMP-I/II suppressed the native EMMPRIN-mediated augmentation of proMMP-1/procollagenase-1 production in a co-culture of the SKG-II cells and human uterine cervical fibroblasts, indicating that the augmentation of SKG-II cell migration resulted from the interference of native EMMPRIN functions by eEMP-I/II on the cell surface. Furthermore, a systematic peptide screening method using nine synthetic EMMPRIN peptides coding the loop I and II domains (termed EM1-9) revealed that EM9 (170HIENLNMEADPGQYR184) facilitated SKG-II cell migration. Moreover, SKG-II cell migration was enhanced by administration of an antibody against EM9, but not EM1 which is a crucial site for the MMP inducible activity of EMMPRIN. Therefore, these results provide novel evidence that EMMPRIN on the cell surface limits the cell migration of human uterine cervical carcinoma cells through 170HIENLNMEADPGQYR184 in the loop II domain. Finally, these results should provide an increased understanding of the functions of EMMPRIN in malignant cervical carcinoma cells, and could contribute to the development of

Study of site layout in the Rokkasho site

International Nuclear Information System (INIS)

Sato, Kazuyoshi; Tamura, Kousaku; Yagenji, Akira; Sekiya, Shigeki; Takahashi, Hideo; Neyatani, Yuzuru; Uehara, Masaharu; Motohashi, Keiichi; Hashimoto, Masayoshi; Ogino, Shunji; Nagamatsu, Nobuhide

2006-03-01

The Final Design Report (FDR) of the International Thermonuclear Experimental Reactor (ITER) was published on July 2001 as a summary of the Engineering Design Activity (EDA). After the EDA, site dependent design has been investigated for the invitation of ITER toward Rokkasho Site (Iyasakadai area) in Aomori prefecture. This report describes the results of site layout of major buildings and structures of ITER in the Rokkasho-Site. The data of the ground near the site and the results of site dependent design in Japan were applied to this study. Through this study, the most appropriate site layout has been constructed with satisfaction of following conditions. (1) Bedrock level at the tokamak complex building is relatively high and it can be reduced the cost of excavation and foundation work. (2) Total amount of excavation soil for site preparation is minimized and the flexibility of the layout is ensured with flat ground level. (3) Accessibility of human and equipments, reduction of noise and vibration to the environment can be obtained. Total length of ducts and piping between buildings in site is minimized. (author)

Late Pleistocene shallow water sand transported to the slope at IODP Sites U1484 and U1485 off the north coast of Papua New Guinea: how, when and why?

Science.gov (United States)

Mountain, G. S.; Browning, J. V.; Bova, S. C.

2017-12-01

IODP Exp 363 drilled two sites on a gently seaward-dipping terrace 18 and 21 km north of Papua New Guinea, enabling the study of mechanisms that bring shallow water sediment to the deep sea. We expect past changes in sea level and precipitation / fluvial run-off dominated this record, but additional processes may have been important. We examined Hole U1484B (1031 m water depth; 223 m drilled; 99.8% recovered) and detected 339 sharp-based sand layers 0.5 cm or more thick. In contrast to the background hemipelagic nanno-bearing silty clay, sand layers are graded or massive turbidites containing detrital grains, shallow-water benthic foraminifera, shell fragments and/or wood. δ18O values of Globigerinoides ruber tied to the isotopic curve of Lisiecki and Raymo (2004) show the densest concentration of sand layers in the last 310 ka occurred during the cooling trend of MIS stage 6. Stage 2 contains significantly fewer discrete sand beds, even during the coldest part of the LGM. Other times of glacial intensification show a similarly modest correlation to peak sand deposition. Sand layers strongly correlate with high values of magnetic susceptibility (MS) measured on unsplit cores, and when mapped to the MIS time scale, MS increases match times of ice growth / falling sea level more consistently than does the density of sand layers. We attribute this to reworking of discrete sand layers by bioturbation, indicating the need for caution tying the absence of sharp-based sands to times of transgression or low precipitation / fluvial run-off. Packages of especially thick and closely-spaced sharp-based sands match seismic reflections at Site U1484. Tracing these reflections throughout the grid of hi-res MCS site survey profiles reveals the areal distribution and transport path of sand as well as a direct tie to similar sharp-based sands in the more distal Hole U1485A (1145 m water depth; 301 m drilled; 103.8% recovered.) The distribution of sands through time might be

Search for the Higgs boson at center-of-mass energies between 161 and 184 GeV in the 4-jet channel with OPAL

International Nuclear Information System (INIS)

Toerne, E. von

1998-07-01

A search for the Standard Model Higgs boson using data from e + e - collisions collected at center-of-mass energies from 161 to 184 GeV with the OPAL detector at LEP is presented. The search is applied to events in the four-jet-channel, in which the Higgs boson decays into a bb pair and the associated Z 0 decays into quark and anti-quark. The data analyzed corresponds to an integrated luminosity of 75.0 pb -1 . Five candidate events are observed, in agreement with the Standard Model background expectation of 6.61±0.42 (stat.) ±1.72 (syst.) events. A lower limit of 74.0 GeV is derived for the mass of the Standard Model Higgs boson at the 95% confidence level. In combination with OPAL searches in other channels a limit of 86.9 GeV is obtained. (orig.)

Theory for site-site pair distribution functions of molecular fluids. II. Approximations for the Percus--Yevick site-site direct correlation functions

International Nuclear Information System (INIS)

Johnson, E.

1977-01-01

A theory for site-site pair distribution functions of molecular fluids is derived from the Ornstein-Zernike equation. Atom-atom pair distribution functions of this theory which were obtained by using different approximations for the Percus-Yevick site-site direct correlation functions are compared

Enfermedad de Dupuytren en una población del noroeste de España: hallazgos clínicos en 184 pacientes Dupuytren's disease in a north-west Spanish population: clinical findings on 184 patients

Directory of Open Access Journals (Sweden)

I. Couto González

2010-06-01

Full Text Available El propósito de este estudio es analizar los factores clásicos relacionados con la Enfermedad de Dupuytren en nuestra región así como la evolución clínica del proceso, con el objeto de comparar nuestros resultados con otros publicados, especialmente de estudios procedentes del norte de Europa y de Norteamérica. Realizamos un análisis retrospectivo sobre 184 pacientes diagnosticados de Enfermedad de Dupuytren en nuestro Servicio y estudiamos sus historias clínicas buscando factores relacionados con el proceso descritos en la literatura médica El 86% de los pacientes estudiados fueron varones, entre la quinta o sexta décadas de la vida en el momento de realizar el diagnóstico. El 64,5% trabajaba o había tenido un trabajo relacionado con traumatismo manual crónico; el 16% reconoció antecedentes familiares; el 43,5% consumía de forma habitual bebidas alcohólicas; el 51% era fumador; el 0% presentaba diabetes mellitus tipo 1 y el 28,8% diabetes mellitus tipo 2; el 1,6% tenían epilepsia; el 19% presentaba algún tipo de vasculopatía periférica; el 6,4% algún tipo de trastorno autoinmune; el 0% una neuropatía degenerativa; el 10,3% Síndrome del Túnel Carpiano; el 32,1% hiperlipemia; el 28,8% hiperuricemia; el 3,8% presentaba algún trastorno hepático; el 77,7% tenía afectación de la mano derecha, el 70,1% de la mano izquierda y el 47,3% bilateral. Los radios palmares afectados con más frecuencia fueron el 4º y el 5º. Las fibromatosis ectópicas fueron un hallazgo infrecuente. Concluimos que el género, la edad y los hallazgos clínicos en nuestros pacientes parecen ser similares a los expuestos en los resultados de las series realizadas en el norte de Europa y Norteamérica. Los factores involucrados en el incremento de los radicales libres del oxígeno como el tabaquismo, las bebidas alcohólicas, la diabetes mellitus, la hiperuricemia o las alteraciones vasculares periféricas aparecen frecuentemente en nuestros

AXAIR89Q User's Manual

International Nuclear Information System (INIS)

Simpkins, A.A.

1994-04-01

AXAIR89Q is the primary dose assessment code used at the Savannah River Site to predict downwind doses following a hypothetical atmospheric release of relatively short duration. The primary purpose of the code is to perform calculations for safety-related documentation, and there is strict adherence in AXAIR89Q to the guidance in USNRC Regulatory Guide 1.145 (USNRC, 1983) entitled Atmospheric Dispersion Models for Potential Accident Consequence Assessments at Nuclear Power Plants. Doses are determined for the cloud shine, and inhalation pathways. Ingestion and ground shine are not considered. Future modifications are expected to include these features. This report discusses the information needed to execute the program and interpret the results

SitesIdentify: a protein functional site prediction tool

Directory of Open Access Journals (Sweden)

Doig Andrew J

2009-11-01

Full Text Available Abstract Background The rate of protein structures being deposited in the Protein Data Bank surpasses the capacity to experimentally characterise them and therefore computational methods to analyse these structures have become increasingly important. Identifying the region of the protein most likely to be involved in function is useful in order to gain information about its potential role. There are many available approaches to predict functional site, but many are not made available via a publicly-accessible application. Results Here we present a functional site prediction tool (SitesIdentify, based on combining sequence conservation information with geometry-based cleft identification, that is freely available via a web-server. We have shown that SitesIdentify compares favourably to other functional site prediction tools in a comparison of seven methods on a non-redundant set of 237 enzymes with annotated active sites. Conclusion SitesIdentify is able to produce comparable accuracy in predicting functional sites to its closest available counterpart, but in addition achieves improved accuracy for proteins with few characterised homologues. SitesIdentify is available via a webserver at http://www.manchester.ac.uk/bioinformatics/sitesidentify/

Characterization of Paleoredox Changes In Nw-pacific Deep-sea Sediments Using Environmental Magnetic In Combination With Geochemical-mineralogic Data

Science.gov (United States)

Urbat, M.; Pletsch, T.

The understanding of environmental and oceanic controls on deep-sea sediments in the NW Pacific Ocean (ODP Site 1149A, Nadezhda Basin) benefits from the inte- gration of environmental magnetic methodology with geochemical-mineralogic XRD (x-ray defraction) and XRF (x-ray fluorescence) data. Crucially, the inherently grad- ual diagenetic processes related to paleo-redox changes in the sediment column may be more sensitively monitored using the integration of non-magnetic and magnetic data, because they do reflect various aspects of the entire postdepositional alteration. The studied 32 m long quaternary interval at Hole ODP 1149A provides an expanded record of eolian dust supply from the Asian continent, siliceous plankton accumulation and varying contributions of both discrete ash layers and disperse ash to a truly deep- sea environment (Plank et al. 2000). Recurrent diagenetic intervals appear to be related to changes in the Ocean water circulation (Kuriosho current) and concomitant produc- tivity variations as a function of glacial-interglacial paleoclimatic changes. Diagenetic intervals correspond to paleo-redox boundaries, where suboxic conditions promoted the destruction of the primary magnetic signal (iron oxides) and the precipitation of rhodochrosite (MnCO3). We used simple normative calculations on the basis of of Al and Cr contents to discriminate between the major groups of components (terrigenous, volcanogenic, biogenic, diagenetic) in combination with our magnetic results. These results form the grounds for the discrimation and independent interpretation of the genetically various sediment components in the paleoceanograhic context.

The C-terminal N-glycosylation sites of the human alpha1,3/4-fucosyltransferase III, -V, and -VI (hFucTIII, -V, adn -VI) are necessary for the expression of full enzyme activity.

Science.gov (United States)

Christensen, L L; Jensen, U B; Bross, P; Orntoft, T F

2000-09-01

The alpha1,3/4-fucosyltransferases are involved in the synthesis of fucosylated cell surface glycoconjugates. Human alpha1,3/4-fucosyltransferase III, -V, and -VI (hFucTIII, -V, and -VI) contain two conserved C-terminal N-glycosylation sites (hFucTIII: Asn154 and Asn185; hFucTV: Asn167 and Asn198; and hFucTVI: Asn153 and Asn184). In the present study, we have analyzed the functional role of these potential N-glycosylation sites, laying the main emphasis on the sites in hFucTIII. Tunicamycin treatment completely abolished hFucTIII enzyme activity while castanospermine treatment diminished hFucTIII enzyme activity to approximately 40% of the activity of the native enzyme. To further analyze the role of the conserved N-glycosylation sites in hFucTIII, -V, and -VI, we made a series of mutant genomic DNAs in which the asparagine residues in the potential C-terminal N-glycosylation sites were replaced by glutamine. Subsequently, the hFucTIII, -V, and -VI wild type and the mutants were expressed in COS-7 cells. All the mutants exhibited lower enzyme activity than the wild type and elimination of individual sites had different effects on the activity. The mutations did not affect the protein level of the mutants in the cells, but reduced the molecular mass as predicted. Kinetic analysis of hFucTIII revealed that lack of glycosylation at Asn185 did not change the Km values for the oligosaccharide acceptor and the nucleotide sugar donor. The present study demonstrates that hFucTIII, -V, and -VI require N-glycosylation at the two conserved C-terminal N-glycosylation sites for expression of full enzyme activity.

Early Site Permit Demonstration Program: Siting Guide, Site selection and evaluation criteria for an early site permit application. Revision 1

Energy Technology Data Exchange (ETDEWEB)

1993-03-24

In August 1991, the Joint Contractors came to agreement with Sandia National Laboratories (SNL) and the Department of Energy (DOE) on a workscope for the cost-shared Early Site Permit Demonstration Program. One task within the scope was the development of a guide for site selection criteria and procedures. A generic Siting Guide his been prepared that is a roadmap and tool for applicants to use developing detailed siting plans for their specific region of the country. The guide presents three fundamental principles that, if used, ensure a high degree of success for an ESP applicant. First, the site selection process should take into consideration environmentally diverse site locations within a given region of interest. Second, the process should contain appropriate opportunities for input from the public. Third, the process should be applied so that it is clearly reasonable to an impartial observer, based on appropriately selected criteria, including criteria which demonstrate that the site can host an advanced light water reactor (ALWR). The Siting Guide provides for a systematic, comprehensive site selection process in which three basic types of criteria (exclusionary, avoidance, and suitability) are presented via a four-step procedure. It provides a check list of the criteria for each one of these steps. Criteria are applied qualitatively, as well as presented numerically, within the guide. The applicant should use the generic guide as an exhaustive checklist, customizing the guide to his individual situation.

Preliminary siting characterization Salt Disposition Facility - Site B

International Nuclear Information System (INIS)

Wyatt, D.

2000-01-01

A siting and reconnaissance geotechnical program has been completed in S-Area at the Savannah River Site in South Carolina. This program investigated the subsurface conditions for the area known as ''Salt Disposition Facility (SDF), Site B'' located northeast of H-Area and within the S-Area. Data acquired from the Site B investigation includes both field exploration and laboratory test data

A Single Amino Acid Change in the Marburg Virus Matrix Protein VP40 Provides a Replicative Advantage in a Species-Specific Manner

Science.gov (United States)

Koehler, Alexander; Kolesnikova, Larissa; Welzel, Ulla; Schudt, Gordian; Herwig, Astrid

2015-01-01

ABSTRACT Marburg virus (MARV) induces severe hemorrhagic fever in humans and nonhuman primates but only transient nonlethal disease in rodents. However, sequential passages of MARV in rodents boosts infection leading to lethal disease. Guinea pig-adapted MARV contains one mutation in the viral matrix protein VP40 at position 184 (VP40D184N). The contribution of the D184N mutation to the efficacy of replication in a new host is unknown. In the present study, we demonstrated that recombinant MARV containing the D184N mutation in VP40 [rMARVVP40(D184N)] grew to higher titers than wild-type recombinant MARV (rMARVWT) in guinea pig cells. Moreover, rMARVVP40(D184N) displayed higher infectivity in guinea pig cells. Comparative analysis of VP40 functions indicated that neither the interferon (IFN)-antagonistic function nor the membrane binding capabilities of VP40 were affected by the D184N mutation. However, the production of VP40-induced virus-like particles (VLPs) and the recruitment of other viral proteins to the budding site was improved by the D184N mutation in guinea pig cells, which resulted in the higher infectivity of VP40D184N-induced infectious VLPs (iVLPs) compared to that of VP40-induced iVLPs. In addition, the function of VP40 in suppressing viral RNA synthesis was influenced by the D184N mutation specifically in guinea pig cells, thus allowing greater rates of transcription and replication. Our results showed that the improved viral fitness of rMARVVP40(D184N) in guinea pig cells was due to the better viral assembly function of VP40D184N and its lower inhibitory effect on viral transcription and replication rather than modulation of the VP40-mediated suppression of IFN signaling. IMPORTANCE The increased virulence achieved by virus passaging in a new host was accompanied by mutations in the viral genome. Analyzing how these mutations affect the functions of viral proteins and the ability of the virus to grow within new host cells helps in the understanding

Automatic web site authoring with SiteGuide

NARCIS (Netherlands)

de Boer, V.; Hollink, V.; van Someren, M.W.; Kłopotek, M.A.; Przepiórkowski, A.; Wierzchoń, S.T.; Trojanowski, K.

2009-01-01

An important step in the design process for a web site is to determine which information is to be included and how the information should be organized on the web site’s pages. In this paper we describe ’SiteGuide’, a tool that automatically produces an information architecture for a web site that a

An Evaluation of C1-C3 Hydrochlorofluorocarbon (HCFC) Metrics: Lifetimes, Ozone Depletion Potentials, Radiative Efficiencies, Global Warming and Global Temperature Potentials

Science.gov (United States)

Burkholder, J. B.; Papanastasiou, D. K.; Marshall, P.

2017-12-01

Hydrochlorofluorocarbons (HCFCs) have been used as chlorofluorocarbon (CFC) substitutes in a number of applications, e.g. refrigerator and air-conditioning systems. Although HCFCs have lower ozone-depletion potentials (ODPs) compared to CFCs, they are potent greenhouse gases. The twenty-eighth meeting of the parties to the Montreal Protocol on Substances that Deplete the Ozone Layer (Kigali, 2016) included a list of 274 HCFCs to be controlled under the Montreal Protocol. However, from this list, only 15 of the HCFCs have values for their atmospheric lifetime, ODP, global warming potential (GWP), and global temperature potential (GTP) that are based on fundamental experimental studies, while 48 are registered compounds. In this work, we present a comprehensive evaluation of the atmospheric lifetimes, ODPs, radiative efficiencies (REs), GWPs, and GTPs for all 274 HCFCs to be included in the Montreal Protocol. Atmospheric lifetimes were estimated based on HCFC reactivity with OH radicals and O(1D), as well as their removal by UV photolysis using structure activity relationships and reactivity trends. ODP values are based on the semi-empirical approach described in the WMO/UNEP ozone assessment. Radiative efficiencies were estimated, based on infrared spectra calculated using theoretical electronic structure methods (Gaussian 09). GWPs and GTPs were calculated relative to CO2 using our estimated atmospheric lifetimes and REs. The details of the methodology will be discussed as well as the associated uncertainties. This study has provided a consistent set of atmospheric metrics for a wide range of HCFCs that support future policy decisions. More accurate metrics for a specific HCFC, if desired, would require fundamental laboratory studies to better define the OH reactivity and infrared absorption spectrum of the compound of interest. Overall, HCFCs within the same family (isomers) show a large ODP, GWP, GTP dependence on the molecular geometry of the isomers. The

Laparoscopic vs open distal pancreatectomy for solid pseudopapillary tumor of the pancreas

Science.gov (United States)

Zhang, Ren-Chao; Yan, Jia-Fei; Xu, Xiao-Wu; Chen, Ke; Ajoodhea, Harsha; Mou, Yi-Ping

2013-01-01

AIM: To compare short- and long-term outcomes of laparoscopic vs open distal pancreatectomy for solid pseudopapillary tumor (SPT) of the pancreas. METHODS: This retrospective study included 28 patients who underwent distal pancreatectomy for SPT of the pancreas between 1998 and 2012. The patients were divided into two groups based on the surgical approach: the laparoscopic surgery group and the open surgery group. The patients’ demographic data, operative results, pathological reports, hospital courses, morbidity and mortality, and follow-up data were compared between the two groups. RESULTS: Fifteen patients with SPT of the pancreas underwent laparoscopic distal pancreatectomy (LDP), and 13 underwent open distal pancreatectomy (ODP). Baseline characteristics were similar between the two groups except for a female predominance in the LDP group (100.0% vs 69.2%, P = 0.035). Mortality, morbidity (33.3% vs 38.5%, P = 1.000), pancreatic fistula rates (26.7% vs 30.8%, P = 0.728), and reoperation rates (0.0% vs 7.7%, P = 0.464) were similar in the two groups. There were no significant differences in the operating time (171 min vs 178 min, P = 0.755) between the two groups. The intraoperative blood loss (149 mL vs 580 mL, P = 0.002), transfusion requirement (6.7% vs 46.2%, P = 0.029), first flatus time (1.9 d vs 3.5 d, P = 0.000), diet start time (2.3 d vs 4.9 d, P = 0.000), and postoperative hospital stay (8.1 d vs 12.8 d, P = 0.029) were significantly less in the LDP group than in the ODP group. All patients had negative surgical margins at final pathology. There were no significant differences in number of lymph nodes harvested (4.6 vs 6.4, P = 0.549) between the two groups. The median follow-up was 33 (3-100) mo for the LDP group and 45 (17-127) mo for the ODP group. All patients were alive with one recurrence. CONCLUSION: LDP for SPT has short-term benefits compared with ODP. Long-term outcomes of LDP are similar to those of ODP. PMID:24115826

Quantitative analysis of fragrance in selectable one dimensional or two dimensional gas chromatography-mass spectrometry with simultaneous detection of multiple detectors in single injection.

Science.gov (United States)

Tan, Hui Peng; Wan, Tow Shi; Min, Christina Liew Shu; Osborne, Murray; Ng, Khim Hui

2014-03-14

A selectable one-dimensional ((1)D) or two-dimensional ((2)D) gas chromatography-mass spectrometry (GC-MS) system coupled with flame ionization detector (FID) and olfactory detection port (ODP) was employed in this study to analyze perfume oil and fragrance in shower gel. A split/splitless (SSL) injector and a programmable temperature vaporization (PTV) injector are connected via a 2-way splitter of capillary flow technology (CFT) in this selectable (1)D/(2)D GC-MS/FID/ODP system to facilitate liquid sample injections and thermal desorption (TD) for stir bar sorptive extraction (SBSE) technique, respectively. The dual-linked injectors set-up enable the use of two different injector ports (one at a time) in single sequence run without having to relocate the (1)D capillary column from one inlet to another. Target analytes were separated in (1)D GC-MS/FID/ODP and followed by further separation of co-elution mixture from (1)D in (2)D GC-MS/FID/ODP in single injection without any instrumental reconfiguration. A (1)D/(2)D quantitative analysis method was developed and validated for its repeatability - tR; calculated linear retention indices (LRI); response ratio in both MS and FID signal, limit of detection (LOD), limit of quantitation (LOQ), as well as linearity over a concentration range. The method was successfully applied in quantitative analysis of perfume solution at different concentration level (RSD≤0.01%, n=5) and shower gel spiked with perfume at different dosages (RSD≤0.04%, n=5) with good recovery (96-103% for SSL injection; 94-107% for stir bar sorptive extraction-thermal desorption (SBSE-TD). Copyright © 2014 Elsevier B.V. All rights reserved.

In situ synthesis and modification of calcium carbonate nanoparticles via a bobbling method

Institute of Scientific and Technical Information of China (English)

无

2009-01-01

Modified calcium carbonate (CaCO3) nanoparticles with cubic- and spindle-like configuration were synthesized in situ by the typical bobbling (gas-liquid-solid) method. The modifiers, such as sodium stearate, octadecyl dihydrogen phosphate (ODP) and oleic acid (OA), were used to obtain hydrophobic nanoparticles. The different modification effects of the modifiers were investigated by measuring the active ratio, whiteness and the contact angle. Moreover, transmission electron microscopy (TEM), X-ray diffraction (XRD) and thermogravimetry analysis (TGA analysis) were employed to characterize the obtained products. A preliminary reaction mechanism was discussed. According to the results, the active ratio of CaCO3 modified by ODP was ca. 99.9% and the value of whiteness was 97.3% when the dosage of modifiers reached 2%. The contact angle was 122.25° for the CaCO3 modified in the presence of sodium stearate, ODP and OA. When modified CaCO3 was filled into PVC, the mechanical properties of products were improved greatly such as rupture intensity, pull intensity and fuse temperature. The compatibility and affinity between the modified CaCO3 nanoparticles and the organic matrixes were greatly improved.

In situ synthesis and modification of calcium carbonate nanoparticles via a bobbling method

Institute of Scientific and Technical Information of China (English)

ZHAO LiNa; FENG JingDong; WANG ZiChen

2009-01-01

Modified calcium carbonate (CaCO3) nanoparticles with cubic- and spindle-like configuration were synthesized in situ by the typical bobbling (gas-liquid-solid) method.The modifiers,such as sodium stearate,octadecyl dihydrogen phosphate (ODP) and oleic acid (OA),were used to obtain hydrophobic nanoparticles.The different modification effects of the modifiers were investigated by measuring the active ratio,whiteness and the contact angle.Moreover,transmission electron microscopy (TEM),X-ray diffraction (XRD) and thermogravimetry analysis (TGA analysis) were employed to characterize the obtained products.A preliminary reaction mechanism was discussed.According to the results,the active ratio of CaCO3 modified by ODP was ca.99.9% and the value of whiteness was 97.3% when the dosage of modifiers reached 2%.The contact angle was 122.25° for the CaCO3 modified in the presence of sodium stearate,ODP and OA.When modified CaCO3 was filled into PVC,the mechanical properties of products were improved greatly such as rupture intensity,pull intensity and fuse temperature.The compatibility and affinity between the modified CaCO3 nanoparticles and the organic matrixes were greatly improved.

Site description of Forsmark at completion of the site investigation phase. SDM-Site Forsmark

Energy Technology Data Exchange (ETDEWEB)

2008-12-15

The Swedish Nuclear Fuel and Waste Management Co., SKB, has undertaken site characterisation in two different areas, Forsmark and Laxemar-Simpevarp, in order to identify a suitable location for a geological repository of spent nuclear fuel according to the KBS-3 method. The site investigations have been conducted in campaigns, punctuated by data freezes. After each data freeze, the site data have been analysed and modelling has been carried out with the overall purpose to develop a site descriptive model (SDM). The site descriptive model is used by repository engineering to design the underground facility and to develop a repository layout adapted to the site. It is also essential for safety assessment, since the model is the only source for site-specific input. Another important use of the site descriptive model is in the environmental impact assessment. An SDM is an integrated model for geology, thermal properties, rock mechanics, hydrogeology, hydrogeochemistry, bedrock transport properties and a description of the surface system. The site descriptive model compiled in the current report, SDM-Site, presents an integrated understanding of the Forsmark area at the completion of the surface-based investigations, which were conducted at Forsmark during the period 2002 to 2007. It also provides a summary of the abundant underlying data and the discipline-specific models that support the site understanding. The description relies heavily on background reports that address, in particular, details in data analyses and modelling in the different disciplines. The Forsmark area is located in northern Uppland within the municipality of Oesthammar, about 120 km north of Stockholm. The candidate area for site investigation is located along the shoreline of Oeregrundsgrepen, within the north-western part of a major tectonic lens that formed between 1.87 and 1.85 billion years ago during the Svecokarelian orogeny. The candidate area is approximately 6 km long and 2 km wide. The

Site description of Laxemar at completion of the site investigation phase. SDM-Site Laxemar

Energy Technology Data Exchange (ETDEWEB)

2009-12-15

The Swedish Nuclear Fuel and Waste Management Company (SKB) has undertaken site characterisation in two different areas, Forsmark and Laxemar-Simpevarp, in order to identify a suitable location for a geological repository of spent nuclear fuel according to the KBS-3 method. The site investigations have been conducted in campaigns, punctuated by data freezes. After each data freeze, the site data have been analysed and modelling has been carried out with the overall purpose to develop a site descriptive model (SDM). The site descriptive model is used by repository engineering to design the underground facility and to develop a repository layout adapted to the site. It is also essential for safety assessment, since the SDM is the only source for site-specific input. Another important use of the site descriptive model is in the environmental impact assessment. An SDM is an integrated model of geology, thermal properties, rock mechanics, hydrogeology, hydrogeochemistry, bedrock transport properties and a description of the surface system. The site descriptive model compiled in the current report, SDM-Site Laxemar, presents an integrated understanding of the Laxemar-Simpevarp area (with special emphasis on the Laxemar subarea) at the completion of the surface-based investigations, which were conducted during the period 2002 to 2007. A summary is also provided of the abundant underlying data and the discipline specific models that support the site understanding. The description relies heavily on background reports that address, in particular, details of the data analyses and modelling of the different disciplines. The Laxemar-Simpevarp area is located in the province of Smaaland within the municipality of Oskarshamn, about 230 km south of Stockholm. The candidate area for site investigation is located along the shoreline of the strait of Kalmarsund, within a 1.8 billion year old suite of well preserved bedrock belonging to the Transscandinavian Igneous Belt formed during

Site description of Laxemar at completion of the site investigation phase. SDM-Site Laxemar

International Nuclear Information System (INIS)

2009-12-01

The Swedish Nuclear Fuel and Waste Management Company (SKB) has undertaken site characterisation in two different areas, Forsmark and Laxemar-Simpevarp, in order to identify a suitable location for a geological repository of spent nuclear fuel according to the KBS-3 method. The site investigations have been conducted in campaigns, punctuated by data freezes. After each data freeze, the site data have been analysed and modelling has been carried out with the overall purpose to develop a site descriptive model (SDM). The site descriptive model is used by repository engineering to design the underground facility and to develop a repository layout adapted to the site. It is also essential for safety assessment, since the SDM is the only source for site-specific input. Another important use of the site descriptive model is in the environmental impact assessment. An SDM is an integrated model of geology, thermal properties, rock mechanics, hydrogeology, hydrogeochemistry, bedrock transport properties and a description of the surface system. The site descriptive model compiled in the current report, SDM-Site Laxemar, presents an integrated understanding of the Laxemar-Simpevarp area (with special emphasis on the Laxemar subarea) at the completion of the surface-based investigations, which were conducted during the period 2002 to 2007. A summary is also provided of the abundant underlying data and the discipline specific models that support the site understanding. The description relies heavily on background reports that address, in particular, details of the data analyses and modelling of the different disciplines. The Laxemar-Simpevarp area is located in the province of Smaaland within the municipality of Oskarshamn, about 230 km south of Stockholm. The candidate area for site investigation is located along the shoreline of the strait of Kalmarsund, within a 1.8 billion year old suite of well preserved bedrock belonging to the Transscandinavian Igneous Belt formed during

Site description of Forsmark at completion of the site investigation phase. SDM-Site Forsmark

International Nuclear Information System (INIS)

2008-12-01

The Swedish Nuclear Fuel and Waste Management Co., SKB, has undertaken site characterisation in two different areas, Forsmark and Laxemar-Simpevarp, in order to identify a suitable location for a geological repository of spent nuclear fuel according to the KBS-3 method. The site investigations have been conducted in campaigns, punctuated by data freezes. After each data freeze, the site data have been analysed and modelling has been carried out with the overall purpose to develop a site descriptive model (SDM). The site descriptive model is used by repository engineering to design the underground facility and to develop a repository layout adapted to the site. It is also essential for safety assessment, since the model is the only source for site-specific input. Another important use of the site descriptive model is in the environmental impact assessment. An SDM is an integrated model for geology, thermal properties, rock mechanics, hydrogeology, hydrogeochemistry, bedrock transport properties and a description of the surface system. The site descriptive model compiled in the current report, SDM-Site, presents an integrated understanding of the Forsmark area at the completion of the surface-based investigations, which were conducted at Forsmark during the period 2002 to 2007. It also provides a summary of the abundant underlying data and the discipline-specific models that support the site understanding. The description relies heavily on background reports that address, in particular, details in data analyses and modelling in the different disciplines. The Forsmark area is located in northern Uppland within the municipality of Oesthammar, about 120 km north of Stockholm. The candidate area for site investigation is located along the shoreline of Oeregrundsgrepen, within the north-western part of a major tectonic lens that formed between 1.87 and 1.85 billion years ago during the Svecokarelian orogeny. The candidate area is approximately 6 km long and 2 km wide. The

On-site and off-site activities

International Nuclear Information System (INIS)

Martin, H.D.

1986-01-01

Design principles for NPP training programs. Effects of NPP contracts. Effects of domestic industrial activities. The role of international bodies. Requirements for on-site training. Training abroad, technical, financial and social aspects. Training center on-site, an evaluation. (orig.)

Region 9 NPL Sites (Superfund Sites 2013)

Science.gov (United States)

NPL site POINT locations for the US EPA Region 9. NPL (National Priorities List) sites are hazardous waste sites that are eligible for extensive long-term cleanup under the Superfund program. Eligibility is determined by a scoring method called Hazard Ranking System. Sites with high scores are listed on the NPL. The majority of the locations are derived from polygon centroids of digitized site boundaries. The remaining locations were generated from address geocoding and digitizing. Area covered by this data set include Arizona, California, Nevada, Hawaii, Guam, American Samoa, Northern Marianas and Trust Territories. Attributes include NPL status codes, NPL industry type codes and environmental indicators. Related table, NPL_Contaminants contains information about contaminated media types and chemicals. This is a one-to-many relate and can be related to the feature class using the relationship classes under the Feature Data Set ENVIRO_CONTAMINANT.

Mechanistic characterization and molecular modeling of hepatitis B virus polymerase resistance to entecavir.

Science.gov (United States)

Walsh, Ann W; Langley, David R; Colonno, Richard J; Tenney, Daniel J

2010-02-12

Entecavir (ETV) is a deoxyguanosine analog competitive inhibitor of hepatitis B virus (HBV) polymerase that exhibits delayed chain termination of HBV DNA. A high barrier to entecavir-resistance (ETVr) is observed clinically, likely due to its potency and a requirement for multiple resistance changes to overcome suppression. Changes in the HBV polymerase reverse-transcriptase (RT) domain involve lamivudine-resistance (LVDr) substitutions in the conserved YMDD motif (M204V/I +/- L180M), plus an additional ETV-specific change at residues T184, S202 or M250. These substitutions surround the putative dNTP binding site or primer grip regions of the HBV RT. To determine the mechanistic basis for ETVr, wildtype, lamivudine-resistant (M204V, L180M) and ETVr HBVs were studied using in vitro RT enzyme and cell culture assays, as well as molecular modeling. Resistance substitutions significantly reduced ETV incorporation and chain termination in HBV DNA and increased the ETV-TP inhibition constant (K(i)) for HBV RT. Resistant HBVs exhibited impaired replication in culture and reduced enzyme activity (k(cat)) in vitro. Molecular modeling of the HBV RT suggested that ETVr residue T184 was adjacent to and stabilized S202 within the LVDr YMDD loop. ETVr arose through steric changes at T184 or S202 or by disruption of hydrogen-bonding between the two, both of which repositioned the loop and reduced the ETV-triphosphate (ETV-TP) binding pocket. In contrast to T184 and S202 changes, ETVr at primer grip residue M250 was observed during RNA-directed DNA synthesis only. Experimentally, M250 changes also impacted the dNTP-binding site. Modeling suggested a novel mechanism for M250 resistance, whereby repositioning of the primer-template component of the dNTP-binding site shifted the ETV-TP binding pocket. No structural data are available to confirm the HBV RT modeling, however, results were consistent with phenotypic analysis of comprehensive substitutions of each ETVr position

Mechanistic characterization and molecular modeling of hepatitis B virus polymerase resistance to entecavir.

Directory of Open Access Journals (Sweden)

Ann W Walsh

Full Text Available BACKGROUND: Entecavir (ETV is a deoxyguanosine analog competitive inhibitor of hepatitis B virus (HBV polymerase that exhibits delayed chain termination of HBV DNA. A high barrier to entecavir-resistance (ETVr is observed clinically, likely due to its potency and a requirement for multiple resistance changes to overcome suppression. Changes in the HBV polymerase reverse-transcriptase (RT domain involve lamivudine-resistance (LVDr substitutions in the conserved YMDD motif (M204V/I +/- L180M, plus an additional ETV-specific change at residues T184, S202 or M250. These substitutions surround the putative dNTP binding site or primer grip regions of the HBV RT. METHODS/PRINCIPAL FINDINGS: To determine the mechanistic basis for ETVr, wildtype, lamivudine-resistant (M204V, L180M and ETVr HBVs were studied using in vitro RT enzyme and cell culture assays, as well as molecular modeling. Resistance substitutions significantly reduced ETV incorporation and chain termination in HBV DNA and increased the ETV-TP inhibition constant (K(i for HBV RT. Resistant HBVs exhibited impaired replication in culture and reduced enzyme activity (k(cat in vitro. Molecular modeling of the HBV RT suggested that ETVr residue T184 was adjacent to and stabilized S202 within the LVDr YMDD loop. ETVr arose through steric changes at T184 or S202 or by disruption of hydrogen-bonding between the two, both of which repositioned the loop and reduced the ETV-triphosphate (ETV-TP binding pocket. In contrast to T184 and S202 changes, ETVr at primer grip residue M250 was observed during RNA-directed DNA synthesis only. Experimentally, M250 changes also impacted the dNTP-binding site. Modeling suggested a novel mechanism for M250 resistance, whereby repositioning of the primer-template component of the dNTP-binding site shifted the ETV-TP binding pocket. No structural data are available to confirm the HBV RT modeling, however, results were consistent with phenotypic analysis of

On-Site or Off-Site Renewable Energy Supply Options?

DEFF Research Database (Denmark)

Marszal, Anna Joanna; Heiselberg, Per; Jensen, Rasmus Lund

2012-01-01

The concept of a Net Zero Energy Building (Net ZEB) encompasses two options of supplying renewable energy, which can offset energy use of a building, in particular on-site or off-site renewable energy supply. Currently, the on-site options are much more popular than the off-site; however, taking...... into consideration the limited area of roof and/or façade, primarily in the dense city areas, the Danish weather conditions, the growing interest and number of wind turbine co-ops, the off-site renewable energy supply options could become a meaningful solution for reaching ‘zero’ energy goal in the Danish context...... five technologies, i.e., two on-site options: (1) photovoltaic, (2) micro combined heat and power, and three off-site options: (1) off-site windmill, (2) share of a windmill farm and (3) purchase of green energy from the 100% renewable utility grid. The results indicate that in case of the on...

Increased Ice-age Influence of Antarctic Intermediate Water.

Science.gov (United States)

Muratli, J.; McManus, J.; Mix, A.; Chase, Z.

2008-12-01

A depth transect of three ODP sites collected along the central Chile Margin constrain Antarctic Intermediate Water (AAIW) distributions and regional export production over the last 30 ka. Reduced Re and Cd, and increased Mn are proxies for higher bottom water oxygenation; 230Th-normalized burial of opal is a proxy for productivity. Mn/Al is high during the glacial interval at all three sites, suggesting high oxygenation and the retreat of the oxygen minimum zone during this period. At Site 1233, within the core of modern AAIW, Re and Cd are unchanged from detrital values throughout the last 30 ky, implying continuously oxic conditions. In contrast, at the northern sites 1234 and 1235, which reside below and above AAIW respectively, Re and Cd rise rapidly from low glacial values at ~15ka, signifying lower oxygen concentrations at the sea floor during Holocene time relative to ice-age conditions. Local productivity, recorded in Th-normalized opal burial, is highest during the glacial interval at both sites 1233 and 1234, and varies independently from the redox proxies. We conclude that local productivity does not drive bottom water oxygenation here, and that ventilation of the shallow subsurface southeast Pacific increased during the last ice age, with an expanded depth range of AAIW relative to the present.

Nuclear power plant site evaluation using site population-meterology factor

International Nuclear Information System (INIS)

Rho, B.H.; Kang, C.H.

1982-01-01

In this paper, as a site evaluation technique, SPNF(Site Population Neteorology Factor) which is modified from SPF(Site Population Factor) of the USNRC model, is defined from site population and meteorology data in order to consider the radiological impacts to the population at large from the atmospheric dispersion of the radioactive effluents released during routine plant operation as well as accidental conditions. The SPMF model proved its propriety from the comparison of SPMF and SPF for Kori site. The relative suitability of Korean sites to the U.S. sites have been also examined using SPF. (Author)

Superfund and Toxic Release Inventory Sites - MDC_ContaminatedSite

Data.gov (United States)

NSGIC Local Govt | GIS Inventory — A point feature class of open DERM Contaminated sites - see phase code for status of site. Contaminated sites identifies properties where environmental contamination...

EVIDENCE FOR GAS FROM A DISINTEGRATING EXTRASOLAR ASTEROID

International Nuclear Information System (INIS)

Xu, S.; Jura, M.; Zuckerman, B.; Dufour, P.

2016-01-01

We report high-resolution spectroscopic observations of WD 1145+017—a white dwarf that was recently found to be transitted by multiple asteroid-sized objects within its tidal radius. We discovered numerous circumstellar absorption lines with linewidths of ∼300 km s −1 from Mg, Ca, Ti, Cr, Mn, Fe, and Ni, possibly from several gas streams produced by collisions among the actively disintegrating objects. The atmosphere of WD 1145+017 is polluted with 11 heavy elements, including O, Mg, Al, Si, Ca, Ti, V:, Cr, Mn, Fe, and Ni. Evidently, we are witnessing the active disintegration and subsequent accretion of an extrasolar asteroid

EVIDENCE FOR GAS FROM A DISINTEGRATING EXTRASOLAR ASTEROID

Energy Technology Data Exchange (ETDEWEB)

Xu, S. [European Southern Observatory, Karl-Schwarzschild-Straße 2, D-85748 Garching (Germany); Jura, M.; Zuckerman, B. [Department of Physics and Astronomy, University of California, Los Angeles CA 90095-1562 (United States); Dufour, P., E-mail: sxu@eso.org, E-mail: jura@astro.ucla.edu, E-mail: ben@astro.ucla.edu, E-mail: dufourpa@astro.umontreal.ca [Institut de Recherche sur les Exoplanètes (iREx), Université de Montréal, Montréal, QC H3C 3J7 (Canada)

2016-01-10

We report high-resolution spectroscopic observations of WD 1145+017—a white dwarf that was recently found to be transitted by multiple asteroid-sized objects within its tidal radius. We discovered numerous circumstellar absorption lines with linewidths of ∼300 km s{sup −1} from Mg, Ca, Ti, Cr, Mn, Fe, and Ni, possibly from several gas streams produced by collisions among the actively disintegrating objects. The atmosphere of WD 1145+017 is polluted with 11 heavy elements, including O, Mg, Al, Si, Ca, Ti, V:, Cr, Mn, Fe, and Ni. Evidently, we are witnessing the active disintegration and subsequent accretion of an extrasolar asteroid.

1,2-Dichlorohexafluoro-Cyclobutane (1,2-c-C4F6Cl2, R-316c) a Potent Ozone Depleting Substance and Greenhouse Gas: Atmospheric Loss Processes, Lifetimes, and Ozone Depletion and Global Warming Potentials for the (E) and (Z) stereoisomers

Science.gov (United States)

Papadimitriou, Vassileios C.; McGillen, Max R.; Smith, Shona C.; Jubb, Aaron M.; Portmann, Robert W.; Hall, Bradley D.; Fleming, Eric L.; Jackman, Charles H.; Burkholder, James B.

2013-01-01

The atmospheric processing of (E)- and (Z)-1,2-dichlorohexafluorocyclobutane (1,2-c-C4F6Cl2, R-316c) was examined in this work as the ozone depleting (ODP) and global warming (GWP) potentials of this proposed replacement compound are presently unknown. The predominant atmospheric loss processes and infrared absorption spectra of the R-316c isomers were measured to provide a basis to evaluate their atmospheric lifetimes and, thus, ODPs and GWPs. UV absorption spectra were measured between 184.95 to 230 nm at temperatures between 214 and 296 K and a parametrization for use in atmospheric modeling is presented. The Cl atom quantum yield in the 193 nm photolysis of R- 316c was measured to be 1.90 +/- 0.27. Hexafluorocyclobutene (c-C4F6) was determined to be a photolysis co-product with molar yields of 0.7 and 1.0 (+/-10%) for (E)- and (Z)-R-316c, respectively. The 296 K total rate coefficient for the O(1D) + R-316c reaction, i.e., O(1D) loss, was measured to be (1.56 +/- 0.11) × 10(exp -10)cu cm/ molecule/s and the reactive rate coefficient, i.e., R-316c loss, was measured to be (1.36 +/- 0.20) × 10(exp -10)cu cm/molecule/s corresponding to a approx. 88% reactive yield. Rate coefficient upper-limits for the OH and O3 reaction with R-316c were determined to be model to be 74.6 +/- 3 and 114.1 +/-10 years, respectively, where the estimated uncertainties are due solely to the uncertainty in the UV absorption spectra. Stratospheric photolysis is the predominant atmospheric loss process for both isomers with the O(1D) reaction making a minor, approx. 2% for the (E) isomer and 7% for the (Z) isomer, contribution to the total atmospheric loss. Ozone depletion potentials for (E)- and (Z)-R-316c were calculated using the 2-D model to be 0.46 and 0.54, respectively. Infrared absorption spectra for (E)- and (Z)-R-316c were measured at 296 K and used to estimate their radiative efficiencies (REs) and GWPs; 100-year time-horizon GWPs of 4160 and 5400 were obtained for (E)- and (Z

Umatilla Satellite and Release Sites Project : Final Siting Report.

Energy Technology Data Exchange (ETDEWEB)

Montgomery, James M.

1992-04-01

This report presents the results of site analysis for the Umatilla Satellite and Release Sites Project. The purpose of this project is to provide engineering services for the siting and conceptual design of satellite and release facilities for the Umatilla Basin hatchery program. The Umatilla Basin hatchery program consists of artificial production facilities for salmon and steelhead to enhance production in the Umatilla River as defined in the Umatilla master plan approved in 1989 by the Northwest Power Planning Council. Facilities identified in the master plan include adult salmon broodstock holding and spawning facilities, facilities for recovery, acclimation, and/or extended rearing of salmon juveniles, and development of river sites for release of hatchery salmon and steelhead. The historic and current distribution of fall chinook, summer chinook, and coho salmon and steelhead trout was summarized for the Umatilla River basin. Current and future production and release objectives were reviewed. Twenty seven sites were evaluated for the potential and development of facilities. Engineering and environmental attributes of the sites were evaluated and compared to facility requirements for water and space. Site screening was conducted to identify the sites with the most potential for facility development. Alternative sites were selected for conceptual design of each facility type. A proposed program for adult holding facilities, final rearing/acclimation, and direct release facilities was developed.

Site decontamination

International Nuclear Information System (INIS)

Bicker, A.E.

1981-01-01

Among the several DOE sites that have been radiologically decontaminated under the auspices of the Nevada Operations Office are three whose physical characteristics are unique. These are the Tatum Dome Test Site (TDTS) near Hattiesburg, Mississippi; a location of mountainous terrain (Pahute Mesa) on the Nevada Test Site; and the GNOME site near Carlsbad, New Mexico. In each case the contamination, the terrain, and the climate conditions were different. This presentation includes a brief description of each site, the methods used to perform radiological surveys, the logistics required to support the decontamination (including health physics and sample analysis), and the specific techniques used to reduce or remove the contamination

Planktic foraminiferal photosymbiont bleaching during the Early Eocene Climatic Optimum (Site 1051, northwestern Atlantic)

Science.gov (United States)

Luciani, Valeria; D'Onofrio, Roberta; Dickens, Gerald Roy; Wade, Bridget

2017-04-01

The symbiotic relationship with algae is a key strategy adopted by many modern species and by early Paleogene shallow-dwelling planktic foraminifera. The endosymbionts play an important role in foraminiferal calcification, longevity and growth, allowing the host to succeed in oligotrophic environment. We have indirect evidence on the presence and loss of algae photosymbionts because symbionts modify the chemistry of the microenvironment where a foraminifer calcifies, resulting in a characteristic geochemical signature between test size and δ13C. We present here the result of a test on loss of algal photosymbiont (bleaching) in planktic foraminifera from the northwest Atlantic Ocean Drilling Program (ODP) Site 1051 across the Early Eocene Climatic Optimum (EECO), the interval ( 49-53 Ma) when Earth surface temperatures and probably atmospheric pCO2 reached their Cenozoic maximum. We select this interval because two symbiont-bearing planktic foraminiferal genera Morozovella and Acarinina, that were important calcifiers of the early Paleogene tropical-subtropical oceans, experienced a marked and permanent switch in abundance at the beginning of the EECO, close to the carbon isotope excursion known as J event. Specifically, the relative abundance of Morozovella permanently decreased by at least half, along with a progressive decrease in the number of species. Concomitantly, the genus Acarinina almost doubled its abundance and diversified within the EECO. Many stressors inducing loss of photosymbiosis may have occurred during the long-lasting environmental conditions relating to the EECO extreme warmth, such as high pCO2 and possible decrease of the surface-water pH. The bleaching may therefore represent a potential mechanism to explain the rapid morozovellid decline at the start of the EECO. Our geochemical data from Site 1051 demonstrate that there was indeed a reduction of algal-symbiosis in morozovellids at the EECO beginning. This bleaching event occurred at the

Comparison of calcium carbonate and aluminium hydroxide as phosphate binders on biochemical bone markers, PTH(1-84), and bone mineral content in dialysis patients

DEFF Research Database (Denmark)

Jespersen, B; Jensen, J D; Nielsen, H K

1991-01-01

Bone mineral content, estimated by single-photon absorptiometry of the forearm, serum values of intact parathyroid hormone (PTH(1-84], osteocalcin, alkaline phosphatase, 1,25-dihydroxycholecalciferol (1,25(OH)2D3), and aluminium were determined during treatment with calcium carbonate (CaCO3......) or aluminium hydroxide (Al(OH)3) in 11 dialysis patients participating in a randomised cross-over study. Each treatment period lasted 6 months. Serum phosphorus was maintained in the range 1.5-2.0 mmol/l. During Al(OH)3 treatment bone mineral content (BMC) decreased by 11% per half-year (mean), but only by 3...... 0.05), osteocalcin decreased (89% versus 117%, P less than 0.01), alkaline phosphatase decreased (92% versus 116%, P less than 0.05), and aluminium decreased (56% versus 189%, P less than 0.05). 1,25(OH)2D3 remained unchanged in both periods. No increase in soft-tissue calcification was demonstrated...

Using CAM3 and the Alkenone Method to Understand how Pliocene SST's Affect California and Other Climates Adjacent to Upwelling Regions

Science.gov (United States)

Searles, Z. A.; Otto-Bliesner, B. L.; Rosenbloom, N. A.; Dekens, P. S.

2008-12-01

The Intergovernmental Panel on Climate Change fourth assessment report established with 90% confidence that anthropogenic climate change will result in a warmer world. In order to more fully understand possible future climate, past analogues of warm periods should be analyzed. The early Pliocene is an appropriate analogue because the continental configuration was similar to today and CO2 levels were comparable to present (~100ppm higher than pre-anthropogenic levels). This project has two objectives: 1.To test the atmospheric sensitivity to USGS PRISM2 dataset revised to better approximate proxy data indicating warmer SST's in upwelling regions and 2. To provide early-Pliocene (2.7- 3.5 Ma) SST estimates for ODP site 1018 on the California Margin (36°59.4'N, 123°16.5'W) using the UK'37 SST proxy. Recent UK'37 proxy data reveals that PRISM2 underestimates SST's in Pacific and Atlantic coastal upwelling regions. The sensitivity of the atmosphere to significantly warmer SST's in upwelling regions was tested using the National Center for Atmospheric Research (NCAR) Community Atmospheric Model, version 3 (CAM3). Initial conditions were supplied by the USGS PRISM2 project and include Pliocene SST's, vegetation cover, sea level height, topography, marine and continental ice extent. Pliocene SST's along the Californian, Peruvian, North African and South African margin were modified to reflect proxy observations from 4 sites. The lack of observational coverage (1 data point per region) required interpolation of the areal extent of the SST warming anomaly indicated by the proxies. Experiment results show increased cumulative precipitation and humidity in regions where the original PRISM2 predicted drying. The predicted North American increase in precipitation is in better agreement with geologic proxies indicating wetter conditions. Warmer SST's also causes weaker wind velocities along the North American, Peruvian, and North African margins, and stronger winds along the

Bedrock hydrogeology Forsmark. Site descriptive modelling, SDM-Site Forsmark

Energy Technology Data Exchange (ETDEWEB)

Follin, Sven (SF GeoLogic AB, Taeby (Sweden))

2008-12-15

The Swedish Nuclear Fuel and Waste Management Company (SKB) has conducted site investigations at two different locations, the Forsmark and Laxemar-Simpevarp areas, with the objective of siting a final repository for spent nuclear fuel according to the KBS-3 concept. Site characterisation should provide all data required for an integrated evaluation of the suitability of the investigated site and an important component in the characterisation work is the development of a hydrogeological model. The hydrogeological model is used by repository engineering to design the underground facility and to develop a repository layout adapted to the site. It also provides input to the safety assessment. Another important use of the hydrogeological model is in the environmental impact assessment. This report presents the understanding of the hydrogeological conditions of the bedrock at Forsmark reached following the completion of the surface-based investigations and provides a summary of the bedrock hydrogeological model and the underlying data supporting its development. It constitutes the main reference on bedrock hydrogeology for the site descriptive model concluding the surface-based investigations at Forsmark, SDM-site, and is intended to describe the hydraulic properties and hydrogeological conditions of the bedrock at the site and to give the information essential for demonstrating understanding

Social Media Sites

Science.gov (United States)

Media Sites Site Registration Contact Us Search AF.mil: Home > AF Sites > Social Media Sites Social Media Welcome to the Air Force social media directory! The directory is a one-stop shop of official Air Force social media pages across various social media sites. Social media is all about

Barium isotope composition of altered oceanic crust from the IODP Site 1256 at the East Pacific Rise

Science.gov (United States)

Nan, X.; Yu, H.; Gao, Y.

2017-12-01

al. (2012) Downhole variation of lithium and oxygen isotopic compositions of oceanic crust at East Pacific Rise, ODP Site 1256. Geochemistry, Geophysics, Geosystems,13(10). Huang F., Nan X., Hu M., Huang S. and Huang J. (2015) Barium isotope compositions of igneous rocks. Goldschm. Abstr.2015, 1331.

Site operations

International Nuclear Information System (INIS)

House, W.B.; Ebenhack, D.G.

1989-01-01

This chapter is a discussion of the management and operations practices used at the Barnwell Waste Management Facility in Barnwell, SC. The following topics are discussed: (1) Waste receiving and inspection, including manifest and certificates of compliance, radiological surveys, disposition of nonconforming items, and decontamination and disposition of secondary waste streams; (2) Waste disposal, including Title 10 CFR 61 requirements, disposal area evaluations, shipment offloading, container emplacement, and radiation protection; (3) Trench closure, including trench backfilling, trench capping, and permanent markers; (4) Site maintenance and stabilization, including trench maintenance, surface water management, and site closure activities; (5) Site monitoring programs, including operational monitoring, and environmental monitoring program; (6) Personnel training and qualifications, including basic training program, safety training program, special skills training, and physical qualifications; (7) Records management, including waste records, personnel training records, personnel dosimetry records, site monitoring records, trench qualification and construction records, and site drawings and stabilization records; (8) Site security; (9) Emergency response plans; and (10) Quality assurance

Polyphase serpentinization history of Mariana forearc mantle: observations on the microfabric of ultramafic clasts from ODP Leg 195, Site 1200

Science.gov (United States)

Kahl, Wolf-Achim; Jöns, Niels; Bach, Wolfgang; Klein, Frieder

2013-04-01

In the forearc of the Mariana subduction zone system, a number of seamounts form from extrusion of blueschist and serpentine mud. Ocean Drilling Program Leg 195 drilled the South Chamorro seamount, where ultramafic clasts occur within the mud matrix. These clasts show a complex serpentinization history, which bears the potential for tracking the alteration history during uplift and cooling of mantle wedge rocks to the seafloor. Moreover, the microfabrics of the highly serpentinized harzburgite and dunite clasts exhibit evidence for multiple fracturing events in the forearc mantle. These, in turn, lead to fluid influx and varied styles of serpentinization of harzburgite and dunite. The serpentinized ultramafic clasts exhibit a variety of microfabrics that range from virtually undeformed to strongly deformed samples. Pervasively serpentinized harzburgites feature either an equigranular fabric of serpentinized olivine and orthopyroxene crystals, or different vein generations related to multiple stages of serpentinization. Several types of fluid pathways in harzburgites are present: (i) veins containing brucite and iron oxides, developed linearly without marked conformance with the rock fabric. In places, these veins developed mm-cm wide halos with finger-shaped serpentinization fronts. Veins of type (i) are either developed as syntaxial veins from a single crack-seal event with large magnetite crystals growing from one wall to the other (as confirmed with high-resolution X-ray microtomography), or formed by multiple fluid events. (ii) serpentine veins that encompass regions of marginally serpentinized, microgranular olivine and large orthopyroxene crystals. (iii) extensional serpentine veins (known as "Frankenstein" type). In the clasts studied, their occurrence is restricted to the halo region of type (i) veins. (iv) as a late-stage feature, extensional veins documenting multiple crack-seal events can be present in the serpentinites (either in undeformed regions with preserved equigranular fabric, or in serpentinites of type (i) and (ii) where they crosscut and offset earlier vein generations). In addition, serpentinized dunites can host syntaxial serpentine veins (ribbons). The ribbons separate regions, where recrystallization of serpentine and brucite can be observed. Presumably the lack of orthopyroxene locally influences the rheology and thus enable ribbon formation. The serpentine and/or brucite assemblages formed during these different stages show distinct trace element patterns suggesting a diminished influence of slab-related fluids during later stages of serpentinization. Ongoing work is aimed at reconciling textural and geochemical co-evolution during serpentinization of the mantle wedge. In particular, deciphering deformation-related pathways for serpentinizing fluids and identifying their geochemical signatures may foster our understanding of shallow subduction-related mass transfer in supra-subduction zones.

Towards a robust and consistent middle Eocene astronomical timescale

Science.gov (United States)

Boulila, Slah; Vahlenkamp, Maximilian; De Vleeschouwer, David; Laskar, Jacques; Yamamoto, Yuhji; Pälike, Heiko; Kirtland Turner, Sandra; Sexton, Philip F.; Westerhold, Thomas; Röhl, Ursula

2018-03-01

present a revision of previous astronomical timescales from the Equatorial and South Atlantic, to overcome the differences between different mid-Eocene astrochronologies. Using our new records from the North Atlantic, combined with existing records from the South Atlantic (ODP Site 1263 and Hole 702B) and Equatorial Atlantic (ODP Site 1260), we revise the durations of magnetic polarity Chrons C18n.1n to C21n, thereby arriving at a robust and self-consistent closure of the middle Eocene astronomical timescale gap.

A new horned crocodile from the Plio-Pleistocene hominid sites at Olduvai Gorge, Tanzania.

Directory of Open Access Journals (Sweden)

Christopher A Brochu

Full Text Available BACKGROUND: The fossil record reveals surprising crocodile diversity in the Neogene of Africa, but relationships with their living relatives and the biogeographic origins of the modern African crocodylian fauna are poorly understood. A Plio-Pleistocene crocodile from Olduvai Gorge, Tanzania, represents a new extinct species and shows that high crocodylian diversity in Africa persisted after the Miocene. It had prominent triangular "horns" over the ears and a relatively deep snout, these resemble those of the recently extinct Malagasy crocodile Voay robustus, but the new species lacks features found among osteolaemines and shares derived similarities with living species of Crocodylus. METHODOLOGY/PRINCIPAL FINDINGS: The holotype consists of a partial skull and skeleton and was collected on the surface between two tuffs dated to approximately 1.84 million years (Ma, in the same interval near the type localities for the hominids Homo habilis and Australopithecus boisei. It was compared with previously-collected material from Olduvai Gorge referable to the same species. Phylogenetic analysis places the new form within or adjacent to crown Crocodylus. CONCLUSIONS/SIGNIFICANCE: The new crocodile species was the largest predator encountered by our ancestors at Olduvai Gorge, as indicated by hominid specimens preserving crocodile bite marks from these sites. The new species also reinforces the emerging view of high crocodylian diversity throughout the Neogene, and it represents one of the few extinct species referable to crown genus Crocodylus.

Late Paleogene-early Neogene dinoflagellate cyst biostratigraphy of the eastern Equatorial Atlantic

Science.gov (United States)

Awad, Walaa K.; Oboh-Ikuenobe, Francisca E.

2018-04-01

Six dinoflagellate cyst biozones (zone 1-zone 5, subzones 1a and 1b) are recognized in the late Paleogene-early Neogene interval of the Ocean Drilling Program (ODP) Site 959 (Hole 959 A), Côte d'Ivoire-Ghana Transform Margin in the eastern Equatorial Atlantic. The biozones are based on palynological analysis of 30 samples covering a 273.2-m interval with generally fair preservation and good to poor recovery. We propose a new age of Late Eocene (Priabonian) for subunit IIB as opposed to the previously published mid-Early Oligocene age (middle Rupelian). This age assignment is mainly based on the presence of Late Eocene marker taxa, such as Hemiplacophora semilunifera and Schematophora speciosa in the lower part of the studied interval. We also document for the first time a hiatus event within dinoflagellate cyst zone 3, based on the last occurrences of several taxa. This interval is assigned to an Early Miocene age and is barren of other microfossils. Furthermore, we propose new last occurrences for two species. The last occurrence of Cerebrocysta bartonensis is observed in the late Aquitanian-early Burdigalian in this study vs. Priabonian-early Rupelian in mid and high latitude regions. Also, the last occurrence of Chiropteridium galea extends to the latest Early Miocene (Burdigalian) in ODP Hole 959 A; this event was previously identified in other studies as Chattian in equatorial regions, and Aquitanian in the Northern Hemisphere mid-latitudes. We suspect that these differences are due to physical (offshore vs. nearshore) and latitudinal locations of the areas studied.

``Out To Sea: Life as a Crew Member Aboard a Geologic Research Ship'' - Production of a Video and Teachers Guide.

Science.gov (United States)

Rack, F. R.; Tauxe, K.

2004-12-01

In May 2002, Joint Oceanographic Institutions (JOI) received a proposal entitled "Motivating Middle School Students with the JOIDES Resolution", from a middle school teacher in New Mexico named Katie Tauxe. Katie was a former Marine Technician who has worked aboard the R/V JOIDES Resolution in the early years of the Ocean Drilling Program (ODP). She proposed to engage the interest of middle school students using the ODP drillship as the centerpiece of a presentation focused on the lives of the people who work aboard the ship and the excitement of science communicated through an active shipboard experience. The proposal asked for travel funds to and from the ship, the loan of video camera equipment from JOI, and a small amount of funding to cover expendable supplies, video editing, and production at the local Public Broadcasting Station in Los Alamos, NM. Katie sailed on the transit of the JOIDES Resolution through the Panama Canal, following the completion of ODP Leg 206 in late 2002. This presentation will focus on the outcome of this video production effort, which is a 19 minute-long video entitled "Out to Sea: Life as a Crew Member Aboard a Geologic Research Ship", and a teacher's guide that can be found online.

Three-dimensional modeling of HCFC-123 in the atmosphere: assessing its potential environmental impacts and rationale for continued use.

Science.gov (United States)

Wuebbles, Donald J; Patten, Kenneth O

2009-05-01

HCFC-123 (C2HCl2F3) is used in large refrigeration systems and as a fire suppression agent blend. Like other hydrochlorofluorocarbons, production and consumption of HCFC-123 is limited under the Montreal Protocol on Substances that Deplete the Ozone Layer. The purpose of this study is to update the understanding of the current and projected impacts of HCFC-123 on stratospheric ozone and on climate and to discuss the potential environmental effects from continued use of this chemical for specific applications. For the first time, the Ozone Depletion Potential (ODP) of a HCFC is determined using a three-dimensional model (MOZART-3) of atmospheric physics and chemistry. All previous studies have relied on results from two-dimensional models. The derived HCFC-123 ODP of 0.0098 is smaller than previous values. Analysis of the projected uses and emissions of HCFC-123, assuming reasonable levels of projected growth and use in centrifugal chiller and fire suppressant applications, suggests an extremely small impact on the environment due to its short atmospheric lifetime, low ODP, low Global Warming Potential (GWP), and the small production and emission of its limited applications. The current contribution of HCFC-123 to stratospheric reactive chlorine is too small to be measurable.

Incidence and evolution of subretinal precipitates in optic disc pit maculopathy.

Science.gov (United States)

Chatziralli, Irini; Theodossiadis, George; Brouzas, Dimitrios; Theodossiadis, Panagiotis

2017-06-26

To study the evolution of subretinal precipitates coexistent with optic disc pit (ODP) maculopathy from their appearance at baseline examination until their absorption after successful treatment. Participants in this retrospective, multicenter study were 42 patients with ODP maculopathy, in whom complete ocular examination was performed, including visual acuity (VA) measurement, slit-lamp examination, color or red-free fundus photography, and optical coherence tomography at baseline after surgical treatment. Out of 42 cases, 17 (40.5%) cases of ODP maculopathy, which were examined between 2002 and 2015, were found to have subretinal precipitates associated with multilayer fluid accumulation at baseline. Precipitates were located at the outer part of the photoreceptor layer and remained for 3-6 months after successful treatment and absorption of subretinal fluid. The mean VA was 0.99 ± 0.21 logMAR at baseline and improved to 0.54 ± 0.25 logMAR at the final examination. Macular precipitates in association with signs of disease chronicity, such as multilayer fluid accumulation, became evident at baseline examination. Precipitates' disappearance in 15 out of 17 cases coincided with the absorption of subretinal fluid. The relative low VA at baseline probably could be attributed to the chronicity of the disease.

Confidence assessment. Site-descriptive modelling SDM-Site Laxemar

International Nuclear Information System (INIS)

2009-06-01

The objective of this report is to assess the confidence that can be placed in the Laxemar site descriptive model, based on the information available at the conclusion of the surface-based investigations (SDM-Site Laxemar). In this exploration, an overriding question is whether remaining uncertainties are significant for repository engineering design or long-term safety assessment and could successfully be further reduced by more surface-based investigations or more usefully by explorations underground made during construction of the repository. Procedures for this assessment have been progressively refined during the course of the site descriptive modelling, and applied to all previous versions of the Forsmark and Laxemar site descriptive models. They include assessment of whether all relevant data have been considered and understood, identification of the main uncertainties and their causes, possible alternative models and their handling, and consistency between disciplines. The assessment then forms the basis for an overall confidence statement. The confidence in the Laxemar site descriptive model, based on the data available at the conclusion of the surface based site investigations, has been assessed by exploring: - Confidence in the site characterization data base, - remaining issues and their handling, - handling of alternatives, - consistency between disciplines and - main reasons for confidence and lack of confidence in the model. Generally, the site investigation database is of high quality, as assured by the quality procedures applied. It is judged that the Laxemar site descriptive model has an overall high level of confidence. Because of the relatively robust geological model that describes the site, the overall confidence in the Laxemar Site Descriptive model is judged to be high, even though details of the spatial variability remain unknown. The overall reason for this confidence is the wide spatial distribution of the data and the consistency between

Confidence assessment. Site-descriptive modelling SDM-Site Laxemar

Energy Technology Data Exchange (ETDEWEB)

2008-12-15

The objective of this report is to assess the confidence that can be placed in the Laxemar site descriptive model, based on the information available at the conclusion of the surface-based investigations (SDM-Site Laxemar). In this exploration, an overriding question is whether remaining uncertainties are significant for repository engineering design or long-term safety assessment and could successfully be further reduced by more surface-based investigations or more usefully by explorations underground made during construction of the repository. Procedures for this assessment have been progressively refined during the course of the site descriptive modelling, and applied to all previous versions of the Forsmark and Laxemar site descriptive models. They include assessment of whether all relevant data have been considered and understood, identification of the main uncertainties and their causes, possible alternative models and their handling, and consistency between disciplines. The assessment then forms the basis for an overall confidence statement. The confidence in the Laxemar site descriptive model, based on the data available at the conclusion of the surface based site investigations, has been assessed by exploring: - Confidence in the site characterization data base, - remaining issues and their handling, - handling of alternatives, - consistency between disciplines and - main reasons for confidence and lack of confidence in the model. Generally, the site investigation database is of high quality, as assured by the quality procedures applied. It is judged that the Laxemar site descriptive model has an overall high level of confidence. Because of the relatively robust geological model that describes the site, the overall confidence in the Laxemar Site Descriptive model is judged to be high, even though details of the spatial variability remain unknown. The overall reason for this confidence is the wide spatial distribution of the data and the consistency between

Siting guidelines and their role in repository site selection

International Nuclear Information System (INIS)

Hanlon, C.L.

1985-01-01

The first requirement of the Nuclear Waste Policy Act was for the Secretary of Energy to issue general guidelines for siting repositories. The guidelines were to specify detailed geologic considerations that would be the primary criteria for the selection of sites in various host rocks, as well as factors that would qualify or disqualify any site from development as a repository. These guidelines were clearly intended to provide not only the framework for the siting program but also the stimulus for establishing effective communication and consultation among the parties involved in the program. The Act further required that the guidelines be a factor in the development of all future decision documents of the Office of Civilian Radioactive Waste Management, including the environmental assessments that would accompany the nomination of sites for characterization, the site-characterization plans that are to be prepared before the sinking of exploratory shafts at any candidate site, and the environmental impact statement that is to support the recommendation of a site for development as a repository. More than two years after its passage, the intention of the Act for the guidelines has been realized. Concurred in by the Nuclear Regulatory Commission on June 22, 1984, and issued by the Department in November 1984, the guidelines include postclosure technical guidelines that apply to conditions governing the long-term performance of the repository system; preclosure technical guidelines that apply to conditions governing the siting, construction, operation, and closure of the repository; and system guidelines whose objective is to ensure that the regulatory requirements of the Environmental Protection Agency and the Nuclear Regulatory Commission are met

SiteGuide: An example-based approach to web site development assistance

NARCIS (Netherlands)

Hollink, V.; de Boer, V.; van Someren, M.; Filipe, J.; Cordeiro, J.

2009-01-01

We present ‘SiteGuide’, a tool that helps web designers to decide which information will be included in a new web site and how the information will be organized. SiteGuide takes as input URLs of web sites from the same domain as the site the user wants to create. It automatically searches the pages

Feedback from performance assessment to site characterisation. The SITE-94 example

International Nuclear Information System (INIS)

Dverstorp, B.; Geier, J.

1999-01-01

Interaction and information exchange between site characterisation and performance assessment are key features of any successful radioactive waste management programme. Some examples are presented of the types of feedback that can be offered from performance assessment to site characterisation, based on SKI's most recent performance assessment project, SITE-94. SITE-94 in Sweden was an assessment of a hypothetical repository for spent nuclear fuel, based on real data gathered in the surface-based investigation of the Aespoe Hard Rock Laboratory site. Examples of feedback are given concerning quality control of data and site investigation procedures, identification of key parameters for the performance assessment, use of models for planning and evaluation of a site investigation, data sampling strategies, and guidance on future priorities for further development of site investigation methods. Because site characterisation serves multiple purposes, including provision of data for repository design and construction, it must account for and compromise among requirements from several lines of analyses in the performance assessment. (author)

Dicty_cDB: CHC347 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHC347 (Link to dictyBase) - - - - CHC347P (Link to Original s...ite) CHC347F 184 CHC347Z 431 CHC347P 595 - - Show CHC347 Library CH (Link to library) Clone ID CHC347 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts...KRNKLIFNYKKK--- ---IGFGCLAXPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPREC NPRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KKK--- ---IGFGCLAXPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPREC NPRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT

Site characterization plan:

International Nuclear Information System (INIS)

1988-01-01

The Yucca Mountain site in Nevada is one of three candidate sites for the first geologic repository for radioactive waste. On May 28, 1986, it was recommended for detailed study in a program of site characterization. This site characterization plan (SCP) has been prepared in accordance with the requirements of the Nuclear Waste Policy Act to summarize the information collected to date about the geologic conditions at the site;to describe the conceptual designs for the repository and the waste package;and to present the plans for obtaining the geologic information necessary to demonstrate the suitability of the site for repository, to design the repository and the waste package, to prepare an environmental impact statement, and to obtain from the US Nuclear Regulatory Commission (NRC) an authorization to construct the repository. This introduction begins with a brief section on the process for siting and developing a repository, followed by a discussion of the pertinent legislation and regulations. A description of site characterization is presented next;it describes the facilities to be constructed for the site characterization program and explains the principal activities to be conducted during the program. Finally, the purpose, content, organizing principles, and organization of this site characterization plan are outlined, and compliance with applicable regulations is discussed

Fish production and diversity in the Paleocene-Eocene Thermal Maximum—Increased production but no novel faunas during a "Future Earth" analog

Science.gov (United States)

Tomczik, D. W.; Norris, R. D.; Gaskell, D. E.

2014-12-01

A partial analog for future global change is the Paleocene-Eocene Thermal Maximum—a transient episode of warming, acidification, and biogeographic change at ~55.5 Ma. The PETM is known to have triggered extinction in some deep sea biotas, extensive biogeographic range shifts, and the common occurrence of 'excursion biotas'—non-analog occurrences of species that are typically rare in the open ocean before or after the PETM. Here we report on the impact of the PETM on fish production and biodiversity. Our data include the mass accumulation rate of fish teeth and denticles as well as an analysis of tooth morphotypes for three PETM sites: ODP 1220 and 1209 in the Pacific, and ODP 1260 in the equatorial Atlantic. Tooth morphotypes hardly change through the PETM and consist of abundant midwater species (angler fish and flashlight fish) in addition to sharks and epipelagic fish. There is no evidence for a non-analog 'excursion biota' during the PETM, suggesting that fish experienced fewer geographic range shifts than the calcareous and organic-walled plankton where excursion biotas are commonplace. Fish mass accumulation rates are also relatively stable before and after the PETM although all sites show a transient rise in fish production at the onset of the PETM or within the later part of the "PETM Core". These results broadly match published estimates of PETM export production from biogenic barium fluxes. Our findings run counter to "Future Earth" models that use climate forecasts for the next century to predict the impact of global change on fish stocks. These models suggest that future warming and ocean stratification will decrease most tropical and subtropical ocean fish production, accentuate fish production in the boundary currents and generally shift production toward higher latitudes. A resolution of "Future Earth" models and PETM data may reflect the different timescales of observation and stages of ecological response to severe global change.

A Holocene record of ocean productivity and upwelling from the northern California continental slope

Science.gov (United States)

Addison, Jason A.; Barron, John A.; Finney, Bruce P.; Kusler, Jennifer E.; Bukry, David; Heusser, Linda E.; Alexander, Clark R.

2018-01-01

The Holocene upwelling history of the northern California continental slope is examined using the high-resolution record of TN062-O550 (40.9°N, 124.6°W, 550 m water depth). This 7-m-long marine sediment core spans the last ∼7500 years, and we use it to test the hypothesis that marine productivity in the California Current System (CCS) driven by coastal upwelling has co-varied with Holocene millennial-scale warm intervals. A combination of biogenic sediment concentrations (opal, total organic C, and total N), stable isotopes (organic matter δ13C and bulk sedimentary δ15N), and key microfossil indicators of upwelling were used to test this hypothesis. The record of biogenic accumulation in TN062-O550 shows considerable Holocene variability despite being located within 50 km of the mouth of the Eel River, which is one of the largest sources of terrigenous sediment to the Northeast Pacific Ocean margin. A key time interval beginning at ∼2900 calibrated years before present (cal yr BP) indicates the onset of modern upwelling in the CCS, and this period also corresponds to the most intense period of upwelling in the last 7500 years. When these results are placed into a regional CCS context during the Holocene, it was found that the timing of upwelling intensification at TN062-O550 corresponds closely to that seen at nearby ODP Site 1019, as well as in the Santa Barbara Basin of southern California. Other CCS records with less refined age control show similar results, which suggest late Holocene upwelling intensification may be synchronous throughout the CCS. Based on the strong correspondence between the alkenone sea surface temperature record at ODP Site 1019 and the onset of late Holocene upwelling in northern California, we suggest that CCS warming may be conducive to upwelling intensification, though future changes are unclear as the mechanisms forcing SST variability may differ.

SiteFind: A software tool for introducing a restriction site as a marker for successful site-directed mutagenesis

Directory of Open Access Journals (Sweden)

Evans Paul M

2005-12-01

Full Text Available Abstract Background Site-directed mutagenesis is a widely-used technique for introducing mutations into a particular DNA sequence, often with the goal of creating a point mutation in the corresponding amino acid sequence but otherwise leaving the overall sequence undisturbed. However, this method provides no means for verifying its success other than sequencing the putative mutant construct: This can quickly become an expensive method for screening for successful mutations. An alternative to sequencing is to simultaneously introduce a restriction site near the point mutation in manner such that the restriction site has no effect on the translated amino acid sequence. Thus, the novel restriction site can be used as a marker for successful mutation which can be quickly and easily assessed. However, finding a restriction site that does not disturb the corresponding amino acid sequence is a time-consuming task even for experienced researchers. A fast and easy to use computer program is needed for this task. Results We wrote a computer program, called SiteFind, to help us design a restriction site within the mutation primers without changing the peptide sequence. Because of the redundancy of genetic code, a given peptide can be encoded by many different DNA sequences. Since the list of possible restriction sites for a given DNA sequence is not always obvious, SiteFind automates this task. The number of possible sequences a computer program must search through increases exponentially as the sequence length increases. SiteFind uses a novel "moving window" algorithm to reduce the number of possible sequences to be searched to a manageable level. The user enters a nucleotide sequence, specifies what amino acid residues should be changed in the mutation, and SiteFind generates a list of possible restriction sites and what nucleotides must be changed to introduce that site. As a demonstration of its use, we successfully generated a single point mutation

Neutron flux density and secondary-particle energy spectra at the 184-inch synchrocyclotron medical facility

International Nuclear Information System (INIS)

Smith, A.R.; Schimmerling, W.; Henson, A.M.; Kanstein, L.L.; McCaslin, J.B.; Stephens, L.D.; Thomas, R.H.; Ozawa, J.; Yeater, F.W.

1978-07-01

Helium ions, with an energy of 920 MeV, produced by the 184-inch synchrocyclotron of the Lawrence Berkeley Laboratory are now being used in a pilot series to determine their efficacy in the treatment of tumors of large volume. The techniques for production of the large uniform radiation fields required for these treatments involve the use of beam-limiting collimators and energy degraders. Interaction of the primary beam with these beam components produces secondary charged particles and neutrons. The sources of neutron production in the beam transport system of the alpha-particle beam have been identified and their magnitudes have been determined. Measurements with activation detectors and pulse counters of differing energy responses have been used to determine secondary particle spectra at various locations on the patient table. These spectra are compared to a calculation of neutron production based on best estimates derived from published cross sections. Agreement between the calculated spectra and those derived from experimental measurements is obtained (at the 10 to 20% level) when the presence of charged particles is taken into account. The adsorbed dose in soft tissue is not very sensitive to the shape of the incident neutron energy spectrum, and the values obtained from unfolding the experimental measurements agree with the values obtained from the calculated spectra within the estimated uncertainty of +-25%. These values are about 3 x 10 -3 rad on the beam axis and about 1 x 10 -3 rad at 20 cm or more from the beam axis, per rad deposited by the incident alpha-particle beam. Estimates of upper limit dose to the lens of the eye and red bone marrow are approximately 10 rad and approximately 1 rad, respectively, for a typical treatment plan. The absorbed dose to the lens of the eye is thus well below the threshold value for cataractogenesis estimated for fission neutrons. An upper limit for the risk of leukemia is estimated to be approximately 0.04%